current user: public

If you have questions about the server, please let us know.

Query: 4wxb_A mol:protein length:428 Serine hydroxymethyltransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MRGSGSMIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLYLast
1 -124.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model  100  1MRGSGSMIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY 422
2 -118.0003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  55  1.SMSNANPFFSQSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSRDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLV-TGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTHATEQRVRREIFALCERFPIY 425
3 -117.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  55  1......MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDIL-TGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNSALEQQVLNEVTKLIELFPFY 419
4 -117.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  50  9..QTQGPGSMSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQQ-YAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKVVSGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALATGSSVD-VSALKDRATRLARAFPLY 430
5 -116.0005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  57  2......AMFANISISEFDPELAQAIASEDERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEFVDVIEQMAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQYGLNAETGEIDYEEVERLALEHKPRMIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKANEIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVV-SGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGDEKVIADVKAKVEAVCAKFPVY 417
6 -115.0005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  52  3.........MAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVN-LDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTNEHAHPFPHCHVVSSTTHKTLRGPRGGIILTNDEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLV-SGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINNVSLQLHVKEELKAMANQFPVY 413
7 -115.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  59  1......MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGID-ATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVV-SGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARYPVY 416
8 -114.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  56  5...........SYITKQDKVIAEAIEREFQRQNSNIELIASENFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTESIAIDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYNFVEYGVDKDTERINYDEVRKLALEHKPKLIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYK-KDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKPFVTSGIRLGTPAATTRGFDEKAFEEVAKIISLALKNSKDEEKLQQAKERVAKLTAEYPLY 414
9 -113.0003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  53  3..........AMSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFY-GVELDGRIDYEKVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRGGIIMTNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLV-SDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNNEKLQENIKQELKKLASNFIIY 412
10 -113.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  58  2...........VSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIV-TGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPS----EALREEVRRLALAHPM. 406
11 -112.0001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  59  2...........KYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFA-KQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLV-SGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGSEQALEEARQRVAALTDPTSRS 410
12 -111.0004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  57  1......MFNRDMNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITPETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKNEAIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIV-SGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDETTITAVKVKVAALCKACPVY 420
13 -111.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  55  2...ASMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINS-AIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIV-SGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVY 417
14 -110.0001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  43  9..WASHEKMLSQPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEMLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKIFFESMPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKYELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYK-IVTGGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELTLQQSAVATLREEVENFASNFSL. 472
