current user: public

If you have questions about the server, please let us know.

Query: 4zva_A mol:protein length:165 Diguanylate cyclase DosC, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst GAMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDENYRLast
1 -77.4004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model  100  1GAMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDENYR 165
2 -68.0004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  97  6KRMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFLE............. 157
3 -64.9004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  27  7.ILALRWKDTSAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLSDQLVKTKLHASMQDWLESVYAAAPTEYERTVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDALSAAQAAATCRYVADVTMTAVEMMSHAYSVSHDRNARAEE... 169
4 -63.6002w31_A mol:protein length:162 GLOBIN  ali model follow..  17  3.TMQEIKAHYFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLKEDLVLQKLKQTHQDWFVSLFAGSYD--NRYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASYREEEMRKFFVSH... 162
5 -62.5004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  32  49.QQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFLTHEQVKSRLHGTLRQWIVSVFSMSDDDAQALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRAFSDAYDRNSRSEE... 211
6 -54.6001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  13  32ADVKKQLKMVLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVID--DEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLVLE................. 178
7 -53.5005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  19  7TVFEELKRYVWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALGGESQVGHLKVTMIAWLDELLGGPWD--EAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERHGDPPELERVRNALGKVLDLELAVMLHTYRED............ 160
8 -48.6002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  13  23EDLKLLKEAVFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTNEKYLAAVRKRFSRWILDTSNRSYD--QAWLDYQYEIGLRHHRTKKNQTDNVESVPNITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGD.......... 194
9 -18.9002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  13  1..........MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFY---IDIEKKLYDK............. 140
10 -18.7001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  1.........MLDQQTINIIKATVPVLKEHGVTITTTFYKNLFAHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATD-----DILDAWGKAYGVIADVFIQVEADLYAQAVE...... 146
11 -18.6003pmd_A mol:protein length:153 Conserved domain protein  ali model follow..  6................ATKRYLCLYLKESQEKFISNWKKRILVHEHDPYKNEIIKNGTHLLHVFTMYMRE------INLQDIEDISKKIAQERMDAKVNIADFIYNTNEGKKEILNTLFLLNPTGQECKVVIEQINLFFDHLIYSTIYSYYKLKKEYIHSYYEL. 148
12 -17.2003pmc_A mol:protein length:139 Uncharacterized protein pXO2-61/BXB0075/GBAA_pXO2_0075  ali model follow..  6................EIKCLLCRYLKERQEKFISDWKKKVIIRERDPYKEEIIKNGEHLLSAFIMYLKE------ISLQEIEITSKKIARERIDAKVNIAEFIHNTNVAKIEIMNILTLLNPDLQQYQALVKKINQFFDHLIYYTVHSYYE............. 136
13 -16.7003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  13  1.........MIDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEPTVSVLFQNPISSQKLMQVLGILVQGI-----DNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAKVYGIAAQVM.......................... 130
14 -16.1003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  14  1..........MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDEPKVRPLFKIDIEKQKLMDVLNWIVLNL-----QDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTK-----QLEQLWTQAYEALAQVMIEE................ 132
15 -15.4004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  1..MATLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMENPETFQIFKEMRSHPRFKSHAKSIGKVICLVDLNGVKKHEPKLSSLGAMHTKKKVPTELF----GKLGGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE................. 154
16 -15.3001cqx_A mol:protein length:403 FLAVOHEMOPROTEIN  ali model follow..  11  1.........MLTQKTKDIVKATAPVLAEHGYDIIKCFYQRMEAHPELKNVFNMAHQEQGQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATD-----DIISAWAQAYGNLADVLMGMESELYERSAEQPGGWK 152
17 -15.2004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  1.........MLAEKTRSIIKATVPVLEQQGTVITRTFYKNMLEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDDLSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATP-----EIINAWGEAYQAIADIFITVEKKMYEEA........ 144
