current user: public

If you have questions about the server, please let us know.

Query: 4zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440
# Score Template Links and tools%idFirst MATKSDGSASAAAEGGARKTNIEAYRDGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDSDAIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEERKKLast
1 -118.0004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model  100  1MATKSDGSASAAAEGGARKTNIEAYRDGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDSDAIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEERKK 441
2 -115.0004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  100  2................ARKTNIEAYRDGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDSDAIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEERKK 426
3 -113.0001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  47  9..QRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKL---PSDVVTAVRGKGLLNAIVIKETDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF...... 439
4 -111.0003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  48  1........................MDFVKELKSSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRAFFSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWGYEVKKIPENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFGPFVPNFLKVPYDDLEALEKELQDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGEHGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKD-SKVVREVRGKGLLCAIEFKNDLVNVWDICLKFKENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNLLQ 416
5 -109.0001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  47  2............GSSSSGLVPRGSMEFVKDLKTPEDYINNELKYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFGPFAPQFSKVPYDDLEALEEELKDPNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKD-SKIVRDVRGKGLLCAIEFKNELVNVLDICLKLKENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTVKFFDER... 426
6 -108.0005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  50  2..........................AMSETKNSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRAFYNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLARKWSYEVKGIAENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYGPFTPGFIRIPYNDIAALEEVLSKGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKLIACHHEDVQPDILILGKALSGGMYPVSAVLANNNIMDVIKPGQHGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKL-IEKTDLITKVRGKGLLNAILINDTSSTAWNLCLALKENGLLAKPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF...... 413
7 -107.0003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  46  1..................................KDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTNKEMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYGDLEALKAAIT-PNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI---DNPMITEVRGKGLFIGIELNEP---ARPYCEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVLS........ 392
8 -104.0004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  32  2....................RGSGMASHMATEQTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHS--PFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMD-DHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGF-PVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAI-DEQFDIFSDIRGMGLLIGAELKPKKGRARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKVVALE.. 416
9 -103.0004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  30  2................................SQPITRENFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALID-DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTI-NHRYGLFSEVRGLGLLIGCVLNADAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHFVSRGSS 406
10 -102.0001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  35  2..........................ETRTLEDWRALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAILELNRVFPVNSGTEANEAALKFARAHT--------GRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVD-EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGV-PLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPS---PKIREVRGMGLMVGLELKEK--AAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA........ 395
11 -101.0002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  32  1....................................MGSDKIMYLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKKS---EKKYRILSAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMS-EDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGGV-PIGAVIVN-ERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEM-KEEYDVVADVRGMGLMIGIQFREE-VSNREVATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVLQGI...... 391
