current user: public

If you have questions about the server, please let us know.

Query: 4zvb_A mol:protein length:163 Diguanylate cyclase DosC, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MEMYFKRMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFLELast
1 -71.6004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model  100  1MEMYFKRMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFLE 157
2 -68.0004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  97  1.....GAMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTF 152
3 -63.8004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  27  1MKPSPEILALRWKDTSAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLSDQLVKTKLHASMQDWLESVYAAAPTEYERTVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDSLSAAQAAATCRYVADVTMTAVEMMSHAYSV 159
4 -62.1002w31_A mol:protein length:162 GLOBIN  ali model follow..  19  2.....LTMQEIKAHYFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLKEDLVLQKLKQTHQDWFVSLFAGSYD--NRYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASYRE 152
5 -60.2004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  32  43PGISPEQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFLTHEQVKSRLHGTLRQWIVSVFSMSDDDAQALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRAFSD 201
6 -56.2001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  13  27LTNKHADVKKQLKMVLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVID--DEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLVLE.... 178
7 -55.2005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  19  2TGVPETVFEELKRYVWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALGGESQVGHLKVTMIAWLDELLGGPWD--EAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERHGDPPELERVRNALGKVLDLELAVMLHTYRE 159
8 -49.9002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  13  18APFNLEDLKLLKEAVFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTNEKYLAAVRKRFSRWILDTSNRSYD--QAWLDYQYEIGLRHHRTKKNQTDNVESVPNITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVK 191
9 -20.0002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  13  1...............MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFY---IDIEKKLYDK 140
10 -18.2001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  1..............MLDQQTINIIKATVPVLKEHGVTITTTFYKNLFAHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDA-ATDDILDAWGKAYGVIADVFIQVEADLYAQ 143
11 -17.9003pmc_A mol:protein length:139 Uncharacterized protein pXO2-61/BXB0075/GBAA_pXO2_0075  ali model follow..  1................GSHMEEIKCLLCRYLKERQEKFISDWKKKVIIRERDPYKEEIIKNGEHLLSAFIMYLKE------ISLQEIEITSKKIARERIDAKVNIAEFIHNTNVAKIEIMNILTLLNPDLQQYQALVKKINQFFDHLIYYTVHSYYE 136
12 -16.9003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  13  1..............MIDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEPTVSVLFQNPISSQKLMQVLGILVQGI-----DNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAKVYGIAAQVM............. 130
13 -16.3003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  15  1...............MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDEPKVRPLFKIDIEKQKLMDVLNWIVLNL-----QDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLQAYEALAQVM............. 129
14 -15.7004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  10  1..............MLAEKTRSIIKATVPVLEQQGTVITRTFYKNMLEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDDLSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPE........................... 117
15 -15.6003pmd_A mol:protein length:153 Conserved domain protein  ali model follow..  6.....................ATKRYLCLYLKESQEKFISNWKKRILVHEHDPYKNEIIKNGTHLLHVFTMYMRE------INLQDIEDISKKIAQERMDAKVNIADFIYNTNEGKKEILNTLFLLNPTGQECKVVIEQINLFFDHLIYSTIYSYYK 136
16 -15.5004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  1.......MATLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMENPETFQIFPWADASKRSHPRFKSHAKSIGKVDLNGVKKHEPKLSSLGAMHTKKKVPTELF----GKLGGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE.... 154
17 -15.5001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  12  1..............MLDAQTIATVKATIPLLVETGPKLTAHFYDRMTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEMFSPGQEVLDAWGKAYGVLANVF............. 131
18 -15.3001cqx_A mol:protein length:403 FLAVOHEMOPROTEIN  ali model follow..  13  1..............MLTQKTKDIVKATAPVLAEHGYDIIKCFYQRMEAHPELKNVFNMAHQEQGQQQQALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNA-ATDDIISAWAQAYGNLADVLMGMESELYER 143
19 -15.3001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  10  14...............FSEEQEALVLKSWAILKKDSANIALRFFLKIFEAPSASQMFSFLRNSDEKNPKLKTHAMSVFVMKAGKVTVRDTTLKRLGATHLKYGVGDAHF----EVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKP 164
20 -15.3006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  14  10...............................AAAVAATVDVFYKKLMNDPDLEPFFRGVD-MVTLIAKQNRFLAYAFGAT----THYHGKDIV--MGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGV.............. 114
21 -15.1001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  13  4...............CGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQSPAARDMFKRVRGDNIHTPAFRAHATRVLGGLLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGI............. 142
22 -15.1003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  1.......MESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEAPTTKKMFSDSPIPAEQNPKLKPHAMSVFVMKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSP-----EMKVAWGQAYDHLVAAIKAEMNL 158
23 -15.0005v3t_A mol:protein length:132 Globin  ali model follow..  1...............MSKQPMTPFEAIGG--EQCIEILVDTFYSYVSKHPDLSPIFPDD--LTETARKQKQFLTQYLGGPNLYTEE--HGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVN............ 124
