current user: public

If you have questions about the server, please let us know.

Query: 5Y8X Entity 1(prereleased), from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst MRRLAFLVVAFCLAVGCFFSPVSKAEGVMSGGDGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETRETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDLAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQVLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIGELast
1 -109.0005Y8X Entity 1(prereleased)  ali  100  1MRRLAFLVVAFCLAVGCFFSPVSKAEGVMSGGDGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETRETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDLAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQVLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIGE 398
2 -109.0005y9b_A mol:protein length:398 Gamma glutamyl transpeptidase  ali model follow..  99  1MRRLAFLVVAFCLAVGCFFSPVSKAEGVMSGGDGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETRETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKLEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDLAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQVLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIGE 398
3 -107.0003a75_A mol:protein length:384 Gamma-glutamyltranspeptidase large chain  ali model follow..  68  2.....................NHKVIEGRHMDEYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWK-YQEGSANYKQVEQPKDKVEG 377
4 -105.0004y23_A mol:protein length:585 Gamma glutamyl transpeptidase,Gamma-glutamyltranspeptidase  ali model follow..  95  1MRRLAFLVVAFCLAVGCFFSPVSKAEGVMSGGDGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETKETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDMAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQMLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYTIGEATHFTVTDQWGNVVS. 413
5 -103.0003whq_A mol:protein length:418 Gamma-glutamyltranspeptidase large chain  ali model follow..  64  15WNVCLTALLSVLLVAGSVPFHAEAKKPPKSYDEYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWK-YQEGSANYKQVEQPKDKVEG 411
6 -97.7002qm6_A mol:protein length:377 Gamma-glutamyltranspeptidase  ali model follow..  38  1.............MGSSSSGLVPRGSHMASAASYPPIKNTKVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLAN-GENVALDFREKAPLKATKNMFLDKQGNVVP-KLSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEARERFKYSSSKKYFFKKGLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALGYGASKNIHIAAEAMRQAYADRSVYMGDADFVSVPVDKLINKAYAKKIFDTIQPDTVTPSSQI-KPGMGQLHEGSN............. 371
7 -97.6002e0w_A mol:protein length:556 Gamma-glutamyltranspeptidase  ali model follow..  35  1..................AAPPAPPVSYGVEEDVFHPVRAKQGMVASVDATATQVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSK-NGNTTAIDFREMAPAKATRDMFLDDQGNPDS-KKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARDGFIVNDALADDLKTYGSEVNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTNKAYAKSIADQIDINKAKPSIRPGKLAPYESNQATHYSVVDKDGNAVA. 381
