current user: public

If you have questions about the server, please let us know.

Query: 4zv5_A mol:protein length:91 Matrix protein p10, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst GVSGSKGQKLFVSVLQRLLSERGLHVKESSAIEFYQFLIKVSPWFPEEGGLNLQDWKRVGREMKRYAAEHGTDSIPKQAYPIWLQLREILTLast
1 -47.7004zv5_A mol:protein length:91 Matrix protein p10  ali model  100  1GVSGSKGQKLFVSVLQRLLSERGLHVKESSAIEFYQFLIKVSPWFPEEGGLNLQDWKRVGREMKRYAAEHGTDSIPKQAYPIWLQLREILT 91
2 -46.6005hyb_A mol:protein length:91 Matrix Protein  ali model follow..  98  1GVSGSKGQKLFVSVLQRLLSERGLHVKESSAIEFYQFLIKVSPWFPEEGGLNLQDWKRVGREMKRYAAEHGTDSIPKQAAPIWLQLREILT 91
3 -44.2002mv4_A mol:protein length:125 Matrix protein p10  ali model follow..  30  2GQELSQHE-RYVEQLKQALKTRGVKVKFADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYFNTFGPEKVPVTAFSYWNLIKELID 91
4 -44.2005lmy_A mol:protein length:125 Matrix protein p10  ali model follow..  30  2GQELSQHE-RYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELID 91
5 -44.1005ldl_A mol:protein length:124 myristoylated M-PMV matrix protein mutant  ali model follow..  30  1GQELSQHE-RYVEQLKQALKTRGVKVKYADLLKFFDFVKDICPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVIAFSYWNLIKELID 90
6 -42.6001bax_A mol:protein length:94 M-PMV MATRIX PROTEIN  ali model follow..  30  2GQELSQHER-YVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKRWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELID 91
7 -42.0002f77_X mol:protein length:100 Core protein p10  ali model follow..  30  2GQELSQHE-RYVEQLKQALKTRGVKVKYADLLKFFDFVKDTCPWFPQEGTIDIKFWRRVGDCFQDYYNTFGPEKVPVTAFSYWNLIKELID 91
8 -12.1005kza_A mol:protein length:104 virus matrix protein  ali model follow..  1.....SEFEAVIKVISSACKTYCGKTSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSG-----LKTWGLVLGALK 84
9 -11.4001a6s_A mol:protein length:87 GAG POLYPROTEIN  ali model follow..  2........EAVIKVISSACKTYCGKTSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSG-----LKTWGLVLGALK 82
10 -11.1005kz9_A mol:protein length:163 Virus Matrix Protein  ali model follow..  2........EAVIKVISSACKTYCGKTSKKEIGAMLSLLQKEGLLMSPSDLYSPGSWDPITAALSQRAMILGKSG-----LKTWGLVLGALK 82
11 -9.0702jxj_A mol:protein length:96 Histone demethylase JARID1A  ali model follow..  13  1GPLGSRVRLDFLDQLAKFWELQGSTLKILDLYALSKIVASKG-----EMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHY............ 83

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.