18 -15.0006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  14  10..........................AAAVAATVDVFYKKLMNDPDLEPFFRGVD-MVTLIAKQNRFLAYAFGAT----THYHGKDIV--MGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGV........................... 114
19 -15.0003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  1..MESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEAPTTKKMFSDSPIPAEQNPKLKPHAMSVFVMKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSP-----EMKVAWGQAYDHLVAAIKAEMNLS............ 159
20 -15.0001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  10  14..........FSEEQEALVLKSWAILKKDSANIALRFFLKIFEAPSASQMFSFLRNSDEKNPKLKTHAMSVFVMKAGKVTVRDTTLKRLGATHLKYGVGDAHF----EVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE........... 166
21 -14.9002bnl_A mol:protein length:136 MODULATOR PROTEIN RSBR  ali model follow..  12  5...................QTVYQFIAENQNELLQLWTDTLKELSEQESYQLTDQVYENISKE----YIDILLLSVKDENAAESQISELALRAVQIGLSMKFLATALAEFWKRLYTKMNDKRLPDQESTELIWQIDRFFSPINTEIFNQYSIS............ 134
22 -14.9001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  1..........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFEDSLSSPEFLDHIRKVMLVIAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDGE............ 151
23 -14.9001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  12  1.........MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPGQEVLDAWGKAYGVLANVF.......................... 131
24 -14.8002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  4..........MERPESELIRQSWRVVSRSPLEHGTVLFARLFAEPSLLPLFEDSLSSPEFLDHIRKVMLVIAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTP-----ATRTAWSRLYGAVVQAMSRGWDGE............ 154
25 -14.8004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  1..........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFEDCLSSPEFLDHIRKVMLVIAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDGE............ 151
26 -14.7002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  12  1.........VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAH-VADGLTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP-----AVHASLDKFLSSVSTVLTSKY............... 140
27 -14.7001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  13  4..........CGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQSPAARDMFKRVRGDNIHTPAFRAHATRVLGGLLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGI.......................... 142
28 -14.6001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  12  9..........................QAAVQAVTAQFYANIQADATVATFFNGID-MPNQTNKTAAFLCAALGGPNA-------TGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTV........................ 116
29 -14.6002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  11  13..........FGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEAPSAKQMFSFKTHAMSVFVMTCEAAAQL--RKAGKVTVRETTLKRLGATHLRYGVADGHF----EVTGFALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPDA........... 165
30 -14.6005v3t_A mol:protein length:132 Globin  ali model follow..  1..........MSKQPMTPFEAIGG--EQCIEILVDTFYSYVSKHPDLSPIFPDD--LTETARKQKQFLTQYLGGPNLYTEE--HGHPMLRARHLPFEITPK----RAEAWLSCMEQAMDDTGVHGHIREFVFERLALT........................... 118
31 -14.5001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  11  3..........FTEKQDALVSSSFEAFKANIPQYSVVFYTSILEAPAAKDLFSFTGHAEKLFALVRDSAGQL------KASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSD-----ELSRAWEVAYDELAAAIKKA................ 143
32 -14.5002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  1..........MSSETVTLYEAIGG--DATVRALTRRFYELMDTLPEAARCRAIHPALSGSEAKFYDYLTGYLGGPPVYVEKHGHP--MLRRRHFVAPIGPA----ERDEWLLCFRRAMDETIENAKLREIIWAPVERL........................... 121
33 -14.4002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  10..........FSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEAPSARQMFPFKTHAVSVFVMTCEAAAQL--RKAGKITVRETTLKRLGGTHLKYGVADGHF----EVTRFALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE........... 162
34 -14.4003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  12  3..........CGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKAPSARDMFKRVRGDNIYTPAFRAHATRVLGGLLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGI.......................... 141
35 -14.4002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  1........XSLSAKDKANVKAIWGKILPKSDEIGEQALSRMLVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQCVGHMDDLFGFLTKLSELHAKLRVDPTNFKILAHNLIVVIAAYFPAEFTP-----EIHLSVDKFLQQLALALAEKY............... 142