8 -95.9005bpk_A mol:protein length:379 Gamma-glutamyltranspeptidase (Ggt)  ali model follow..  37  1MRRSFLKTIGLGVIALFLGLLNPLSAA-----SYPPIKNTKVGLALSSHPLASEIGQKVLEEGGNAIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLAN-GENVALDFREKAPLKATKNMFLDKQGNVVP-KLSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETLKEARERFKYSSSKKYFFKKGLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELIEKDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENADLSALGYGASKNIHIAAEAMRQAYADRSVYMGDADFVSVPVDKLINKAYAKKIFDTIQPDTVTPSSQI-KPGMGQLHEGSN............. 379
9 -93.8003g9k_L mol:protein length:323 Capsule biosynthesis protein capD  ali model follow..  34  16.....................................GDKGTYGVSASHPLAVEEGMKVLKNGGSAVDAAIVVSYVLGVVELHASGIGGGGGMLIISKDKET--FIDYRETTPYFTGN------------------QKPHIGVPGFVAGMEYIHDNYGSLPMGELLQPAINYAEKGFKVDDSLTMRLDLAKPRI-YSDKLSIFYPNGEPIETGETLIQTDLARTLKKIQKEGAKGFYEGGVARAISK-----TAKISLEDIKGYKVEVRKPVKGNYMGYDVYTAPPPFS-GVTLLQMLKLAEKKEVYKDVDHTATYMSKMEEISRIAYQDRKKNLGDPNYVNMDPNKMVSDKYISTMKNENGDALSEAEHES.......................... 323
10 -91.4002nlz_A mol:protein length:547 Cephalosporin acylase  ali model follow..  27  2....................SVMFDPQSYPYPSRRNVVYAKNGMVATSQPLAAQAGLDILKAGGNAIDAAIATATALTVLEPTSNGIGSDAFALVWTK--GKLHGLNGSGRAPMSLTMEAVKAKGYEQ---ELPPYGVIPVTVPGAPGAWAELAKMYGNLPLAASLAPAIRYAEEGYPVTPTLAKYWKAAYDRVKTQPWFDTFAPKGRAPRVGEVWRSQGHADTLRSIAESNGESFYRGELADQIHAFFDKHGGYLTKEDLACYRPEWVEPISIDYRGYRVWEI-PPNGQGLVALEALNIVKGFEFY--HKDTVDTYHKQIEAMKLAFVDGMKYVTEPSDMSVSVEQLLSDEYATERRKEIGEQALTPE-----PGTPPRGGTVYLATADGDGNMVS. 372
11 -91.4005hft_A mol:protein length:364 Gamma-glutamyltranspeptidase  ali model follow..  23  1................MGSDKISSGENLYFQGHMHSSNVSTHGMAVAPHHLASQSALAILREGGSAIEAMVAAAAAIAVVYPHMNGLGGDGFWLIVPPE-GDPIAIDASGAAGSLATLEAYAGQRHIPNRG-----PQAALTVAGTVSGWVEALRISRALPVARLLADAIGYAEDGIPVTASQAHATASKLEELHQPGFSETWLVAGEAPRPGSRFRQPALAGTLRMLASDGLDSFYRGPLAERLAQGMAALGMPITLGDLQAHRARRPGPLTLQHQQGTLWNLAPPTQGLV-SLAILGITDRLKM--ADADDAQTVHRIVEATKRAFALRDAHITDPRHLDVDVQQLLTPEALQPLADSIDDASASPWGGGKGP....................... 356
12 -89.9004gg2_A mol:protein length:353 Gamma-glutamyltranspeptidase 1 heavy chain  ali model follow..  30  1.............................SASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQ-------SQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDVVLYMPSAPLSGPVLALILNILKGYNFSRESVESPETYHRIVEAFRFAYAKRT-LLGDPKFVDVTVRNMTSEFFAAQLRAQISDDTTHPISYYK......................... 343
13 -89.4004gdx_A mol:protein length:374 Gamma-glutamyltranspeptidase 1 heavy chain  ali model follow..  28  1VKKKLVVLGLLAVVLVLVIVGLCLWLPSAS--KEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQ-------SQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSAPLSGPVLALILNILKGYNFSRESVESPETYHRIVEAFRFAYAKRT-LLGDPKFVDVTVRNMTSEFFAAQLRAQISDDTTHPISYYK......................... 370
14 -84.4002i3o_A mol:protein length:516 Gamma-glutamyltransferase related protein  ali model follow..  24  3................................RSRPNALSQRSVIASSSELASLAGRDILKRGGNIFDAALAVSAMLCVTQNNLCGLGGDLFALIRDE-NGQIMDLNGSGQASRAVSIDYYESMGLTKIP---ERGPYAAITVPGIAGSWDEIFRKFATMDIADILEPAIRTASAGFPITQNYSDSIARSAPVIQYRGWSSIFMPNGSVPVAGEILKQPDLAESFRLMSEEGFRSFYDGSLADIIIAGLEGTGSPLSDRDLRVYRPLIGKPVFTDLDEFRIYETSPNSQ-GITVIEWIRGMESHGYDSRTMWEAK-IEDIFETMEEAYDKR-RKITDPSYMNIAQHDSANGKKDGLPKRDHN----------------DIGDTTYFSISDSEGRSVS. 345

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.