15 -110.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  59  1...SNAMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGID-ESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVV-SGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEATIERVKAKVLDICARFPVY 419
16 -110.0005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  44  7..SPEHKQMVEGHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTSAVSTYFETMPYRVDLETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYK-LVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGD-RSALVPGGVRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKSDEITQLKNEISAWAGEFPLS 469
17 -109.0006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  44  5..WSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTSATSIFFNSMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYK-IVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSVQALREEVESFASLFPLP 468
18 -109.0001bj4_A mol:protein length:470 PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)  ali model follow..  44  5..WSSHDAMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIV-TGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRS-ALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSVQALREEVESFASLFPLP 468
19 -108.0005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  45  17..EANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVTSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLV-SGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLESQRLANLRQRVEQFARAFPMP 478
20 -104.0004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  39  1.......MFNNEPLEQIDKELHDILADEEKRQRETINLIASENLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDFIDKIEELCQKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDMFESCNSQGYVDLDAVREMALSFKPKVIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACNILNNPFLHADVVTTTTHKILRGPRSALIFFNKKGIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQID-LVTNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDV-DCVSPSGVRIGTPAMTTRGAKEKDMEFIADVLARAIKITVDLQELQQLKQEVVTWAGALPF. 441
21 -103.0004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  38  27.HPFTPGMFNNDPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDLFESCNSEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILRGPRSALIFFNKKGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLV-TNGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDV-DCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILLTDENPKIDELKKEVVQWAKNLPF. 473
22 -103.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  45  21.GEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSSATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLV-SGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVQRLANLRQRVEQFARAFPM. 482
23 -103.0006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  45  1.....SNAFLDYGLSEADPDVHAIINKEKDRQFRSLELIASENFTSKAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELEILCQQRALAAFDKWGVNVQPLSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMTSGTSIYFESMPYRLDESTGVIDYDMLEKTAALFRPKLIIAGASAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAASVLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDAVESAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLV-SGGSDNHLVLVDLRPSGIDGARVEKILDMASITLNKNSVPGDK-SALVPGGIRIGSPAMTTRGLGEKEFELIADLIHEGVRISLEGDKVSNLRRKVEALATQYPIP 453
24 -103.0004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  35  2............EYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLEGAEYLMGSTHKTFFGPQGGVILTTKE-NADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFG-EAYAKQVIKNAKALAQALYERGFNVLCKDFTESHQVIIDIEDIEFSASELAKMYEEANIILNKNLLPWDDNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEK---PEKVREDVKEFAKEYSTI 413
25 -102.0001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  44  14..WSSHEQMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEHIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIV-TGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-KSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQQRAVRALRQEVESFAALFPLP 478
26 -20.9005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  12  38.....................YKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRL---DEVTCPPIKDFLEDIAKFLNMDCARP-THGAREGKFIVMHAICKEGDYVVLDKNA---HYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNKNVGLILLTDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE----KADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFLGCTSRGLPIVTLMASFPHVV--ERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPV-----DEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKEI---KMSVYGLEWEQVEYVVNAIKEIVE......................... 408