12 -101.0003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  27  2...................................KMDYKEQSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSNLYYNENIAAAAKNLAKASALERVFFTNSGTESIEGAMKTARKYAFNKG---VKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFKPLISGVKFAKYNDISSVEKLVN-EKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCGL-SVGAFVINQKVANSLEAGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDEL-INEFDFCKKRKGLGFMQGLSLDKS-VKVAKVIQKCQENALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF...... 395
13 -97.5004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  28  5...PSSASALACSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLAKAYQSPR-----GKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNE-IGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAMRVSVEE 458
14 -96.9005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  28  1.GSHMSASALACSAHALNLIEKRTLDHEEMKALNREVIEYFKEHVNPGFLEYAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLAKAYQSP-----RGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNE-IGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAMRQQ... 453
15 -96.2002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  35  1..........................................TYLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSNLYENPWQEELAHKLVKHFWTEKVFFANSGTESVEAAIKLARKYWRDKG---KNKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLD-EETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGGV-PIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELG------KGKVKGRGLMLGLELERE---CKDYVLKALEKGLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL......... 375
16 -92.0004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  29  360..HHDIYAGESADAALPASRLAFIDAVIAQTPAREDTLDRYHQYINPKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPIQYISIPEQTAKLAEVLCRLANMGRVFFSNSGTEAVEAAMKIAKAS--------TGKPGIAYLRNSYHGKTLGALSITGRDKHRRYFTPLLDAMVEVPFGDLAALREALNREDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCRADLWQKARFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEI-AARYPFVSEVRGRGLMLGIQFDQAF--TGAVNASAREFATRLPGDWHTTWKFLPDPVQ--AHLRAAMDRMEQALGEMFCMKF. 799
17 -91.8002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  24  2..................AAVVKSVALAGRPTTPDRVHEVLGRSMLVDGLDIVLDLTRSGGSYLVDITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKVYSVAMARFVETFARVLALPHLFFVEGGALAVENALKAAFDWKSRHNQAPALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPFDWPRIDAPYRQARAAFETR-PHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRGLMCAFSLPTTA-DRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVVT..... 449
18 -90.1004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  30  1.......MTTTANELSYRIEQKRNINGAFPGPKSQALAERRSAVVAAGVASVPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCFMVTYEGYVAVTEQLNRLTPGDRTVLFNSGAEAVENAVKVARLA--------TGRDAVVAFDHAYHGRTNLTMALTAKAPYKTNFGPFAPEVYRMPMSYITMIEKQIGGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGGL-PLSAITGRADLLDAVHPGGLGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAELGSVVGDIRGRGAMLAIELVQPGSKTKAVAAACLKEGVIILTCGGNVIRLLPPLVISDELLIDGLEVLAAAIKAHA..... 456
19 -89.4001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  30  1..............................MNSNKELMQRRSQAIPRGVGQHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCQVLAYEPYLELCEIMNQKVPGDKTLLVTTGSEAVENAVKIARAA--------TKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYREDDAIASIHRIFKPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGF-PLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAI-AEKHPEIGDVRGLGAMIAIELFEDGDHTAEIVARARDKGLILLSCGYNVLRILVPLTIEDAQIRQGLEIISQCFDEAKQ.... 426
20 -88.7002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  27  2................................LSRKIIEESDIYLATSTRDFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAANDFYNIPQLELAKKLVTYSPGNKVFFSNSGTEAIEASIKVVKNTG---------RKYIIAFLGGFHGRTFGSISLTASKAQRSIVGPFMPGVIHVPYPNIEFIEDYIPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGIMPIGATIFRKDLD--FKPGMHSNTFGGNALACAIGSKVIDIV--KDLLPHVNEIGKIFAEELQGL-------ADDVRGIGLAWGLEYNEKK-VRDRIIGESFKRGLLLLPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVVK..... 419
21 -87.2003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  27  1..........GPGSMVSHPEQSRHLATAIPGPRSQALIDRKGTAVARGVGTMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDFTHTCFMVTYEGYVAVCEQLNRLTGDKRSALFNSGSEAVENAVKIARSH--------THKPAVVAFDHAYHGRTNLTMALTAKVPYKDGFGPFAPEIYRAPLSYPTVIDKQIGADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGGL-PLSAVTGRAEIMDSPHVSGLGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRL-QAEDDRIGDVRGRGAMIAMELVKAGTTTKALCAGAHAAGVIVLSCGGNVVRFLPPLSIGDDLLNEGLDVLEEVLRGA...... 451
