current user: public

If you have questions about the server, please let us know.

Query: 4wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst MAMFEHIDAYPGDPILTLNENFQKDPRDQKVNLSIGIYFDAEGRIPVMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLQTLGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGMFTYTGLTESQVDALREVHGVYILRSGRMCVAGLNDSNVGIVADAIGKVLKSGALast
1 -128.0004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model  100  1MAMFEHIDAYPGDPILTLNENFQKDPRDQKVNLSIGIYFDAEGRIPVMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLQTLGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGMFTYTGLTESQVDALREVHGVYILRSGRMCVAGLNDSNVGIVADAIGKVLKSGA 402
2 -124.0001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  42  1..MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGLVNVAGMTPDNMAPLCEAIVAVL.... 396
3 -124.0001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  42  1..MFENITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.... 396
4 -124.0004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  43  3VGTFENITAAPADPILGLADLFRADERPGKVDLGIGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.... 400
5 -124.0001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  42  1..MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL.... 396
6 -122.0004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  51  16MSLFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYTNEDGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVLK... 414
7 -121.0001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  39  1..MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKS---ETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVG.... 393
8 -121.0001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  43  1..MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.... 396
9 -120.0004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  42  3VGTFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.... 400
10 -120.0002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  41  1..MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.... 396
11 -119.0002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  41  1..MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL.... 396
12 -118.0003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  59  1..MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM.... 397
13 -118.0005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  41  2.SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK... 401
14 -118.0003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  41  2.SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK... 401
15 -116.0004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  42  1......MAMGKPDPILGLGQDFRMDPAKRKVNLSIGVYRDDADQPFVLECVKQAT-----LGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRIASCQTLGGTGALRIGGDLLRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQDYDAFVPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTGLTREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVSQAIHNVTK... 390
16 -115.0003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  42  1..MFENITAAPADPILGLADLFRADERPGKINLGQGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIYANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.... 396
17 -113.0004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  41  8AQTQGPGSMGKPDPILGLGQDFRMDPAKRKVNLSIGVYRDDADQPFVLECVKQAT-----LGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRIASCQTLGGTGALRIGGDLLRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQDYDAFVPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTGLTREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVSQAIHNVTK... 403
18 -112.0001yaa_A mol:protein length:412 ASPARTATE AMINOTRANSFERASE  ali model follow..  39  2ATLFNNIELLPPDALFGIKQRYGQDQRATKVDLGIGAYRDDNGKPWVLPSVKAAEKLIHNDSSNHEYLGITGLPSLTSNAAKIIFGTQSDALQEDRVISVQSLSGTGALHISAKFFSKFFPDKLVYLSKPTWANHMAIFENQGLKTATYPYWANETKSLDLNGFLNAIQKAPEGSIFVLHSCAHNPTGLDPTSEQWVQIVDAIASKNHIALFDTAYQGFATGDDKDAYAVRLGVETVSPVFVCQSFAKNAGMYGERVGCFHLALTKQAQNKTVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQMVKRLEETHAVYLVASGRASIAGLNQGNVEYVAKAIDEVVRFYA 412