27 -20.5005i90_A mol:protein length:427 PvdN  ali model follow..  14  22...SAAQSLRAEGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRNPGEAVDWHREEIWKYEDE-ARAWAGRYFAVQPGQV-TGSTTDGLAAIYGGLVQPGKEILTSSHEHYSTYTLEYRHKRMGTQVREFPLFKDPHRVSADLSSIAAQIRP-QTRVLGMTQSGSGVKLPIREIGKLVRELNQIYVVDGVHGFGVEDVSFAD----DCDYFIAGTHKWLFGPRGGVIIARSEQLQEHLVPSIPTFSRGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHKVRLVTPTSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVD---------VGPVVRLAPSLLND----EAEIDRVLEILAPQL.......................... 426
28 -19.5002hzp_A mol:protein length:501 Kynureninase  ali model follow..  11  50LKCHPTDERVALHLDEEDKDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESI-VGLMKDIVGANEKEIALMNALTVNLHLLMLSFPKRYKILLEAKAPSDHYAIESQLQLHGLNIEESMRMIEETLRIEDILEVIEKEGD-SIAVILFSGVHFYQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD----GVDFACWCSYKYLNAGAGGIGAFIHEKHAHTIKPALV---ISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHPVVNIITPSHVEERGCQLTITFSV-PNKDVFQELEKRGVVCDKRN----------PNGIRVAPVPLYN---SFHDVYKFTNLLTSILDSAETKN................... 495
29 -19.4002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  13  54..............................................................................PIHDFIHNQLPKFLGCDVARV---GAREAKFAVMHSLAKKDAWVV---MDENCHYSSYVAAERAGLNIALVPKTDYPD-YAITPENFAQTIEETKKRLITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE----GADFIVGSGHKSMAASGPIGVMGMKEEWAEIVKNKEVELLGCTARGATIITLMASFPHVRERIKRW--DEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAKKAKGGRFFLYRELKSRKIHGIKPGL---------------RYFKLSTYGLSDEEVDYVLNAFKEIIEK........................ 369
30 -19.3001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  15  1........MAKRIVEPFRIKMVEKIRVPSREERNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLK----DKAKELFNYDYI-IPAHQGRGAENILFPVLLKYKQKEGKFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKGDFDIKKLKENIAQHGADNIVAAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYP--TGGHAVFVDCKKL--AQAVINALYLESGVRAVEIGSFLLGRDPATGE-MRLTIAR-----YTNDHMDYIADALIGLKEKFATLKGLEFEYEPLRHFTARLPI. 466
31 -19.2001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  10  34HLREVPPRLPEVDELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFAD-LHPYQDPRTAQGALRLMWELGEY----LKALTGMDAITLEPAAGAHGELTGILIIRAYHED--VVLVPDSAHGSNPATASMAGYQVREIPS---GPEGEVDLEALKRELGPHVAALMLTNPNTLLFERRILEISRLCKEAGVQLYYDGANLNAIMG---WARPGDGFDVVHLNLHKTF-GPGSGPVGVKAHLADFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHE--FVAQPPEGFRALDLAKGLLELGFHPPTVYFP-----LIVKEALMVEPTETE----AKETLEAFAEAMGALLKKPKEWLENAPYSTPVRRL....... 457
32 -19.1003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  4..........CEARRAHEHLIRLLLEQGKCPEDG------DESTLELFLHELAVMDSNNFLGNCGVGER--AGSSLLNKITNSLVLKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPECLHSTTACFA---RLEELAVICANYDIPHVVNNAY--GLQSSKCMHLIVGRIDAFVQSLDKNFMVPGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNA----AAAIGMKMQDVDLFIKRLDKCLNIVRKEQ................... 447
33 -19.0001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  12  8...........LALDAQDS--LAPLRQQFALPEGVIYL-NSLGARPVAALARAQAVIAEEWGNGLIR--SWNSAGWRDLSERL-GNRLATLIGARDGEVVVTDTTSINLFKVLSAAPERRVIVTETSNPTDLYIAEGLADMLQQGYTLRLV--------DSPEELPQAIDQ-DTAVVMLTHVNYKYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ----GADYAIGCTYKYL-GPGSQAFVWVSPQLCDLVPQPLS---CGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRELTLVTPREHAKRGSHVSFEHP--EGYAVIQALIDRGVIGDYRE----------PRIMRFGFTPLYT---TFTEVWDAVQILGEILDRKTWAQAQFQVRHSVT......... 416
34 -19.0003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  17  12..NKEIEGLKKAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGPALIKTAQTVV-EQYGFGMASVRFICGTQ---TIHKELEKDISEFLGTDDTIL---SCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYK-------------AMGDLEAKLKEARFKLIATDGSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENEYCGVADRVDILTGTLGKALGGASGGYT-SGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPG----NHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMG---KARIRVQMSA----VHTQQQLDRAIEAFGQVGKK........................ 395
35 -19.0001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  17  34.................................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTAAHGIKVFYDATRCVENAYAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIVEP--VGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRLTIPR-----YTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPLRFFTARFYI. 456
36 -18.9003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  13  1.......................MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAF------------TGIMNETMEMLRELFQTKNRWAYPITSRAGIEAVLASVIEPEDDVLIPI---YGRFGYLLTEIAERYGANVHMLECEWGT-VFDPEDIIREIKKVKPKIVAMGETSTGRIHPLKAIGEACRTEDALFIVDAVATIG---GCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERG-TEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVTCVEIPGGIDGESVRDMLAQFGIEIASSF------GPLAGKIWRIGMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYENAGRQAAV. 416