22 -87.1003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  28  1...GPGSMVTIAEIAGRTLTQERRLVTAIPGPISQELQARKQSAVAAGVGVLPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTYEGYVKVAEHLNRLTPGDRTALFNSGAEAVENAVKIARAY--------TRRQAVVVFDHAYHGRTNLTMAMTAKNQYKHGFGPFANEVYRVPTSYLDLINKQVGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHENVVPDLIVTAKGIAGGL-PLSAVTGRAEIMDGPQSGGLGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGAL-AAADPRIGEVRGRGAMIAVELVKPGTTTKRVAAAAHAQGLVVLTCGGNVLRFLPPLSMPDHLLDEGLDILAAVFAEVK..... 453
23 -86.5004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  30  1.......GPGSMTDITYRLAQKRTIVTPLPGPRSGALAERRRAAVSAGGSTAPVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHFTHTCFMVTYEQYVQVAELLNALTPGDRTALFNSGAEAVENAIKVARLA--------TGRPAVVAFDNAYHGRTNLTMALTAKSPYKSQFGPFAPEVYRMPASYISRIETQIGAQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFARTGAWFASEHEGIVPDIVTMAKGIAGGM-PLSAVTGRAELMDAVYAGGLGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSAL-AEEVDIIGEVRGRGAMLAIEIVKPGTLTKSIAAEALSQGVLILTCGGNVIRLLPPLVIGDDLLDEGITALSDIIRAKASHQ.. 453
24 -86.1005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  23  1........................MSLTVQKINWEQVKEWDRKYLMRTFSTQPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDRYGFVWDTYATDYKAKAAKIIIEDILGDKVRFVSTGSEAVETALNIARLY--------TNRPLVVTREHDYHGWTGGAATVTRLRSYRSGLSSYNSAVLMAPSKYTRRMIENYGPEQVAAVITEVSQGAGSA-MPPYEYIPQIRKMTKELGVLWINDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVLVSKEIAAFMDKHRSVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELL-QEKHKSIGNFDGYGLLWIVDIVNAKTKTQIIMKKALEKGVLIGGVMPNTMRIGASLNVSRGDIDKAMDALDYALDYLESGEWQ 474
25 -85.9005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  23  1........................MGLTVQKINWEQVKEWDRKYLMRTFSTQPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDRYGFVWDTYATDYKAKAAKIIIEDILGDKVRFVSTGSEAVETALNIARLY--------TNRPLVVTREHDYHGWTGGAATVTRLRSFRSGLVGENSAVLMAPSKYTRRMIENYGPEQVAAVITEVSQGVGST-MPPYEYVPQIRKMTKELGVLWISDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVVVSKEIAAFMDKHESVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELL-QEKHKSIGNFDGYGLLWIVDIVNAKTKTQIIMEKALEKGVLIGGAMPNTMRIGASLNVSRGDIDKAMDALDYALDYLESGEWQ 474
26 -85.9001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  17  1.......SQAAAKVDVEFDYDGPLMKTEVPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALENFVEKLRESLLSVAGMSQLITMACGSCSNENAFKTIFMWYRSKERPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKDIPSFDWPIAPFPRLKLEEVEDLIVKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKMMTGG-FFHKEEFRPN-----APYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQFISRVRGRGTFCSFDTPDES-IRNKLISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDILADFK..... 472
27 -85.5003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  26  3.MGTLEAQTQGPGSMVASLDQSRLLVTEIPGPASLELNKRRAAAVSGGVGVLPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQFTHTCFMVTYEQYVAVAEQLNRITPEKRTVLFNSGAEAVENSIKVARAH--------TRKQAVVAFDYAYHGRTNLTMALTAKSPYKSGFGPFAPEIYRAPVSYINLIDKQIGAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGF-PLSAVTGRAEIMDAPHTSGLGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRL-QAADDRLGDVRGRGAMIAMELVKSGTATQKLAAAAHAAGVIVLTCGGNVIRLLPPLTISDELLSEGLDILCQILAD....... 461
28 -85.3005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  24  2............GSSSSGLVPRGSHMTKQTSAQTQHWQALSREHHLAPFTDYARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLELPYYNLFTAHPPALELAKAIADIAGMNHVFFTGSGSESNDTVLRMVRHYWSIKGK--PQKKVVIGRWNGYHGSTVAGVSLGGMKALHSQGDLPIPGIVHIAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVIVRDEIVDTLNEGGHGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQELAD-HPLVGEARGVGMVGALELVKNKKTGMLCREHCFRNGLIMRAVG-DTMIISPPLVITKPEIDELITLARKCLDQTAAV... 465
29 -84.8004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  26  6....................EGRHMELMGKLDKASKLIDEENKYYARSINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAFHHVPGMELSEKLAKIAPGNMVSFGNSGSDANDAIIKFARAY--------TGRQYIVSYMGSYHGSTYGSQTLSGSSNMTRKIGPMLPSVVHVPYPDSKPFESFLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEM-QQRHPMIGDVRMWGLNGGIELVKDPKTATKVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAVENGEVT 452
30 -84.6005dds_A mol:protein length:523 CrmG  ali model follow..  23  1............................MTHPSGEPVYADAVLNGWLTSMGLGVEYVRAEGNTVYDDEGREVLDHACGFGSLIFGHNHPEIIAHAKAALDAGTVVHAQLSQPRANQISRILNDIMDRYNAIFANSGAEANEICMKHAELERQERDERRAERPLFLTLDGSFHGKLVGSIQLTQNEPWRTPFTALSSPARFLPADEPELIGKIVEDPVVAAIFVEPVRGGSGMKTVTPELAEELHRLRDTLGCPLVVDEVQTGIGRTGAFFGSALLGIRGDYYTLAKAIGGGIVKNSVALIRQDRFLPAMEVIHSSTFAKDGLSASIALKVLEMVEADRVYQRVRERGQRLEAMLESVRADHSDVVSAVWGTGLMLALELRDQSNATSQAGFLLREHHIRVLPAGSGFLRFSPSLYITDEEIDRTETALRSLFTALRDQ... 515