19 -112.0003wzf_A mol:protein length:412 Aspartate aminotransferase, cytoplasmic  ali model follow..  37  3PSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKINDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWNKNTPVYVSSPTWENHNAVFSAAGFKIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ 412
20 -109.0003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  38  1.........MQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKINDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLGTNNKNTPVYVSSPTWENHNAVFSAAGFKIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIA 401
21 -106.0004rkc_A mol:protein length:398 Aromatic amino acid aminotransferase  ali model follow..  51  1..MFERIDYYAGDPILGLVEKFAADNNPDKVNLGIGIYYDESGVMPVLDCVKIAEQRIADPISPRPYLPMAGLPGHRKGCQELLFGKDAPVLKDGLVATIATIGGSGALKVGAEFIHEWFPQSKCYVSDPTWGNHIAIFEGCDIEVGKYPYYDTATGGIKFDEMIAFFETLNKDDVLLLHPCCHNPTGVDLTREQWDTVLNVIQERELIPFMDIAYQGFGEDMDSDAYAIRKAVDMGLPLFVSNSFSKNLSLYGERVGGLSVVCPTVDETERVFGQLNSTVRRIYSSPPSHGGRVVDIVMNDAALHEQWVGEVYAMRDRIKSMRTKLKSVLEAKISGRNFDYLTAQNGMFSFTGLTPEQVERLQSEFGIYMISNSRMCVAGLNSSNIDYVANAMVDVLKD.. 398
22 -105.0001aat_A mol:protein length:411 CYTOSOLIC ASPARTATE AMINOTRANSFERASE  ali model follow..  37  2ASIFAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGNSLNHEYLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFLRRWNTATPVYVSSPTWENHNSVFMDAGFKDIRTYYWDAAKRGLDLQGLLSDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGNEKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNLDYVAKSIHEAVTKIQ 411
23 -105.0004f5g_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  43  3VGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSKNFGLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFVIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL.... 400
24 -104.0002d5y_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  42  1..MFENITTAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL.... 396
25 -103.0004f5k_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  43  3VGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSKNFSLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL.... 400
26 -103.0004f5f_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  43  3VGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVGADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL.... 400
27 -103.0003uak_A mol:protein length:406 De Novo designed cysteine esterase ECH14  ali model follow..  40  1..MFENITAAPADPIYGLADLFRADERPGKINLGLALYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGHGALRVAADFLAKNTSVKRVWVYNPSSNCSKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFTGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFTFFYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNESVGACTLVAADSETVDRAFSQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVLGSLE 400
28 -103.0004f5i_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  43  3VGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSKNFSLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL.... 400
29 -101.0003meb_A mol:protein length:448 Aspartate aminotransferase  ali model follow..  35  16MSVFSGFPASPPDAILNLTVLYNADTNPKKVNLGVGAYRDESGKPWILPAVKEAEAIISSDLSNKEYPPVAGFPLFLEAAQFLMFGKDSKAAQEGRIASCQSLSGTGSLHIGFEFLHLWMPKAEFYMPSTTWPNHYGIYDKVFNKLKVTYLRKDGELEIDFSNTKKDIQSAPEKSIFLFHACAHNPSGIDFTEAQWKELLPIMKEKKHIAFFDSAYQGFATGSEADAFAVRMFVDAGVEVLVAQSFSKNFGLYGERIGCLHVVHAGVEGSVEKVSGMTLQIRKTWSMSAIHGAYIVQVIVHDKRLLQMFYDNVKEMSARIHRMRSLLHASLAKRKTPGTWDHILTAIGMFTFTGLTPEHVDYLKEKWSIYLVKGGRMSMCGLTESNCDYVAEAIHDAVTKLP 439
30 -101.0005ton_A mol:protein length:414 Aspartate aminotransferase, cytoplasmic  ali model follow..  37  5PSVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANNSLNHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLARWYNGTPVYVSSPTWENLNGVFTTAGFDIRSYRYWDTEKRGLDLQGFLSDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLINQKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ 414
31 -99.6001aka_A mol:protein length:401 ASPARTATE AMINOTRANSFERASE  ali model follow..  40  2.SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDNRDAWALRHFIEQGIDVVLSQSYAHNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK... 401
32 -95.7004h51_A mol:protein length:420 Aspartate aminotransferase  ali model follow..  35  12AERWQKIQAQAPDVIFDLAKRAAAAKGP-KANLVIGAYRDEQGRPYPLRVVRKAEQLLLDMNLDYEYLPISGYQPFIDEAVKIIYGNTVEL---ENLVAVQTLSGTGAVSLGAKLLTRVAETTPIYLSDPTWPNHYGVVKAAGWNICTYAYYDPKTVSLNFEGMKKDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEYC-QNHNIFITVSGRANMAGLTHETALMLAQTINDAVRNVN 412