37 -18.9002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  10  18................................PNKLLMGPGPSNAPQRVLDAMSRPILGHLHPET------------LKIMDDIKEGVRYLFQTNNIATFCLSGHGGMEATLCNLLEDGDVILIGH---TGHWGDRSADMATRYGADVRVVKSKVGQ-SLSLDEIRDALLIHKPSVLFLGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLG---GAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKVPQGVDWLKAAQYAKTYLVEISGGL------GPTAGQVFRIGLMGQN---ATTERVDRVLQVFQEAVAA........................ 382
38 -18.8001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  15  46...............................SNDYLGLSHHPQIIRAWQQGA------EQFGIGSGGSGHVSGYS---VVHQALEEELAEWLGYSRALL---SGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFA-------------DVTHLARLLASPCPGQMVVTEGVFSMDAPLAEIQQVTQQHNGWLMVDDAHGTGVIGRGSCWLQKVKPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADS----CSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAG---TARLRLTLTA----AHEMQDIDRLLEVLHGN........................... 383
39 -18.7003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  11  1.....................MDITQFSQLNPPSRLLMGPGPINADPRVLRAMSSQLIGQYDPAM------------THYMNEVMALYRGVFRTENRWTMLVTSRAGIEAILVSAIRPGDKVLVPV---FGRFGHLLCEIARRCRAEVHTIEVPWGE-VFTPDQVEDAVKRIRPRLLLTGDTSTTMLQPLAELGEICRRYDALFYTDATASLG---GNPLETDVWGLDAVSAGMQKCLGGPSGTSPITLSARMEEAIRRRKCVEEG-TEATTALFGARECARLILQEGLDYGIARHKLHGDALVKGIQAMGLETFGDLKHKMNNVLGVVIPQGINGDQARKLMEDFGIEIGTSF------GPLHGKVWRIGMGYNARKDCVMTTLSALEAVLNYLKFPTTQGAAMQAAWDHYRS........ 409
40 -18.6002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  16  10......................................LRSDTVTKPT------EEMRKAMAQAEVGDDVYGEDPTINELE----RLAAETFGKEAA-LFVPSGTMGNQVSIMAHTQRGDEVIL---EADSHIFWYEVGAMAVLS--VMPHPVPGKNGAMDPDDVRKAIRPPRTSLIAIENTRVVPLENIKEICTIAKEHGINVHIDGARIFNASIA-PVKEYAGYADSVMFCLSKGLCAPVGSVVVGDR----DFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKED--ENARFLALKLKEIGYSVNPED-VKTNMVILRTDNLKVNAHGFIEALRNSGVLANA----------VSDTEIRL----VTHKDVSRNDIEEALNIFEKLFRK........................ 347
41 -18.6001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  10  90VNAREIETAVNNYEDSILPPFFKSLKEYVSRYLIQFDC-PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLI-AEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVL---FDRNNHKSVYNSALAMAGGRPVYLQTNRNPYGFIDSDFDEKKIRELAAKAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRN--DPGIIVVQSVHKQQAGSQTSQIHKKDSHIKKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAKWHAYEGYGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDAETPAKMNNLITQLLQLQRLI... 566
42 -18.5001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  14  17..........................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAA----RLIGELLERPDADV-ISGGTQTNLIACSLALRPWEAVIA---TQLGHISTHETGAIEATGHKVVTAP--CPDGKLRVADIESALHENIPKLVYISNTTQYTKQELEDISASCKEHGLYLFLDGARLASALSS-TLADIARLTDMFYIGATKAGGMFGEALIILND----ALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNFFELGAHSNKMAAILKAGLEACGIRLAWP--SASNQLFPILENTMIA--ELNNDFDMYTVEPLKDG----------TCIMRL----CTSWATEEKECHRFVEVLKRLVASTA...................... 359
43 -18.4006MME Entity 1(prereleased)  ali follow..  17  34.................................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTEAHGIKVFYDATRCVNKSIAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIVEP--VGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRL---TIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPLRFFTARFYI. 456
44 -18.3003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  15  9......................................LRSDTVTQPT------DAMRQCMLHAEVGDDVYGEDPGVNALE----AYGADLLGKEAA-LFVPSGTMSNLLAVMSHCQRGEGAVL---GSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDTPTRLVCLENTVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVA-TVRELVAPFDSVSICLSKGLGAPVGSLLVGSHA-----IARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADD--RRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTSGESA--PLLAFMKARGILFS------------GYGELRL----VTHLQIHDDDIEEVIDAFTEYLGA........................ 341
45 -18.3002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  59.................DEKIKLFLKFLSMMDTDKDPKSVRIGEREARTYSKIHEELSSGFCHGVDPQPKASGASIMYALTNKILESFFKQLGVHAIATPISTGMSISLCLSAARKKYGSNVVIYPYA--SHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEIELCVLSTLTFFPP--DIVEIAKICENYDIPHIINGAY--AIQNNYYLEK-KYRVDAVVSSSDKNLLTPIGGLVYSTDAEFIKEISLS----YPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDYIVMNAAIGVRTEDIVNSVSKLEKIL.......................... 449