31 -84.4003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  28  1.........................SNAMKTKQTDELLAKDEQYVWHGMRPFTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQTLSYFPMSQSHEPAIKLAEKLNEWLGEYVIFFSNSGSEANETAFKIARQYYAQKGE--PHRYKFMSRYRGYHGNTMATMAATGQAQRRYQYEPFASGFLHVTVKEVDRVMTWELSETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKAFGFMNYDVKPDIITMAKGITSAYLPLSATAVKREIYEAFKGKGHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEIGE-HPLVGDIRGKGLLVGIELVNDKETIASVVNACKEKGLIIGRNGNNILTLAPPLVISSEEIAFVIGTLKTAMERI...... 452
32 -83.6003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  26  2......GSSSSGLQGTENLYFQSHMAAATGGLTPEQIIAVDGAHLWHPYSSIPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGLTHEPAARLAKLLVDITGLDTVFFSDSGSVSVEVAAKMALQYWRGRGL--PGKRRLMTWRGGYHGDTFLAMSICDPHGMHSLWTDVLAAQVFAPQVPSAAFEAQLAAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGARGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTA--RALPAVTDVRVCGAIGVIECDRPV-DLAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLVGS.... 454
33 -83.6004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  25  2.................GSSSSGLVPRGSHMNKPQSWEARAETYSLYGWTDMTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERFPGYHAAKMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEGK--PQKRKILTRWNAYHGATAVSASMTGFP-YNSVFGLPLPGFVHLTARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHI--AERPNIGEYRGIGFMWALEAVKDKASSERIANTCTDLGLICFPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKVFAE... 465
34 -83.5003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  25  3..............................LNQSNELNAWDRDHFFHPSTHMTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHAYHGTEASITLAKMIIDRAPMSRVYFGLSGSDANETNIKLIWYYNNVLGR--PEKKKIISRWRGYHGSGVMTGSLTGLDLFHNAFDLPRAPVLHTEADKLEEMILAEGPETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAKGLTSAYAPLSGVIVADRVWQVLVQGSHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGG-HKNVGEVRGDGMLAAVEFVADKDDGPQVATALAASGVIGRAMPGDILGFAPPLCLTREQADIVVSKTADAVKSVFAN... 459
35 -83.3003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  26  1..........MGSSSSGLVPRGSHMAAATGGLTPEQIIAVDGAHLWHPYSSIPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGLTHEPAARLAKLLVDITGLDTVFFSDSGSVSVEVAAKMALQYWRGRGL--PGKRRLMTWRGGYHGDTFLAMSICDPHGMHSLWTDVLAAQVFAPQVPSAAFEAQLAAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGAHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTA--RALPAVTDVRVCGAIGVIECDRPV-DLAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLVGS.... 449
36 -83.3004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  25  2.................GSSSSGLVPRGSHMNKPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFRMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEGK--PQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFVHLTARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHI--AERPNIGEYRGIGFMWALEAVKDKASSERIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKVFAE... 465
37 -83.3004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  24  2............GSSSSGLVPRGSHMNQQVNVAPSAAADLNLKAHWMPFSANPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGTLDYSPGFYGHPLSFQLAEKIAQMTTLDHVFFTGSGSECADTSIKMARAYWRIKGQ--AQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGPLMDVDHLPHANELLKLIELHDASNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFGRMGKATGAEYFGVTPDIMNVAKQVTNGAVPMGAVIASSEIYDTFMNQNHGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGL--KGTKNVIDIRNCGLAGAIQIAARDGDPFEASMKLWKEGFYVRFGG-DTLQFGPTFNAKPEDLDRLFDAVGEALNGVA..... 462
38 -83.2003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  24  2..............................MLKNDQLDQWDRDNFFHPSTHLNRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQARELAYYHSYHGTEASITLAKMILDRAPMSKVYFGLGGSDANETNVKLIWYYNNILGR--PEKKKIISRWRGYHGSGLVTGSLTGLELFHKKFDLPVEQVIHTEVAELEALIEREGADTIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTMFGSDHYGLEPDIITIAKGLTSAYAPLSGSIVSDKVWKVLEQGTHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEALSQ-HANVGDVRGEGLLCAVEFVKDRDSGPQISAKLLEQDKIIARAMGDILGFAPPFCLTRAEADQVVEGTLRAVKAV...... 456
39 -83.2003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  24  2.................ASMTGGQQMGRGSMNKPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFRMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEGK--PQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFVHLTARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHI--AERPNIGEYRGIGFMWALEAVKDKASSERIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKVFAEVAA 468