33 -95.4003k7y_A mol:protein length:405 Aspartate aminotransferase  ali model follow..  28  3.KLLSSLENIEVDNILKTAREFKEDTCEEKINLSIGVCCNDDGDLHIFDSVLNADKLVTENYKEKPYLLGNGTEDFSTLTQNLIFGNNSKYIEDKKICTIQCIGGTGAIFVLLEFLKML-NVETLYVTNPPYINHVNMIESRGFNLKYINFFDYNLIDINYDLFLNDLRNIPNGSSVILQISCYNPCSVNIEEKYFDEIIEIVLHKKHVIIFDIAYQGFGHTNEEDVLLIRKFEEKNIAFSVCQSFSKNMSLYGERAGALHIVCKNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQLLNNQNLKLNWIKELSQLSQRITNNRILFFNKLETYNLNYDWNVYKKQRGLFSFVPLLAKIAEHL-KTHHIYIINNGRINVSGITKNNVDYIADKICLSLSQI. 405
34 -92.9004wb0_A mol:protein length:414 Broad specificity aminotransferase  ali model follow..  35  12TERWQKIQGRAPDPIFELAKRAAAAKGP-KANLVIGAYRDEQGLPYPLRVVRKAEQLLLDMNLNYEYLPISGYQPFIDEAVKMTYGDTV---ELENLVAVQTLSGTGALSLGAKLLTHVAEKTPIYLADPTWPNHYSIVKAAGWKIRTYAYYDHKTLGLDFEGMKKDILAAPDGSVFLLHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIRAEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGRWEHVINQIGMFSFLGLSKEQCEYC-QNHNIFITLSGRANIAGLTHETALMLAQTINDAVRNVN 412
35 -80.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  21  6MTIKRATWNNGPDLAFDINAAIEKYGREAVINAALGTLLDDKGKIIALPSVYDRLDEM-DRSHIASYAPIEGEKDYRKIVIDTLFGPYKPE---GYISAIATPGGTGA--IRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDF-AFNIDVYKEAIDEGSDRIASLINSPGNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGISSSKEIIEEFEASLAHSARCNWSNGT-HAAQNILIELERAENKKIYEQELVDLRNMLKSRADVFVTAAKENK----LTMIPYFGGFFTFIPTDKFDIVKDLEKENIFTIPSIRVAICGVGEEKIPKLVQRLAFYTNK.. 412
36 -80.4003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  21  7VAAKHAKGKKLKDVIFVTAGQAQENGRENVVNGTLGAIHDEEGNLVFLKTVKEEYLSLS-DSEHVGYAPIAGIPDFLCAAEKECFGNFRPE---GHIRSIATAGGTGG--IHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHNN--AFQNRVNELAAKQTNVVVIFNTPGNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKETCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNKSTSRATWSNICRPAMRTMANIVADPAKFKEYEAERNCYYQLIRDRADIFKQEAAQVG----LPMLPYRGGFFITIPTDSANCEELKKEYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLG 416
37 -72.7002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  16  8QSLNEQLQQSNATAFAMLSDLGQAEAKSTTYNATIGMATNKDGKM-FASSLDAMFNDLTPDE-IFPYAPPQGIEELRDLWQQKMLRDNPELSIDNMSRPIVTNALTHG--LSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALQSYNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTFTALTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNK---QFDKEIEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHEALRKHLIDKYSIGVIADIRIAFSCVEKDDIPHVFDSIAKAIDDLR 430
38 -64.8001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  1MALSDRLELVSASEIRKLFDIAAG--MKDVISLGIGEP-DFDTPQHIKEYAKEA-----LDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKTEI---MVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYV---TDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDAR-HYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAP-------SWIIERMVKFQMYNATCPVTFIQYAAAKALKDERKAVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPR---IRDTGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATEKLEEAMDRME 380
39 -63.5001xi9_A mol:protein length:406 putative transaminase  ali model follow..  14  4IRASKRALSV-EYAIRDVVLPARELEKKKVIRLNIGDPVDFQPPEHMKEAYCKA-----IKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVR----VTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKI---TDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGS---LTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKL--SEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPWKN--DKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPEILEEAMDRFE 391
40 -62.4004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  14  8.RFNKNLNKIEVSMIRQFDQSISD--IPDVLKLTLGEP-DFATPKHIKEAAKRA-----IDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDNEI---LVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT-RSNDFVLTPEMLEEAILKEGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEYLPD---QTILISGLSKSHAMTGWRLGLIFAP-------AVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVAQGQD--SFKFLQDFAKEKAVAFIPGVRISYAA-SMETIKEAMKRLKEFMEQYA 392