46 -18.2005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  12  7..........................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS----EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVIC---SETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHC---AQLLALLVSDLPGVELMFP-VEANGVFLQMP------EHAIEALRAKGWRFYTFI---------GSGGARF----MCSWDTEEERVRELAADIRSIITA........................ 346
47 -18.2004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  13  46MSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFVYSGEEKLTELLVKAYGDFAWSNPLH-------PDIFPGLRKIEAEIVRIACSLFNGDSCGCVTSGGTESILMACKAYFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPL---TKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDVPEVAKLAVKYKIPLHVDAC-LGGFLI--PFDFRVKGVTSISADTHKYGYAPKGSLVLYSDKKYRNY-GIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVF---GNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP---------PSIHF---CITLLHARKRVAIQFLKDIRESVTQMKNPKAKTTGMGAIYGMAQTTV.. 476
48 -18.2003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  16  4......................................LRSDTVTRPS------RAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTHNGKVYLKEAWEFTRERNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNR----DYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQED--DNAAWMAEQLREAGADV-----MRQDTNMLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSREQLAEVAAHWRAFLAR........................ 333
49 -18.2001vjo_A mol:protein length:393 alanine--glyoxylate aminotransferase  ali model follow..  11  22...........................EPLEVPSRLLLGPGPSNAHPSVLQAMNVSPVGHLDPAF------------LALMDEIQSLLRYVWQTENPLTIAVTGTAAMEATIANAVEPGDVVLIGV---AGYFGNRLVDMAGRYGADVRTISKPWGE-VFSLEELRTALETHRPAILALAETSTGARQPLEGVGELCREFGTLLLVDTVTSLG---GVPIFLDAWGVDLAYSCSQKGLGCSPGASPFTMSSRAIEKLQRRRTKVYHHTAPINLYYALREALRLIAQEGLANCWQRHQKNVEYLWERLEDIGLSLHVEKEYRLPTLTTVCIPDGVDGKAVARRLNEHNIEVGGGL------GELAGKVWRVGLMGFNS---RKESVDQLIPALEQVLR......................... 387
50 -18.2002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  46...............................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNNE-VNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDER-NTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY........................ 383
51 -18.1001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  16  52...............................ANNYLGLANHPDLIAAAKAGM------DSHGFGMASVRFICGTQ---DSHKELEQKLAAFLGMEDAIL---SCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYA-------------DMQELEARLKEAREHVLIATDGVFSMDANLKGVCDLADKYDALVMVDDSHAVGFVGENEYCDVMGRVDIITGTLGKALGGASGGYT-AARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGA----DHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKG---QARIRTQMSA----AHTPEQITRAVEAFTRIGKQ........................ 396
52 -18.0004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  13  52...............................TSDYLNLSSAHNLKHAIVNGF------DKYGFGSKGSNIVCGYT---DETQQFEHEFAKFINYPRAIF---SGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYK-------------QLSQLQDIYDGKS---FITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLAINSFRISYKNCLICVFPLGKAF-GGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV--NDNRARLQQNITFFNELCDAKDLELVSKDLSPIRSIQL---NNANLAIRLKDKLFENKIIVSCFRYPTVPKD---QAILRFSLHSN-----TFDQIQQALEIISKEVKY........................ 387
53 -17.9002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  15  61................................................................................EKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYL-PELPGHPSIERSCKIVNAKY----------FESDKVGEILNKIDKDTLVIITGSTMDLIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKGADLVVTSTDKLMEGPRGGLLAGKKELVDKIYIEGTKFGLEAQPP--LLAGIYRALKNFNLERIRKAFERAKNFDLSKIEKLNKELKAIIVYERTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYIKAIVESIKMAFKS........................ 374
54 -17.9002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  12  21................................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALLPTVTTVAVPAGYDWRDIVSYVDHFDIEIMGGL------GPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALVA........................ 386
55 -17.9004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  11  60LSPQDILSAFDVDVEKCHFDFLSVTNDPEREFLVGRGDGKDSGALYAIHPKELTELLKEVYGATALTNPLHDKWPRINAMQAEVIRWCQNLFHGEGYGLLTHGGTTSIIEAMAAYRAKGIDYPEIVVPETAHAAFKKAAELTG--AILITVPVDKKTGAVNPNVMSSYITRNTAVMVSAPSFMNGIHDPISELGQLAKKKNVPFHVDACL--GFLTAFLDTS-VPGVTSISADLHKYGCCPKGSVCLFSEDSPALSVLYATPGILDGSTSGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALVEEGNGLTSEDIYVYILGFRSNTCNAHFIADELEKRGWKLNLLQNPDGFH-------LCLTHVHTLVGSFETQFIKDLREAVIDV--KNYPPGKKPSGNVKVYGAVGMMP.. 497
56 -17.9005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  12  26................................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALLPTVTTVAVPAGYDWRDIVSYVDHFDIEIMGGL------GPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH........................ 391