40 -83.2005ghf_A mol:protein length:456 Aminotransferase class-III  ali model follow..  26  2..............................TAQPNSLEARDIRYHLHSYTDAPLVIERGDGIYVEDVSGKRYIEAMSGLWSVGVGFSEPRLAEAAARQMKKLPFYHTFRSHGPVIDLAEKLVSMAPMSKAYFTNSGSEANDTVVKLIWYRSNALGE--PERKKIISRKRGYHGVTIASASLTGLPNNHRSFDLPIDRILHTGADELEQLIIAEGPHTIAAFIGEPVMGAGGVVVPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNLFGSQTFDMKPDILVMSKQLSSSYLPISAFLINERVYAPIAEESTGFTASGHPVAAAVALENLAIIEERDLVANARDRGTYMQKRLREL--QDHPLVGEVRGVGLIAGVELVTDKQAGAKANAVLQERGVISRAMG-DTLAFCPPLIINDQQVDTMVSALEATLNDVQASLTR 456
41 -83.1005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  28  1..............................MGSSYEKYKNAEKKFWHPMGSSTLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDELAYYQTFIAHPRVFDLAERLTGMFRMARVLFSSGGSDAVETALKMARQYWIASGE--PGRTRFLSLRNGYHGVHMGGTSVGGNGVYHYNHGQLLAGCHLLDIRQLEEQIALLGAQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFGRSGCMLGSRGWGVAPDILCLAKGITAGYIPLGATLFNQRIADAIENGQHGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLVER-YAVVGEVRGKGLMIALDLVSDKRTPSRIADEARRAGVLVRPIG-NKIILSPPLTLTRDEAGLMVSALEAAFARC...... 451
42 -83.0005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  2.................GSSSSGLVPRGSHMTSLEQLLEMDRAHFMHPSTHAGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQLAYYHTYHSNDPVIELSSRIIEDWGMKKVFYGMSGSDANETQIKLVWYYNNVLGR--PNKKKIIARERSYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVVEELEKLIAREGADTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKTGSEHYGIKPDLITVAKGLTSAYAPLSAVIVSEKVWDVIEKGSHGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGA-HPLVGEVRGVGMLAALEFMADKGASQKVAAAALEDGLIVRALPGDILGFAPPLVTTRAEVDEIVAIAKEAFDEVADA... 471
43 -83.0004grx_A mol:protein length:465 Aminotransferase  ali model follow..  24  2...................ASWSHPQFEKGANQPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRFPGYHAFRMSDQTVMLSEKLVEVSPNGRVFYTNSGSEANDTMVKMLWFLHAAEGK--PQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFIHLTARELEDTITREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFGRTGNTWGCLTYDFMPDAIISSKNLTAGFFPMGAVILGPDLAKRVEAAVHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKRI--ADRPNIGEYRGIGFMWALEAVKDKPTSERIANTCTDLGLICRPLG-QSIVLCPPFILTEAQMDEMFEKLEKALDKVFAE... 463
44 -83.0006erk_A mol:protein length:451 Aminotransferase  ali model follow..  25  2..................GSDKIENLYFQGHMTTVSTNDFDQQHLWHPYASLNIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGKMAHVMFGLTHQPAIDLGKKLLSIVGLDAIFYADSGSIAVEVALKMALQYQIAAKR--PSKCQFASTHSGYYGDTWHAMSVCDPNGMHSLYGKQLPMQHFVAAPEALTEFFVKNSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFGRSGKLFACEHAAISPDIMTIGKALTGGYMTFAATLSTREIADTISQSDHGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPA--VSLEGVKEVRCLGAVAVIELNEAV-DMPIFQTLLINNGIWVRPFG-KLVYIMPPYVITDDELTTLCQALLKVVSSYLTRKD. 445
45 -82.9003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  23  1......................MSLATITNHMPTAELQALDAAHHLHPFSANTRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRELPYYNTFTTHVPAIALAQKLAELAPLNHVFFAGGGSEANDTNIRMVRTYWQNKGQ--PEKTVIISRKNAYHGSTVASSALGGMAGMHAQS-GLIPDVHHINARELEEAILELGENRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYAPIGGSIVCDEVAHVIGKDEHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEALTD-HPLVGEAKIVGMMASIALTPNKASRAKCRERCFANNLIMRHVG-DRMIISPPLVITPAEIDEMFVRIRKSLDEAQAEIEK 458
46 -82.9005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  26  2....GSSSSGENLYFQGHMASGSEFELMGKLDKASKLIDEENKYYARSINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAFHHVPGMELSEKLAKIAPGNMVSFGNSGSDANDAIIKFARAY--------TGRQYIVSYMGSYHGSTYGSQTLSGSSNMTRKIGPMLPSVVHVPYPDSKPFESFLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEM-QQRHPMIGDVRMWGLNGGIELVKDPKTATKVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAVENGEVT 464
47 -82.7005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  25  2.................GSSSSGLVPRGSHMTDFDQLFEQDRAHFMHPSTHAGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKELAYYHTYHSTEAIIELSSRIIRDWGMKKVYYGLSGSDANETQIKLVRYYNNVLGR--PQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFDLPVEGIKHTVADELEKLILAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFGRLGSKMGSQRYGMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIEKASHGWTYSGHPICAAAALANLDILERENLTANAADVGAYLNQRLRETFEG-HPLVGEVRGDGMLAALEFMADREAGPKVSAACLEDGMIARAMPGDILGFAPPLVLTRAEADEIVGIAKAAVDEVAGE... 471
48 -82.5003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  23  1..........................NMPEHAGASLASQLKLDAHWMPYTANPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLSTLDYSPGFYGHPLSFQLAEKITDLTNLNHVFFTDSGSECALTAVKMVRAYWRLKGQ--ATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQPMQDVDHLPADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASTEIYQTFMNQPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGI--KGAKNVIDIRNFGLAGAIQIAPRDGDPFEAGMALWKAGFYVRFGG-DTLQFGPTFNSKPQDLDRLFDAVGEVLNKLLD.... 449