41 -62.3003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  13  7.KFKKLGTDNAPGQEVRQSAAGLEALIRRPVDFSHGDVDAHEP----TPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGL---IITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLADETRAGLDLTGLEEAF---KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVS-------LRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL---AVAPAEFVKILRLQAGVVVTPGTRLNFSQ-DHEAAVAAARRIVTLVERYR 406
42 -62.1001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  16  1MKLAARVESVSPSMTLIIDAKAKAMKAEDVCSFSAGEP-DFNTPKHIVEAAKAA-----LEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNIL----VTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAI---TPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAASPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHST-------SNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPS---IAKTGRSSLDFCSELLDQHQVATVPGARLSYAT-DLDTIKRGMERLEKFLHGI. 387
43 -60.2001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  17  3.GLSRRVQAMKPSATVAVNAKALELRRQDLVALTAGEP-DFDTPEHVKEAARRA-----LAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETI----VTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAI---TPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGR-----APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQST-------TSPDTIAQWATLEALTNQEAFVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMD---TSPIAPDEVRAAERLLEA-GVAVVPGTRLSYAT-SEENLRKALERFARVLGRA. 385
44 -60.2005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  11  1.ANAKRIEGLDSNVWVEFTKLAAD---PSVVNLGQGFP-DISPPSYVKEELSKA----AFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEI---LVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKF---SSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHT-HVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSL-SDEPYDYKFVKWMTKHKKLTAIPVSRFCFIK-KDSTLDAAEEIFRA...... 409
45 -60.0003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  16  4..KNSSRSAVDPFIVMDVMEAARRAEEARIIHMEVGQP-GTGAPRGAVEALAKS-----LETDALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVV----ITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF------AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKA-----VTALELTDECYVINSFSKYFSMTGWRVGWMVVP-------EDQVRVVERIAQNMFICAPHASQVAALAALDCDAELQA-NLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYAD---VSDLTDDSRAFAAEILEKAGVAVTPGLRFSYAR-ATADIEEGLDRLEAFMQARG 383
46 -59.8004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  12  24IEKSSKLENVCYDIRGPVLKEAKRLEEEKVLKLNIGNPAGFDAPDEILVDVIRNL------PTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIY----IGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKI---TPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPL--APDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYI--EGLEMLASMRLCANVPAQHAIQTALGGYQSISEFPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPDDIELSLSKFA 416
47 -59.7001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  16  6IMVSRRISEIPISKTMELDAKAKALIKKDVINLTAGEP-DFPTPEPVVEEAVRF-----LQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVV----VTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLL---VGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDE--FTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTT-------SCINTVAQYAALKALEVDN---SYMVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVRG------DDVKFCERLLEEKKVALVPGSRLSFAT-SIERLTEALDRIEDFLNS.. 382
48 -59.5002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  11  14HMISNKLANIPDSYFGKTMGRKIEHGPLPLINMAVGIP-DGPTPQGIIDHFQKALT----IPENQKYGAFHGKEAFKQAIVDFYQRQYNVTLDKEDEV---CILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQI---IDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKN--PSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTN-------AGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPPGYD----SEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALQKLDEAAIRLT 391
49 -59.2002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  15  9.VFSDRVLLTEESPIRKLVPFAEMAKKRRIHHLNIGQP-DLKTPEVFFERIYEN------KPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVL----VTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIP----QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEF----ASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGR-------LAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPVE-----DAEEFARWMLTDFNTMVAPLRRIACV-LEKDLLSRAIDVLMEGLKMFC 397