36 -14.4003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  10  10..........FTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEAPSAKNLFSYLKDSPI-NPKLKPHAMTVFVRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSP-----EMKNAWGEAYDQLVAAIKSEMKPSST.......... 162
37 -14.4003mvc_A mol:protein length:161 Globin protein 6  ali model follow..  3..........LTQPQILFVRKTWNHARNQALEPAISIFRNSFFNPEIRQMIMGHERLKKHAQLFTVLMDDLIA-NLDSPSATVAGLREAGEKHVWPPFHAHL----LDQFATAMIERTLEWGEKKDRTETTQRGWTKIVLFVTEQLKEGFQDEQKRARR...... 161
38 -14.4002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  13  2..........CTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFAMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGSLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGI.......................... 140
39 -14.4001g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  12  1.........VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAH-VGDALTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP-----AVHASLDKFLSSVSTVLTSKY............... 140
40 -14.3001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  10  1..........MGQSFNAPYEAIGE---ELLSQLVDTFYERVASHPLLKPIFPSD--LTETARKQKQFLTQYLGGPPLYTEEH--GHPMLRARHLPFPITNE----RADAWLSCMKDAMDHVGLEGEIREFLFGRLELT........................... 117
41 -14.3001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  10  52..........................REAVEAAVDKFYNKIVADPTVSTYFSNTD-MKVQRSKQFAFLAYALGGA----SEWKGKDMRTAHKDLVPHLSDV----HFQAVARHLSDTLTELGVPPEDITDAMAVVAST........................... 154
42 -14.3004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  11  11..........GSEAIKANLRRSWGVLSADIEATGLMLMSNLFTRPDTKTYFTRLGDVQKGKANLRGHAITLTYASLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAALVGVVQAAL.......................... 150
43 -14.3005d1v_A mol:protein length:127 Globin  ali model follow..  11  13..........................EATFRRIVDIFYARVEADPRLRHLFPAD--LEPGKEHQRLFLMQYFGGPRTYSERRGHPRLR--MRHAPFPIGPR----ERDAWLEHMLAALNEAGVPEPARSVMENYFRHA........................... 116
44 -14.3004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  10  31..........................EAGALAIANRFYDIMATDEYAKPLYDMHPLLDRIRQVFFEFLSGWLGGPDLFVAKH---HPMLRKRHMPFTIDQD----LRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQL........................... 137
45 -14.2002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  13  10..........................AAAVDLAVEKFYGKVLADERVNRFFVNTD-MAKQKQHQKDFMTYAFGGT----DRFPGRSMR--AAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSV........................... 114
46 -14.2003uh6_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSIALMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
47 -14.2001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGNVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
48 -14.2003uhc_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAAEF----GKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
49 -14.2003uhd_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVAHITRKISAAEF----GKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
50 -14.2003uhb_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITKKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
51 -14.2003uhi_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVERFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
52 -14.1002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  13  10..........................EETFTRLARRFYEGVAADPVLRPMYPEED-LGPAEERLRLFLMQYWGGPRTYSERR---HPRLRMRHFPYRIGAE----ERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYA........................... 114
53 -14.1003ugz_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
54 -14.1004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  12  13..........SNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKSPSAKGKFARLGDVSAGKDNLRGHSITLMYAALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAASLVAVVQAAL.......................... 152
55 -14.1003ugy_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
56 -14.1002r4x_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGVSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAAEF----GKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
57 -14.1003cy5_A mol:protein length:141 Hemoglobin subunit alpha-2  ali model follow..  12  1.........VLSAADKSNIQAAWGKVGGHAADYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGH-VANALTKAVGHLDDLPGALSELSDLHAHLRVDPVNFKLLSHSLLVTLASHLPNDFTP-----AVHASLDKFLASVSTVLTSKY............... 140