57 -17.9003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  60...............................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNNE-VNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDER-NTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY........................ 397
58 -17.9004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  12  21................................PNQLLLGPGPSNLPPRIMAAGGLQMIGHMSKEMY------------QIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALLPTVTTVAVPAGYDWRDIVSYVDHFDIEIMGGL------GPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH........................ 386
59 -17.9004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  12  23................................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVAFLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALLPTVTTVAVPAGYDWRDIVSYVDHFDIEIMGGL------GPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH........................ 388
60 -17.8005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  16  48...............................SNDYLGLAAHPQLIAAIAEGA------QRYGAGSGGSHLLGGHS---RAHAQLEDDLAEFVGGFVENARALTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYP-------------DTDALSAMLEASDVKVIVSDTSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEGDARRAHLQQLIGRTRAMLKATPWLPVDS----HTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTG---TSRLRISLSA----AHSQADLDRLEAGLQQLGAK........................ 394
61 -17.8001v72_A mol:protein length:356 Aldolase  ali model follow..  10  11..........................................GFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVK----RKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWGNIYC---HPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKQPACVSITQASIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCS--KAGVDALSFGATKNGVLAAEAIVLFNT----SLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDWLRNARKANAAAQRLAQGLEGLGGVEVLGG-TEANILFCRLD------SAMIDALLKAGFGFYHDR--------WGPNVVRF----VTSFATTAEDVDHLLNQVRLAADRTQER.................... 356
62 -17.8003n75_A mol:protein length:715 Lysine decarboxylase, inducible  ali model follow..  12  114..ANKIKQTTDEYINTILPPLTKALFKYVREGKYTFCT-PGHMGGTAFQKSPVGSLFYDFFGPNTMKSDISISVSELGSLLD-AEQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTIL---IDRNCHKSLTHLMMMSDVTPIYFRPTRNAYQSEFQHATIAKRVKETPNAAVITNSTYDGLLYNTDFIKKTLDVKS--IHFDSAWVPYTNFSPIYEGKCGKVIYETQSTHKLLAASQASMIHVKGDVNEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRHGFKNIDNEHMYLDPIKVTLSDFGIPASIVAKYLDEHGIVVEKTGP---------------NLLFLFSIGIDKTKALSLLRALTDFKRAFDLNLRVKNMLPSLYR........ 575
63 -17.8002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  10  17................................PEKIMMGPGPSNCSKRVLTAMTNTVLSNFHAEL------------FRTMDEVKDGLRYIFQTENRATMCVSAHAGMEAMLSNLLEEGDRVLIAV---NGIWAERAVEMSERYGADVRTIEGPPDR-PFSLETLARAIELHQPKCLFLGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLC---GVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHLPTVTGIMIPKGVDWWKVSQYANNFSLEVQGGL------GPTFGKAWRVGIMGECS---TVQKIQFYLYGFKESLKA........................ 382
64 -17.8004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  4......................................LRSDTVTRPS------RAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNR----DYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQED--DNTAWMAEQLREAGADVM-----RQDTNMLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSRAQLAEVAAHWRAFLAR........................ 333
65 -17.7002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  13  124..AGRAVAAMTRYRQQLLPPLFSALMKYSDIHEYSWAA-PGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLD-SEKYAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---VDRNCHKSIEQGLMLTGAKPVYMVPSRNRYPQEMQPETLQKKISESKPSYCVVTNCTY---YNAKEAQDLLEKTSDRLHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR................................................................................................................. 463
66 -17.7003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  13  3...........RNMQEKGVSEKEILEELKKYRSLDLKYEDGNGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTK---LLEEKAVALLGSLLNNKDAGHIVSGGTEANLMALRCIKNSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPI---KEDYTIDEKFVKDAVEDYDVDGIIAGTTELGTIDNIEELSKIAKENNIYIHVDAA-FGGLVIPFLDDKYKLGVDSITIDPHKMGHCPIPGGILFKDIGYKRYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEP------ILNIVAIEDEDYKEVCKKLRDRGIYVSVCNCV---------KALRIVVMPHIKREHIDNFIEILNSIKRD............................ 397