49 -82.5003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  21  4..........................RNDATNAAGAVGAAMRDHILLPAQEMQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYASPWMATSPAARLAEKIATLTPLNRIFFTTGGSTAVDSALRFSEFYNNVLGR--PQKKRIIVRYDGYHGSTALTAACTGRTGNWPNFDIAQDRISFLSVQEFEDRIESLGPDTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKFGVVPDIITFAKGVTSGYVPLGGLAISEAVLARISGENNGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASL--RDLPGVAETRSVGLVGCVQCLLDPTRTLKIDERCFELGLIVRPLG-DLCVISPPLIISRAQIDEMVAIMRQAITEVSAA... 457
50 -82.5005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  2.................GSSSSGLVPRGSHMTDLDQLFEMDRAHFMHPSTHAGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKELAYYHTYHSTEAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKLVWYYNNVLGR--PQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFDLPIERIKHTVADELEKLILAEGPDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFGRLGSKMGSQHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLRETFGG-HPLVGEVRGVGMLAALEFMADKDAGPKVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVGIAKQAVDEVADE... 471
51 -82.4001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  27  1............................MSLNDDATFWRNARQHLVRYGGTFPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSGMLSRPVVDLATRLANITPLDRALLLSTGAESNEAAIRMAKLV--------TGKYEIVGFAQSWHGMTGAAASATYS-AGRKGVGPAAVGSFAIPAPFAFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGL-PLAAIVTSAAIEERAHELGFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDL-MERFDCIGDVRGRGLLLGVEIVKDRRTGAKITRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA...... 432
52 -82.3005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  25  2.................GSSSSGLVPRGSHMTSLDQLFEEDRAHFMHPSTHAGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYHSTDAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKIVWYYNNVLGR--PNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVVEELEKLIAREGADTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFGRLGSKMGAQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGA-HPLVGEVRGVGMLAALEFMADKDAGPKVSAAALEDGVIARAMPGDILGFAPPLVTTRAEVDEIVGIVKQAVDEVADE... 471
53 -82.1005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  25  2.................GSSSSGLVPRGSHMQSLDQLFEMDRAHFMHPSTHAGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYHSTDAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKLVWYYNNVLGR--PNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVVEELEKLIAREGADTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKMGSQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGA-HPLVGEVRGVGMLAALEFMADKDAGPKVSAAALEDGMIARAMPGDILGFAPPLVTTRAEVDEIVGIAKQAVDEVADE... 471
54 -82.0005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  2.................GSSSSGLVPRGSHMTDTDDLLEMDRAHFFHPSTHLGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKELAYYHTYHSNEPIIELSERIIREWGMSKVYYGMSGSDANETQIKLVWYYNNVLGR--PQKKKIISRQRGYHGSGIMTGSLTGLPAFHNHFDLPLEPIRHTTADELEKMILAEGPDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFGRTGSMFGSHHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWKVLEQGSHGWTYSGHPICAAAALANLDIIERENLTGNAADTGAYFQQRMRETFGD-HPLVGEVRGVGLMAALEFVADKDKGPRVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVDIAKQAVDAVADE... 471
55 -82.0005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  25  2.................GSSSSGLVPRGSHMTDYAKLFEQDRAHFMHPSTHAGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQLAYYHTYHASEAIIELSARIIRDWGMKKVYYGLSGSDANETQVKLVRYYNNVLGR--PQKKKIISRQRGYHGSGIVTGSLTGLASFHQHFDLPVEGVKHTLAQELENLILAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFGRLGDKMGSQRHAMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIDSASHGWTYSGHPICAAAALANLDILERENITANAADVGGYLNQQLRQAFEG-HPLVGEVRGDGMLAALEFMADREARTPVSAACLERGMIARAMPGDILGFAPPLVLSRAEADEVVGIAKAAVDAVAAE... 471
56 -82.0003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  27  2..........................................SNVFYRSSKPYPVAVRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHGSFSSDVLEEYAGRLARFVGTFRFWAVSGGSEATESAVKLARQYHVERGE--PGRFKVITRVPSYHGASLGSLAASGMGARRELYTPLMRPEAWPKLEGLRALLEREGPETVAAFMAEPVVGADAALAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIAVLGKGLAAGYAPLAGLLAAPQVYETVMGGSHGFTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALQAR-FPQMMQVRGTGLLLGVVLGDLATGASRIGAAALKRGLITYPGSGDHLLLGPPLSITAAEVDGLLALLAGALEDV...... 428
57 -81.9001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  24  2.................................TTDDLAFDQRHILHPYTSMVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWQAKG---EARQRFLTFRNGYHGDTFGAMSVCDPDNMHSLWKGYLPENLFAPAPQMVGFARLMARHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPA--RDAEMVADVRVLGAIGVVETTHPV-NMAALQKFFVEQGVWIAPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDETFFCQ. 429