24 -15.0002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  10  1...............MSSETVTLYEAIGG--DATVRALTRRFYELMDTLPEAARCRAIHPALSGSEAKFYDYLTGYLGGPPVYVEKHGHP--MLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQN............ 127
25 -14.9002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  12  1..............VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAH-VADGLTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP-----AVHASLDKFLSSVSTVLTSKY.. 140
26 -14.9004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  1MQSLQDKASVLSGVDQAEAFAIDESNLFDKLLQTFINLSTNFYTRVYDDEEEWQSIFSNSNKEDAIQNQYEFFVQRMGGP----PLYSQRHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHTAFFL............. 144
27 -14.9004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  13  31...............................EAGALAIANRFYDIMATDEYAKPLYDMHPLLDRIRQVFFEFLSGWLGGPDLFVAKH---HPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMIN............ 143
28 -14.9003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  12  3...............CGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKAPSARDMFKRVRGDNIYTPAFRAHATRVLGGLLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGI............. 141
29 -14.9001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  10  1...............MGQSFNAPYEAIG---EELLSQLVDTFYERVASHPLLKPIFPSD--LTETARKQKQFLTQYLGGPPLYTEEH--GHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVN............ 123
30 -14.8001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  10  52...............................REAVEAAVDKFYNKIVADPTVSTYFSNTD-MKVQRSKQFAFLAYALGGA----SEWKGKDMRTAHKDLVPHLSDV----HFQAVARHLSDTLTELGVPPEDITDAMAVVAST.............. 154
31 -14.8002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  13  2...............CTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFAMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGSLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGI............. 140
32 -14.8002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  1.............XSLSAKDKANVKAIWGKILPKSDEIGEQALSRMLVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQCVGHMDDLFGFLTKLSELHAKLRVDPTNFKILAHNLIVVIAAYFPAEFTP-----EIHLSVDKFLQQLALALAEKY.. 142
33 -14.8001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  1...............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFEDSLSSPEFLDHIRKVMLVIAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDG 150
34 -14.8002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  4...............MERPESELIRQSWRVVSRSPLEHGTVLFARLFAEPSLLPLFEDSLSSPEFLDHIRKVMLVIAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTP-----ATRTAWSRLYGAVVQAMSRGWDG 153
35 -14.7002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  11  13...............FGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEAPSAKQMFSFKTHAMSVFVMTCEAAAQL--RKAGKVTVRETTLKRLGATHLRYGVADGHF----EVTGFALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKP 163
36 -14.7001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  11  3...............FTEKQDALVSSSFEAFKANIPQYSVVFYTSILEAPAAKDLFSFTGHAEKLFALVRDSAGQL------KASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSD-----ELSRAWEVAYDELAAAIKKA... 143
37 -14.7004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  1...............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFEDCLSSPEFLDHIRKVMLVIAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDG 150
38 -14.6002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  10...............FSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEAPSARQMFPFKTHAVSVFVMTCEAAAQL--RKAGKITVRETTLKRLGGTHLKYGVADGHF----EVTRFALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKP 160
39 -14.6003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  10...............FTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEAPSAKNLFSYLKDSPI-NPKLKPHAMTVFVRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSP-----EMKNAWGEAYDQLVAAIKSEMKP 159
40 -14.6004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  11  11...............GSEAIKANLRRSWGVLSADIEATGLMLMSNLFTRPDTKTYFTRLGDVQKGKANLRGHAITLTYASLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAALVGVVQAAL............. 150
41 -14.6001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  11  12...............................AKTFDAIVSRFYAQVAEDEVLRRVYPEDD-LAGAEERLRMFLEQYWGGPRTYSEQRGHP--RLRMRHAPFRISLIERDAWLRCMHTAV-ASIDSETLDDEHRRELLDYLEM---AAHSLVNSPF.. 128
42 -14.6001g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  12  1..............VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAH-VGDALTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP-----AVHASLDKFLSSVSTVLTSKY.. 140
43 -14.6005d1v_A mol:protein length:127 Globin  ali model follow..  12  13...............................EATFRRIVDIFYARVEADPRLRHLFPAD--LEPGKEHQRLFLMQYFGGPRTYSERRGHPRLR--MRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMN............ 122
44 -14.5002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  10  10...............................EETFTRLARRFYEGVAADPVLRPMYPEED-LGPAEERLRLFLMQYWGGPRTYSERR---HPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVN............ 120
45 -14.5004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  12  17...............................EAAVEKAVDVFYERIVADPQLAPFFANVD-MKKQRRKQVAFMTYVFGGS----GAYEGRDLG--ASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASA.............. 121
46 -14.5002bnl_A mol:protein length:136 MODULATOR PROTEIN RSBR  ali model follow..  11  5........................QTVYQFIAENQNELLQLWTDTLKELSEQESYQLTDQVYENISKE----YIDILLLSVKDENAAESQISELALRAVQIGLSMKFLATALAEFWKRLYTKMNDKRLPDQESTELIWQIDRFFSPINTEIFNQYSI 133
47 -14.4004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  12  13...............SNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKSPSAKGKFARLGDVSAGKDNLRGHSITLMYAALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAASLVAVVQAAL............. 152
