current user: public

If you have questions about the server, please let us know.

Query: 4xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst AADTAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAGAANLast
1 -71.1004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model  100  1AADTAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAGAAN 135
2 -66.2006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  41  1.......STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKGKVD 128
3 -63.6002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  43  1.......ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVRNDVLNR....... 123
4 -63.2001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  43  2.......STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ....... 124
5 -63.0002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  30  6RLRKREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGAPMKQVHQGR----GITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAP. 135
6 -62.9001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  32  6RLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGR----GITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAP. 135
7 -62.3002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  20  2........TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE..... 123
8 -62.1001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  43  36APARKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDL--VPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ.... 164
9 -61.4004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  14  15EQTPTPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH...... 145
10 -61.1003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  32  2....NKPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGM----NLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK....... 121
11 -60.8002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  19  2...SSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADNP.. 133
12 -60.4004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  18  27TSQHDDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDAQP. 160
13 -60.3005v3t_A mol:protein length:132 Globin  ali model follow..  20  2...SKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGE. 131
14 -60.0005d1v_A mol:protein length:127 Globin  ali model follow..  24  2.....SEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGED... 127
15 -59.7001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  35  1........SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANM----GVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT........ 115
16 -59.7001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  15  2......PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP...... 127
17 -58.3002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  22  1....EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHL... 127
18 -52.1001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  20  2...GQSFNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRS 131
19 -50.7004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  17  18EAFAIDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAGNELKNQN 154
20 -50.1004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  11  44FPEVKFPSKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRTTLEP. 178
21 -44.2002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  15  1.........MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAEWKEHKAKIGNFWAGMLLGEGDYNGQPLKKHLDLP----PFPQEFFEIWLKLFEESLNIVYNEE-MKNVILQRAQMIASHFQNMLYKYGGH 127
22 -16.4001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  18  1.GHMNAADRVMQSYGRCCASTGFFDDFYRHFLASPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYGS.... 134
23 -14.5004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  12  32................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS.............. 143
24 -14.5002w31_A mol:protein length:162 GLOBIN  ali model follow..  19  29................ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSNRYIHNLQKHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI.............. 138
25 -14.1004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  15  74................TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSQALIAQQKQEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISET.............. 187
26 -14.0004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  12  27................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQHTEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS.............. 138
27 -14.0001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  11  59................QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVDEFIEKRNRSIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKI.............. 168
28 -12.4004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  20  32................TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAAEEYERRKVGEVHARIDIPVHLVTRGASALIRRICELLRDASLSAAQAAATCRYVADV.............. 145
29 -12.2005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  11  34................APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV.............. 145
30 -12.0002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  17  35...TAEDEEYIQKAGEEDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA.............. 177
31 -9.8203wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  17  21....................DEAGLLFYRRLFDEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE....... 132
32 -9.7702wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  11  21....................EDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK 140
33 -9.7401bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  18  19................KANIPQYSVVFYTSILEAPAAKDLFTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK........ 142
34 -9.6103s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  19  22....................NEIGLLFYANLFKEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE....... 133
35 -9.2601gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  11  4...TQEERDEISKTFQGTDMKTVVTQALDRMFKYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDKDLSKKHAD---DLHVDPGSFHLLTDCIIVELAYLCFTPHIQGIWDKFFEVVIDAISKQ....... 134
36 -9.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  16  1GALTESQAALVKS---NANIPKHTHRFFILVLEAPAAKDLFNNPELQAHAGKVFKLVYEAAIQLEVTGVVVTDATLKNLHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMDDAA.. 153
37 -9.1101jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  12  11.......ASTWKDIAGADNGAGVGKECLSKFISHPEMAAVFGDPGVAELGAKVLAQIGVAVSHLGDEGKKAVGVRHKGY--NKHIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQS.... 147

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.