58 -81.8004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  24  2..........................NQPLNVAPPVSSELNLRAHWMPFSANPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFYGHPLSFQLAEKIAGLLELNHVFFTGSGSECADTSIKMARAYWRLKGQ--PQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLMDVDHLPHANELLKLIELHDASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQAHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGL--QGAKNVIDIRNCGLAGAIQIAPRDGDPFEAGMKLWQQGFYVRFGG-DTLQFGPTFNARPEELDRLFDAVGEALNGIA..... 448
59 -81.7001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  24  2.................................TTDDLAFDERHIWHPYTSMVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMGEITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWDAKG---EARDRFLTFRNGYHGDTFGAMSVCDDNSMHSLWKGYLPENLFAPARDMVGFARLMARHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISDGEHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPA--RDAEMVADVRVLGAIGVVETTHPV-NMAALQKFFVEQGVWIRPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDETFFCQ. 429
60 -81.4005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  25  1..............................QGMTTDDLAFDRRHIWHPYTSMVFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDAMSHVMFGITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWQAKG---ESRQRFLTFRNGYHGDTFGAMSVCDPHNMHSLWKGYLAENLFAPARDMVAFARLMARHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRLFACEHAGIAPDILCLGKALTGGTMTLSATLTSRQVAETISNGEHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPA--ADSPQVADVRVLGAIGVVETTRPV-NIAALQQFFVRQGVWVRPFG-KLIYLMPPYIIQPEQLRRLTQAVNEAVREETFFS.. 430
61 -80.7005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  23  2...................TSETTTTPSRVPQTANDLLARRYATIGPHFYRQPLELVSGSGVWLTDAQGKVYLDGYNN--VPHVGHANPAVADAIYQQLLTVNLHTR-YLNSRVVEYAEALLSKFDLERLFLTNSGSEANELALRIARQH--------TGNTGVLVSDFSYHGNTTSLAEITTGLTVHEPLGAHVPDVSGIAEVDLADVDAAIAGHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSMWGYQMFNVEPELVTMGKPMGNGH-PIGAVVTTAELLDEFRHNMFFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENI-AQRSGNVGSVRGRGLFFGIDIIESDGSTKILIEDMRERGVLISRVGDNVLKMRPPLVFGREHADILLGQLELSLASLPQP... 441
62 -80.5004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  25  3.............................KQRTTSQWRELDAAHHLHPFTDTARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFTTHPAVVELSSLLAEVTGFDRVFYTNSGSESVDTMIRMVRRYWDVQGK--PEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDIGPYMQKRWRETFSR-FEHVDDVRGVGMVQAFTLVKNKAKGTLCRDIFFRNNLIMRACG-DHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLKA 455
63 -79.8003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  27  2.................................THDLIEKSKKHLWLPFTQMPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHSTLLMTNVPATQLAETLIDISKLTRVFYSDSGAEAMEIALKMAFQYWKNIGK--PEKQKFIAMKNGYHGDTIGAVSVGSIELFHHVYGPLMFESYKAPIPYLRELAQLLEHEEIAALSIESVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDYHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDL--HALPHVGDIRQLGFMCGAELVRSKETGYKVSLKMRELGMLTRPLG-DVIAFLPPLASTAEELSEMVAIMKQAIHEVTSL... 446
64 -78.9003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  26  1......................SSGLVPRGSHMTKALYDRDGAAIGNKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANPAGATILASNAPAVTLAERLLASFPGEKIWFGHSGSDANEAAYRAIVKA--------TGRSGVIAFAGAYHGCTVGSMAFSGHS--VQADAAKADGLILLPYPDLTEKLAAVPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCA-SAFAMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSEL-AKRHPLIGDIRGRGLACGMELVCDRQSTAKLIYRAYQLGLVVYYVGGNVLEFTPPLTITETDIHKALDLLDRAFSELSAVSNE 438
65 -78.1005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  26  4...............................AMAGNLYGRDGAAIGSKLRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANPAGASILASNAPAVALAERLTASFPGRKVWFGHSGSDANEAAYRAITRA--------TGRTGVIAFIGAYHGCTVGSMAFSGHS--VQADAAKADGLILLPYPDLKERLAAVPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCA-SAFAMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARL-AERHELIGDIRGRGLACGVELVRNRQSTAKLIYRAYELGLVLYYVGGNVLEMTPPLTMTEDEVRHAVNLLDQAFTELSTVSDT 432
66 -76.3004a0f_A mol:protein length:831 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  19  323...............................ERLNGMAKLAGEVFWWPYTQHKIDSRCGENFSIYKASLSQQFDACASWWTQGPDPTFAELAREMGYTAARFGHVM--NVYEPALKCAELLLDGVGASRVYFSDNGSTAIEIALKMAFRKFCVDHNFKHIVVKVIALRGSYHGDTLGAMEAQAPSPYTGFLQPWYTGRGLFL-KHLQEHSGVRQSAHVGALIIEPVHGAGGMHMVDPLFQRVLVNECRNRKIPVIFDEVFTGFWRLGVETTTELLGCKPDIACFAKLLTGGMVPLAVTLATDAVFDSFSGDSHGHSYSAHAMGCATAAKAIQWFKDPETNHNITSQGKTLRELWDEELVQSHSAVQRVVVIGTLFALELKADASNAKSLLIMLREDGIFTRPLG-NVIYLMCGPCTSPEICRRLLTKLYKRLGEFNRT... 825