50 -58.9003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  15  37VQRNENFGKLRAGYLFPEIARRRKNPDAKIISLGIGDT-TEPLPKYIADAMAKAAAGLATREGYSGYGAEQGQGALREAVASTFYGHAGRAADE-------IFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHFFLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPK-TIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEVHADWNRVMTTCFNGASNIVQAGGLACLQPELKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFPGK-----PSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGENILEAVRRFK 434
51 -58.7001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  15  7..SMSNHAGLVFNPIRTVSDNAKSPSPKPIIKLSVGDP-TLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNELKSTIVKDNVV----LCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLK---DDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFEVPRVILGGTAKNLVVPGWRLGWLLYV-DPHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEYRDIKTDVEFFEKLLEEENVQVLPGTRLTTT-RPVEVYREAVERIKAFCQRHA 414
52 -58.5001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  13  13FDLPKRYQGSTKSVWVEYIQLAAQ---YKPLNLGQGFP-DYHAPKYALNALAAAANS---DPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEV---LVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKDWVLDNNELEALF---NEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFE-HIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETELKRLKSPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSSLDSKVDLDYRFTKWMTKSVGLQGIPPSRYCFFK-KDENLQKAAEILRKWKGS.. 428
53 -58.5005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  16  3.DRVALRAGVPPFYVMDVWLAAAERQRTDLVNLSAGQP-SAGAPEPVRAAAAAA-----LHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVV----ITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQ----MLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA---WQTSRNAVVVNSFSKYYAMTGWRLGWLLVP-------TVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYAD---VSDFTSDSLAFCSKLLADTGVAIAPGIRISFAG-PSGDIEEALRRIGSWLPS.. 387
54 -57.8005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  16  70MSLSPRVQSLKPSKTMVITDLAATLVQSPVIRLAAGEP-DFDTPKVVAEAGINA-----IREGFTRYTLNAGITELREAICRKLKEENGLSYAPDQIL----VSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKL---TEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPAT-HTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVS-------SGASSIAQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGLINDSSSLALYFLDKFQVAMVPGDRISYAT-SLDVLQAAVEKIRKALEPLR 470
55 -57.8003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  12  28YFTSNTAKDVWSLTNEAAAKAANNSKNQELINLGQGFF-SYSPPQFAIKEAQKALD----IPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVT----VTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPITRGEEWTIDFEQFEKAI---TSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFT-DSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNA------ELLSYAAKAHTRICFASPSPLQEACANSINDAL-YFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKV-LNKGKDFRISHWLINELGVVAIPPTRFAVCK-DDAYLENAVERLKLLKDYL. 447
56 -57.3001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  15  6LIPQSKLPQLGTTIFTQMSALAQQ---HQAINLSQGFP-DFDGPRYLQERLAHH-----VAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDI---TVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMAL-QPPHFRVDWQEFAALL---SERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQG-HASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAP-------APISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSAVSTLD--DVEFCQWLTQEHGVAAIPLSRLCFAK-KESTLLAAAERLRQL..... 386
57 -57.0002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  17  1MATVSRLRPYATTVFAEMSALATR---IGAVNLGQGFP-DEDGPPKMLQAAQDA-----IAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEV---LVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPL-DGRGFALDADALRRAV---TPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHAR-HLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGP-------AELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPL---YDDSTEFCAALPEKVGVAAIPMSRFTFCK-RDDTLDEAIRRLSVLAERPA 397
58 -56.6002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  12  2..LSKRLLNFESFEVMDILALAQKLESEKVIHLEIGEP-DFNTPKPIVDEGIKS-----LKEGKTHYTDSRGILELREKISELYKDKYKADIIPDNII----ITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD--------FTVESLEEAL---SDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGK--CYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISN-------DEIIEAILKLQQNLFISAPTISQYAALKAFEKEEREINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPN------IGEDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANENIKEGLERIK 365