48 -14.4002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  13  22...............................HEAIEVVVEDFFVRVLADDQLSAFFSGTN-MSRLKGKVVEFFAAALGGPEPYTGA------PMKQVHQGRGITMH-----FSLVAGHLADALTAAGVPSETITEILGVIAPL.............. 122
49 -14.4004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  60...............................EELLRKLVEVHHENLMKSKIHYLFPTSHEQLRSLVKRSADFVVEMCGGP----PYYTLTRPKMRARHFSVTIDEK----AREIWLACYKHALKDVHFPLSVLEEFWQWIESF.............. 165
50 -14.4001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  12  9...............................QAAVQAVTAQFYANIQADATVATFFNGID-MPNQTNKTAAFLCAALGGPNAWTGR------NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTV........... 116
51 -14.4003uh6_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSIALMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
52 -14.4001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGNVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
53 -14.4003uhc_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
54 -14.4003uhi_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVERFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
55 -14.4003uhd_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVAHITRKISAAEF----GKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
56 -14.4003uhb_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITKKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
57 -14.3002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  10  13...............................EETVAKLVEAFYRRVAAHPDLRPIFPDD--LTETAHKQKQFLTQYLGGPPLYTAEH--GHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVN............ 122
58 -14.3002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  13  10...............................AAAVDLAVEKFYGKVLADERVNRFFVNTD-MAKQKQHQKDFMTYAFGGT----DRFPGRSMR--AAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSV.............. 114
59 -14.3004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  11  43...............................EETFTRLARRFFEGVAADPVLRPMFPEED-LGPAEERLRLFLMQYWGGP----ETYSERRPRLRMRHEPYRIGAE----ERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYA.............. 147
60 -14.3001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  14  22...............................HEAIEVVVEDFYVRVLADDQLSAFFSGTN-MSRLKGKQVEFFAAALGGPEPYTGA------PMKQVHQGRGITMH-----FSLVAGHLADALTAAGVPSETITEILGVIAPL.............. 122
61 -14.3003ugz_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
62 -14.3003cy5_A mol:protein length:141 Hemoglobin subunit alpha-2  ali model follow..  12  1..............VLSAADKSNIQAAWGKVGGHAADYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKGH-VANALTKAVGHLDDLPGALSELSDLHAHLRVDPVNFKLLSHSLLVTLASHLPNDFTP-----AVHASLDKFLASVSTVLTSKY.. 140
63 -14.3003ugy_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
64 -14.3002r4x_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGVSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAAEF----GKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
65 -14.3001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  2...............FTACEKQTIGKIAQVLAKSPEAYGAECLARLFVHPGSKSYFEDYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKLLVDPQNFPMLSECIIVTLATHLTE-------SPDTHCAVDKLLSAICQELSSRY.. 139
66 -14.3003dht_A mol:protein length:141 Hemoglobin subunit alpha-1/2  ali model follow..  12  1..............VLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAFPTTKTYFSDVSPGSAQVKAHGKKVADALAKAADHVEDLPGALSTLSDLHAKLRVDPVNFKFLSHCLLVTLACHHPGDFTP-----AMHASLDKFLASVSTVLTSKY.. 140
67 -14.3002grf_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALVTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
68 -14.3002auo_A mol:protein length:146 Globin I  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKYAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
69 -14.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  11  3...............LTESQAALVKSSWEEFNANIPKHTHRFFILVLEAPAAKDLFSFQAHAGKVFKLVYEAAIQL---EVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSE-----ELNSAWTIAYDELAIVIKKEMDD 151
70 -14.2001cg5_A mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  1..............VLSSQNKKAIEELGNLIKANAEAWGADALARLFEHPQTKTYFSKFSGFEACNEQVKKHGKRVMNAATHHLDNLHLHLEDLARKHGNLLVDPHNFHLFADCIVVTLAVNLQA-------TPVTHCAVDKFLELVAYELSSCY.. 140
71 -14.2001hds_A mol:protein length:141 HEMOGLOBIN S (DEOXY) (ALPHA CHAIN)  ali model follow..  10  1..............VLSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLFPTTKTYFPHFDLSHGSAQQKAH-VANALTKAQGHLNDLPGTLSNLSNLHAKLRVNPVNFKLLSHSLLVTLASHLPTNFTP-----AVHANLNKFLANDSTVLTSKY.. 140
72 -14.2001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  15  2...............LEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFGTVKNTPEMAAQAQSFKGLVWVDNLDNAGALEGQCKTFAANHKARGISAGQL----EAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPDM......... 142
73 -14.1002r4z_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVWGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYAQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA........... 145
74 -14.1003bj1_A mol:protein length:142 hemoglobin alpha  ali model follow..  2...............LSSKDKDAVKALWGKIADKAEEIGADALGRMLAYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGGAVASIDDLNAGLLALSELHATLRVDPANFKILSHCILVQLAVKFPKDFTP-----EVHLSYDKFFSAVARALAEKY.. 141
75 -14.1001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  10  2...............LSAAEADLAGKSWAPVFANKNANGDAFLVALFEFPDSANFFADFKGKSKASPKLRDHSSTIFTRNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGK........ 146

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.