58 -14.1001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  10  12..........................AKTFDAIVSRFYAQVAEDEVLRRVYPEDD-LAGAEERLRMFLEQYWGGPRTYSEQRGHP--RLRMRHAPFRISLI----ERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF............... 128
59 -14.1002grf_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALVTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
60 -14.1002auo_A mol:protein length:146 Globin I  ali model follow..  10..........LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKYAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
61 -14.1002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  13  13..........................EETVAKLVEAFYRRVAAHPDLRPIFPDD--LTETAHKQKQFLTQYLGGPPLYTAEH--GHPMLRARHLRFEITPK----RAEAWLACMRAAMDEIGLSGPAREQFYHRLVLT........................... 116
62 -14.0004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  12  17..........................EAAVEKAVDVFYERIVADPQLAPFFANVD-MKKQRRKQVAFMTYVFGGS----GAYEGRDLG--ASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASA........................... 121
63 -14.0003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  11  14..........................ENAMKAAVPLFYKKVLADERVKHFFKNTD-MDHQTKQQTDFLTMLLGGPNH-------KGKNMTEAHKGMNLQNL----HFDAIIENLAATLKELGVTDAVINEAAKVIEHT........................... 114
64 -14.0003dht_A mol:protein length:141 Hemoglobin subunit alpha-1/2  ali model follow..  12  1.........VLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAFPTTKTYFSDVSPGSAQVKAHGKKVADALAKAADHVEDLPGALSTLSDLHAKLRVDPVNFKFLSHCLLVTLACHHPGDFTP-----AMHASLDKFLASVSTVLTSKY............... 140
65 -14.0001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  11  3..........LTESQAALVKSSWEEFNANIPKHTHRFFILVLEAPAAKDLFS-QAHAGKVFKLVYEAAIQL---EVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSE-----ELNSAWTIAYDELAIVIKKEMDDAA........... 153
66 -14.0002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  13  22..........................HEAIEVVVEDFFVRVLADDQLSAFFSGTN-MSRLKGKVVEFFAAALGGPEPYTGA------PMKQVHQGRGITMH-----FSLVAGHLADALTAAGVPSETITEILGVIAPL........................... 122
67 -14.0001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  15  2..........LEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFGTVKNTPEMAAQAQSFKGLVWVDNLDNAGALEGQCKTFAANHKARGISAGQL----EAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPDM...................... 142
68 -14.0001hds_A mol:protein length:141 HEMOGLOBIN S (DEOXY) (ALPHA CHAIN)  ali model follow..  10  1.........VLSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLFPTTKTYFPHFDLSHGSAQQKAH-VANALTKAQGHLNDLPGTLSNLSNLHAKLRVNPVNFKLLSHSLLVTLASHLPTNFTP-----AVHANLNKFLANDSTVLTSKY............... 140
69 -13.9002r4z_A mol:protein length:146 Globin-1  ali model follow..  10..........LTADVKKDLRDSWKVWGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........................ 145
70 -13.9001cg5_A mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  1.........VLSSQNKKAIEELGNLIKANAEAWGADALARLFEHPQTKTYFSKFSGFEACNEQVKKHGKRVMNAATHHLDNLHLHLEDLARKHGNLLVDPH-----FHLFADCIVVTLAVNLQAFTP--VTHCAVDKFLELVAYELSSCY............... 140
71 -13.9001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  14  22..........................HEAIEVVVEDFYVRVLADDQLSAFFSGTN-MSRLKGKQVEFFAAALGGPEP-------TGAPMKQVHQGRGITMH-----FSLVAGHLADALTAAGVPSETITEILGVIAPL........................... 122
72 -13.9004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  60..........................EELLRKLVEVHHENLMKSKIHYLFPTSHEQLRSLVKRSADFVVEMCGGP----PYYTLTRPKMRARHFSVTIDEK----AREIWLACYKHALKDVHFPLSVLEEFWQWIESF........................... 165
73 -13.9001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  2..........FTACEKQTIGKIAQVLAKSPEAYGAECLARLFVHPGSKSYFEDYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKLLVDPQNFPMLSECIIVTLATHLTE-------SPDTHCAVDKLLSAICQELSSRY............... 139
74 -13.9001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  11..........................TTAVDLAVDKFYERVLQDDRIKHFFADVD-MAKQRAHQKAFLTYAFGGT----DKYDGRYMR--EAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAP........................... 115
75 -13.8001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  14  2..........LSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFGTVKNTPEMAAQAQSFKGLVWVDNLDNAGALEGQCKTFAANHKARGISAGQL----EAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPNM...................... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.