current user: public

If you have questions about the server, please let us know.

Query: 5d1v_A mol:protein length:127 Globin, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MSEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPADLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGEDLast
1 -72.5005d1v_A mol:protein length:127 Globin  ali model  100  1MSEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPADLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGED 127
2 -67.5002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  42  2.QWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPDDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHL 127
3 -66.9005v3t_A mol:protein length:132 Globin  ali model follow..  40  4.QPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNET 129
4 -66.0004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  31  20.PEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDMPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH... 145
5 -65.7002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  55  2....TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE.. 123
6 -65.3002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  34  4.ETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADN 132
7 -61.9001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  47  2..PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP... 127
8 -61.0004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  51  32.DQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDA 158
9 -60.5001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  39  4.SFNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAE 128
10 -60.0004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  24  6.PADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAG 132
11 -59.5002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  23  11.EPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTT 133
12 -59.2001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  25  11.EPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTT 133
13 -58.6006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  20  1...STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKG 125
14 -58.6003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  29  3.KPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK.... 121
15 -57.6002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  25  1...ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHDVLNR.... 123
16 -57.1001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  23  1....SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT..... 115
17 -56.8001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  30  2...STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ.... 124
18 -55.9001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  20  41.CPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ. 164
19 -54.1004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  20  49.FPSKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRTTL 176
20 -53.0004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  31  22IDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWFQSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAGNELK 151
21 -44.7002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  16  1.....MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIVYNE-EMKNVILQRAQMIASHFQNM.... 120
22 -15.2002w31_A mol:protein length:162 GLOBIN  ali model follow..  13  29............ETNKERLADQFYDYLLGIPETAEFLKEDLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI........... 138
23 -14.7001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  13  59............QENIVNIVDAFYKNLDHESSLMDIINDHVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI........... 168
24 -14.6004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  12  32............VAHAHYLSIEFYRIVRIDPHAEEFLSNEERQLKSAMERWIINVLSAQVDDVERLIQIQHTEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSID..... 145
25 -14.5001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  19  3MNAADRVQSYGRCCASTGFFDDFYRHFASSPQIRAKFATDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYGS. 134
26 -14.3004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  11  27............VAHAHYLSIEFYRIVRIDPHAEEFLSNEERQLKSAMERWIINVLSAQVDDVERLIQIQHTEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS........... 138
27 -13.8003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  15  21................DEAGLLFYRRLDVEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDA----RELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE.... 132
28 -13.6004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  74............TTHQSELPGYFYEQMLQDEQAMLFLTHEKSRLHGTLRQWIVSVFSMSQALIAQQ--KQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET........... 187
29 -13.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  19  22................NEIGLLFYANLKEEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNLEG----QDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE.... 133
30 -13.3005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  15  34............APHFPRLAEEFYDRILGHEGARTALVGGVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV........... 145
31 -13.3004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  13  32............TANKAALADYFYESMLADPNAAFFLSDQKTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV........... 145
32 -12.8002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  10  17............QKNGEDLTNEFYKIMNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLEN-DKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEKK. 136
33 -12.4002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  15  50............EDQVEEILDTWYGFVGSHPHLLYYFTSPLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA........... 177
34 -11.8001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  12  18............KEHGVTITTTFYKNLAKHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPA-KKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVEAD. 139
35 -11.3001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  17  19............KANIPQYSVVFYTSIEKAPAAKDLFSPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK..... 142
36 -10.1001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  10  11...ASTWKDIAGADNGAGVGKECLSKFSAHPEMAAVFGPGVAELGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQS. 147
37 -9.8801gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  13  19............NANIPKHTHRFFILVEIAPAAKDLFSPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMDDA 152
38 -9.7701jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  11...ASTWKDIAGSDNGAGVGKECFTKFSAHHDMAAVFGPGVADLGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS. 147
39 -9.4301hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  10  11...AATWKDIAGADNGAGVGKKCLIKFSAHPQMAAVFGPGVAALGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAQYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS. 147
40 -9.3401oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  14  17............SRSPLEHGTVLFARLALEPDLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKSAFTPATRAAWSQLYGAVVQAMSRGWDGE 151
41 -9.3104mpm_A mol:protein length:151 Neuroglobin  ali model follow..  14  17............SRSPLEHGTVLFARLALEPDLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCAFTPATRAAWSQLYGAVVQAMSRGWDGE 151
42 -9.2101cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  11  6.DQEHYIKGVWKDVDHKQITAKALERVVVYPWTTRLFSKGVQQHADKVQRALGEAIDDLKKVEIN---QNLSGKHQEIGVDTQNFKLLGQTFMVELALHTFRPKEHAAAYKFFRLVAEALSSN.... 139
43 -9.1102vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  14  20............SRSPLEHGTVLFARLALEPSLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----TSLGRKHRAVGVRLSSFSTVGESLLYMLEKSDFTPATRTAWSRLYGAVVQAMSRGWDGE 154

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.