59 -56.4002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  12  24VSRNSNMSKLQAGYLFPEIARRRKYPDAQVISLGIGDT-TEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDD-------VFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPEN-LSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNP--RSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGPVAKDFNRIICTCFNGASNISQAGALACLTPELEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPNQ-----SSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGENILEACRRFK 422
60 -56.2004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  12  5.LQARRLDGIDYNPWVEFVKLASE---HDVVNLGQGFP-DFPPPDFAVEAFQHA---VSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNV---LVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSL-SSSNWQLDPMELAGKF---TSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQ-HISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDF-VDEPYDRRFVKWMIKNKGLVAIPVSRFCFVK-DEATLQAMDEKLRKWKVELE 423
61 -55.9001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  18  1MRLHPRTEAAKESIFPRMSGLAQR---LGAVNLGQGFP-SNPPPPFLLEAVRRAL------GRQDQYAPPAGLPALREALAEEF------AVEPESVV----VTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLLTPEGFRLDLSALEKAL---TPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERP----RRLREFAPERTFTVGSAGKRLEATGYRVGWIVGP-------KEFMPRLAGMRQWTSFSAPTPLQAGVAEALKRREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAE---------LPGWDAFRLVEEARVALIPASRFAFC-KTEEELHLALERLGRVVNSPR 372
62 -55.3002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  13  8ARRFARIDRLPPYVFNITAELKMAARRRDIIDLSMGNP-DGPTPPHIVEKLCTVAQ----REDTHGYSTSRGIPRLRRAISHWYRDRYDVQIDPESEA---IVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIR---ESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWK-APSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHD-------YGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPEPYAHLG-SLEFAKKLLQDAKVSVSPGIGFGDYGENRDRLRQAVRGIKAMFRADG 399
63 -55.1003jtx_A mol:protein length:396 aminotransferase  ali model follow..  12  1.GMNTLLKQLKPYPFARLHEAMQGISAPEAVPLHIGEP-KHPTPKVITDALTASL------HELEKYPLTAGLPELRQACANWLKRRDGLTVDADNEI---LPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISE---EVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQALGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHG-------SAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIP---ILQQVFDVKLPDASFYIWLKVPD-----GDDLAFARNLWQKAAIQVLPGRRIALVA-DVATCVKAAEDIVSLYR... 396
64 -54.6003ele_A mol:protein length:398 Amino Transferase  ali model follow..  18  2MVVNESMYQLVRSAIRELFEYGKKRAKENVYDFSIGNP-SIPAPQIVNDTIKELVTD-YDSVALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLY----MTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPA-DTEHFQIDFDALEERI---NAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKRPIFIIADEPYREIVYDGIK----VPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRALGYVCAPSLFQKMIVKCQGATGDINAYKENRDLLYEGLTRI------GYHCFKPDGAFYMFVKALED-----DSNAFCEKAKEE-DVLIVAADRISYC-VDREMIKHSMPAFEKIYKKYN 397
65 -54.5003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  11  14KQNELHIKDLGMASIRDLVALVTNLEKAKFCRMEMGVP-GLPAPQIGIETEIQKLR----EGVASIYPNLDGLPELKQEASRFAKLFVNIDIPARACV----PTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQ---TGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESSSALYALSSGATHSAQWGMAAMLKACDSVIEYGRKARIMKKMFLDNGFNIVYDKDGNEPLADGFYFT----VGYKGMDSSKLIEKFVRYGMCAITLKTRICTSLLPESQFPDLEKRLQMLNAE.. 436
66 -54.5006DK6 Entity 1(prereleased)  ali follow..  15  9..LKLKAGYLFPEIARRVKAFTEGNPEARLIRCGIGDV-TEALPEAVRYAMHEAVDELGNRSTFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFIS-----DGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVY-TPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTI-PHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQWSRRHSTKFNGASYIVQKGAEALYTDEKSQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPAGLT----SWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNANVEEVCRRIA 408