67 -55.1005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  21  28...............................PRSAQAYRENRRHWLYGPGNCPLLVKEAQGARVTDIDGQQYVDFALGDSGAMFGHAQPAVADAIARQARRGSTLM----TEDSLWVGAELARRFGLPYWQVTTSATDANRFVLRLCRML--------SGRDKVVVFNCNYHGSVDESQVEFDAAGRMVPRAGVHPTTRLVEFNDLDALEAALAHGDVAAVLTEPFMTNVGMVPPAEGFHAGLRELTRRHDVALIIDETHT---SCGPAGYSGAHGLEPDFFVLGKCIAGGI-PSAVWGCSQAQAERIWA--FGGTLAGNALQLAAMRATFAEVMTEDAYRHMFQLAAQLEAGVRATLEEL-RLPWHVTRIGARVEYLFMTNGLIEACLHLYLLNRGVLLTPFHNMALTCP---ATRAEDVELHDRLLRDCLGELLER... 459
68 -54.5002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  21  26.PASDTAEKAQAIAAARNTFARDNPVSAGHHERARRSMPGGNTRSILFHRPFPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQ--TENEALFAEAVCDFPSIDLVRFTNSGTEANLMALATATAI--------TGRKTVLAFDGGYHGGLLNFASGHAPTN-------APYHVVLGVYNDVEGTADLLKRHDCAAILVEPMLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS--RLSGGGAQEMLGISADLTTLGKYIGGGM-SFGAFGGRRDLMERFDPARHAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIAVEN-QAPLQFTGLGSLGTIHFSRDQQLKELFFFHMLRKGIYLAPRGMYAL----SLEIADAGRDAFAEALADFIGEQRA.... 456
69 -54.4002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  21  13.........................GSVFWAQRARSVMPDGVTADTRAFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAAS--HPLEVRWAERIVAFPSIRKLRFTGSGTETTLLALRVARAF--------TGRRMILRFEGHYHGWHDFSASGYNSHFDGQPAPGVLPETLLIRPDDIEGMREVFANSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGL-PGGILGGREDVMGVLSRGSHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARK-GLNWLAYGRFSGFHLMPRPDVKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRLADE... 438
70 -54.3006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  21  13.........................GSVFWAQRARSVMPDGVTADTRVFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAAS--HPLEVRWAERIVAFPSIRKLRFTGSGTETTLLALRVARAF--------TGRRMILRIATHYHGWHDFSASGYNSHFDGQPAPGVLPETLLIRPDDIEGMREVFAQSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGL-PGGILGGREDVMGVLSRGSHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARK-GLNWLAYGRFSGFHLMPRPDVKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRLADE... 438
71 -53.8006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  20  1............................MGSSSSENLYFQGGGHMTKNEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDA-VLERLHALCGGEVVGLFRSGTAAVRAAVLAVREA--------TGRPLLL--SAGYHGYDPMWYPSEAPLEPNA-------DGVVDFFFDLGLLRELLRPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV--SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDA-SLPVEIAGDGTFFQFVPATEELE-EALYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERLAPY... 390
72 -53.7006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  20  2.............GSSSSENLYFQGGGHMTIDIGAGKLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTA-WSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVR----------DARDRSIVLSSGYHGYDPMWHCDEPFTPNQHGI--------VEFLFDLDVLAEWLSPEQVAAVVISPDHMHLG-----ERWYTEFTRLTKEADVPVIADEVKVGL-RYRA--GLSTPLLDPAVWIVAKCLANGS-PVAAVGGDAHLLAALEDV--SFTSYFEPTAMAAATTTLRRMATGEPQQAIRAAGDRFIAHTRAAFANA-GVPIDLAGNGNLFQFVCADDEV-ADAFHAAAAAEGLLFFEGDNQTPSAA-----TDEVVEDACGRIDRVSAALTGR... 391
73 -53.7005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  22  15.............................PGSAAADLFERARRVLTVYSAPYPPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLADGVAFAMP--TEHEIALAELLTEVPSLQQVRFTNSGTEAVMMAIKAARAY--------TGRPRIAKFDGCYHGSYDFAEVSTQSSGKPGE-QAVLDSVVVLPFNDIDGTERLIEQDELAAVLIDPNPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVIS---RSDYGGMQSVLGVTPDLTAMGKIIGGGF-PVGAVGGSAEVMSVFDPTGHGGTFNANPVTMVAGLTAMRKL-TPAEFDRLATLGQQLRAGVEEVLREA-GVPGQVTGYGSLFHIHLHQERAFVGRVHEALMGRGIFITPALFGCLSTP-----GVPEVEAFVDAFAAALQDARG.... 446
74 -53.4005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  21  1............................MAMSRSETLFNNAQKHIFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAP--TALEVEMADLVCSMVSMEMVRMVSSGTEATMSAIRLARGY--------TGRDSIIKFEGCYHGHSDSLLVKAGSGALTFGV-PNSPGVLTLPFNDIEAVRKTLGEKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDLSTFGKIIGGGM-PVGAFGGKREIMQQISPLGQAGTLSGNPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAA-GIPFVTTQAGGMFGLYFSGDVERFKRFFHLMLDGGVYLAPSAFEAGFTS--IAHGDKELEITLNAAEKAFAALK..... 429
75 -53.4006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  20  2................................TKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDA-VLERLHALCGGEVVGLFRSGTAAVRAAVLAVREA--------TGRPLLL--SAGYHGYDPMWYPSEAPLEPNAD-------GVVDFFFDLGLLRELLRPERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV--SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDA-SLPVEIAGDGTFFQFVPATEELE-EALYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERLAPY... 374

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.