67 -17.7003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  11  80...........LPRAEILAEIAAMGAAESPAWRDG--VYHGDEHHIAFLNEVYALQSQSNPLH-------PDLWPSTAKFEAEVVAMTAHMLGGTVCGTVTSGGTESLLLAMKTRATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPL---DADYRADVAAMREAITPNTVVVASAPGYPHGVVDPIPEIAALAAEHGIGCHVDAC-LGGFILVPPFDFRLEGVTSVSADTHKYGYGAKGSVILYRRPDLLHY-GLYFSPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILG----DPLWVIAVASDELNIYQVMEEMAGRGWRLNGLHRP---------PAFHV---ALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKATGMAPVYGMAAAAP.. 494
68 -17.7003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  10  40..................EAAYQIINDELMLDGN--LASFVTTWMEPECDKLIMSSINKNYVD-------MDEYPVTTELQNRCVNMIAHLFNATAVGVGTVGSSEAIMLAGLAFKRKPVDKPNIVTGANVQVCWEKFARYFE--VELKEVKLSEGYYVMDPQQAVDMVDENTICVAILGSTLNGEFEDVKLLNDLLVEKNKETGWDT-HVDAASGGFIAP--LPLVKSINVSGHKYGLVYAGGWVIWRNKEDLPE-ADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSLKDSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITV---LRVVIREDFSRTLAERLVIDIEKVMRELDELPSRVIH.................. 453
69 -17.6005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  17  46...............................SNDYLGLAAHPKLVAAFAEGA------QRYGSGSGGSHLLGGHS---RAHAKLEDELAGFAGGFSDAPRALTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYP-------------DTATLGALLEACQTKLIVTDTSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEGDARRAHLAALIERTRALLRRTRWQPVDS----HTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAG---TSRLRISLSA----AHSFDDLARLETALLRASEE........................ 392
70 -17.6003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  11  22................................PTRLLLGPGPSNLAPRVLAAGSLRMIGHMQKEM------------LQIMEEIKQGIQYVFQTRNPLTLVVSGHCAMETALFNLLEPGDSFLTGT---NGIWGMRAAEIADRIGARVHQMIKKPGE-HYTLQEVEEGLAQHKPVLLFLGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLG---GVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKVIHHTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEILPTITTVTVPAGYNWRDIVSYVDHFSIEISGGL------GPTEERVLRIGLLGYN---ATTENVDRVAEALREALQH........................ 387
71 -17.6002dr1_A mol:protein length:386 386aa long hypothetical serine aminotransferase  ali model follow..  11  19................................PKYKLFTAGPVACFPEVLEIMKVQMFSHRSKEY------------RKVHMDTVERLREFLEVEKGEVLLVSGTGIMEASIRNGVSKGGKVLVTI---IGAFGKRYKEVVESNGRKAVVLEYEPGK-AVKPEDLDDALRKNPD-TITYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMG---GADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMPERGWY-TPPMPQVFGINVALRIIEKMGGEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTITAVLTPPGIKGDEVYEAMRKRGFEL------AKGYGSVKEKTFRIG-----HMGMKFEDIQEMLDNLREVINELKKQKGIN................ 386
72 -17.5003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12LVSPAYVRQGCEARRSHEHLIRLLLEKGKCPENHELAIMDSNNFLGNCSALVARRHYRFIHGIGRSGD---AGSSLLNKITNSLVLDIIKLAGVHTVA----MSLTLCFLTLRHKRPKAKYII---WPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCIHSTTSCFA-PDRLEELAVICANYDIPHIVNNAY--GVQSSKCMHLIQQRIDAFVQSLDKNFMVPVGGIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHTNNYPCAYLNA----ASAIGMKMQDVDLFIKRLDRCLKAVRKERSKES............... 469
73 -17.5003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  17  16......EELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGTRIIKAAQDAL-EKYGTGCAGSRFLNGTL---DIHVELEEKLSAYVGKEAAIL---TGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYG-------------NMEDLRAKLSRLPEKLICTDGSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKSHFGLNDDVDLIMGTFSKSL-ASLGGFV-AGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDL----GATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAE---ESLIRFSLMAT-----TYDQIDEAIEKMVKVFKQ........................ 391
74 -17.4005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  11  16LKPIFGASAERHDLPKYKLAKHALEPREADRNSRLNLATFCQTYMEPEAVELMKDTLEKNAID-------KSEYPRTAEIENRCVNIIANLWHASFTGTSTIGSSEACMLAGLAMLDLTAHQPNIVISAGYQVCWEKFCVYWDIDMHVV--PMDDDHMSLNVDHVLDYVDDYTIGIVGIQYDDLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELLNNVISINASGHKYGLVYPGGWVIWRDQQYLPK-GELPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELSDREWTLYDLSDRLLMKGWQVPTYPLPKNMTDRVI---QRIVVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSDPQPK............. 462
75 -17.4005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  12  13VELPLQQKADAAQTVTGPLPFGNSLLKEFVLDPAYRNL----NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPVETVNATMGVNTVLRNIVWSADGKDEILYFDTIYGACIDYVIEDKRGIVSSRCIPLIYPAEDDDV-VAAFRDAIKKSRPRLAVIDSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITE----DPDFLISNCHKWLFTPRGCAVFYVPVRNQHLIRSTLPTSFVGTVDNSPFFCVAIKWREEVLGGEERIMEYMTKLAREGGQKVAEIGTRVLENSTGTLINIALPFVVGEDPKAPVKLTEKEEKDVEGLYEIPHEEANMAFKW-ARLSAQVYL----EMSDFEWAGKTLKELCEEYKESALEVDLQGDHGLSAWSHPQF 499

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.