67 -53.9004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  14  38LVRNVNLEKLKNNYLFPEINRREKHPNVQLISLGTGDT-TEPIPEQITSHMSNFAHGLSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHVKSNE-------VFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPCGPNN-LAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSP--RSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELLYSNGPIINDFHRIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFKGS-----KSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGDHIVEASKRLQ 436
68 -53.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  14  21..RPSDMAKKTFNPIRAIVDNMKVKPNPNKISLSIGDPTNLPTDPEVTQAMKDALD----SGKYNGYAPSIGFLSSREEIASYY-HCPEAPLEAKDVI----LTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLI---DEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCK--YEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQ-RILGPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEFPEFENDVEFTERLVAEQSVHCLPATCFEYPNVPEVMMLEACSRIQEFCEQ.. 417
69 -53.4002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  17  3.......RVPEPSVFLVVDEAKRKARERGLIDLSIGST-DLPPPEAPLKALAEALN----DPTTYGYCLKSCTLPFLEEAARWYEGRYGVGLDPRREA---LALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGV---WREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEA--PSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVID-------FNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALK--GVLSLLPPRATMYLWGRLPEGVD----DLEFGLRLVER-GVALAPGRGFGPGGKGFVRIALVREELLEAAKRIR 372
70 -53.0003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  15  4..RPSDMSNKTFNPIRAIVDNMKVKPNPNKISLSIGDPTNLPTDPEVTQAMKDALD----SGKYNGYAPSIGYLSSREEVASYY-HCPEAPLEAKDVI----LTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLI---DEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCK--YEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQ-RILGPCTIVQGALKSILRTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEFPEFENDVEFTERLIAEQSVHCLPATCFEYPNVPEVMMLEACSRIQEFCEQ.. 400
71 -52.7003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  17  1MKRNPHFVSLTKNYLFADLQKRVAQPQHTVINLSIGDT-TQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFIS-----DGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKIIALPCLQENAFFPEFP--------EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSL-PKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGHVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQLE--AIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVK---PTQANISDRDLFDFFLREYHIAITPGIGFGRSGGKREDILAACERLQMAPALQS 394
72 -52.5004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  11  37....SKHAQRTLQPLNNLTDNMKSRSTKSNLRLSIGDPTNLKTPDIVTEAMVDVVR----SGKFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWENVITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMV---DSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADF--DTNVPRLILGGTAKYQVCPGWRVGWSILI-DPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLYFQDLKSDMEFYEKLLDEENVQVLPGEIFGMSGRPSAVLNEAVDRIIEFCERHK 437
73 -52.4003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  12  2.......MTFEPYPFERLRALLKEITPKRGLDLGIGEP-QFETPKFIQDALKNHT------HSLNIYPKSAFEESLRAAQRGFFKRRFKIELKENELIS--TLGSREVLFNFPSFVLFDYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPSLNE------KELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLCMLAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLG-------YTSANAIQKASEAAWLDDR-------HAEFFRNIYANNLKLARKIFNTLIYPYSFY-------VYLPVQNGENFAKTLYQNEGIITLPALRLALV-YDTPLLEKPLEIIETYRENHA 376
74 -51.5004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  13  14HMSSLRPRREDPPVLEEWYRRHLGPDIHDISSSGVHPYSFAE------IRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAGGDADRV---------LVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLV---TPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEV----LADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTT-------LFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELERAAAEVERFCLELLERHRTLLVPGTRLGF-GGPQEDFRAGLDGLSRFLRERA 397
75 -51.5003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  11  63.....NPQSLGQQPVTFFREVLALCDHPDLLQREEIKTLSADSISRAKQILAMI-----PGRATGAYSHSQGIHGLRDAIASGIASRDGFPANADDIF----LTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDARSNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFHSFKKIVEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIAPDAFYALRLLESTGIVVVPGSRCTILP-QEDKIPAVISRFTVFHEAF. 484

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.