current user: public

If you have questions about the server, please let us know.

Query: 5d3m_D mol:protein length:265 Energy-coupling factor transporter transmembrane protein EcfT, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .
# Score Template Links and tools%idFirst MSKIIIGRYLPGTTFVYRVDPRAKLLTTFYFIIMIFLANNWVSYLVISIFGLAYVFATGLKARVFWDGVKPMIWMIVFTSLLQTFFMAGGKVYWHWWIFTLSSEGLINGLYVFIRFAMIILVSTVMTVTTKPLEIADAMEWMLTPLKLFKVNVGMISLVISIALRFVPTLFDQTVKIMNAQRSRGADFNDGGLVKRAKSVVPMLVPLFIDSLEVALDLSTAMESRGYKGSEGRTRYRILEWSKVDLIPVAYCLLLTILMITTRKHLast
1 -98.2005d3m_D mol:protein length:265 Energy-coupling factor transporter transmembrane protein EcfT  ali model  100  1MSKIIIGRYLPGTTFVYRVDPRAKLLTTFYFIIMIFLANNWVSYLVISIFGLAYVFATGLKARVFWDGVKPMIWMIVFTSLLQTFFMAGGKVYWHWWIFTLSSEGLINGLYVFIRFAMIILVSTVMTVTTKPLEIADAMEWMLTPLKLFKVNVGMISLVISIALRFVPTLFDQTVKIMNAQRSRGADFNDGGLVKRAKSVVPMLVPLFIDSLEVALDLSTAMESRGYKGSEGRTRYRILEWSKVDLIPVAYCLLLTILMITTRKH 265
2 -93.0004huq_T mol:protein length:280 Energy-coupling factor transporter transmembrane protein EcfT  ali model follow..  46  9MSNFIFGRYLPLDSVVHRLDPRAKLMLSFCYIIVVFLANNIWSYAILIAFTVGAILSSKISLGFFLKGIRPLLWLIVFTVVLQLLFSPGGHTYFHWAFINVTQDGLINAGYIFVRFLLIIMMSTLLTLSTQPLDIATGLASLMKPLRWVKVPVDTLAMMLSIALRFVPTLMDEATKIMNAQRARGVDFGEGGLFKQAKSLIPLMVPLFMSAFNRAEDLSTAMEARGYQDSEHRSQYRILTWQRRDTVTWLLFLLGFVAILIFRHW 274
3 -59.4005x41_Q mol:protein length:256 Uncharacterized protein CbiQ  ali model follow..  13  7MSIASIDRVAAQGHWRSRPLAEKSLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARVPLRFWASVAVLPLGFLTTGAAVLLIQIGP-------EGIGLAPDGPAKAAALVMRATAATCCLLFLATTTPAADLLSGLRRWRVP--------AELIEIALLTYRFVFILAEEAAAMTTAQRARLGH---ATRRRWLRSTAQVIAALLPRALTRARRLETGLGARNWQGEMR--VLSTRPPASARVLGLILTLQAAILAAGVLL. 250
4 -8.6605oql_B mol:protein length:907 Utp2  ali model follow..  10  596....AIGTTFPTSDHFHQVTPAMLAIARYLGQKVPAALSDFAVGIYLSILALQYQDFAKRYVPEMMNFLLNTLCALA-PAGIRIKDATNTPIRQLNCGDCLRKDELSPAETSSLQIAILSTATAILKSAADTWHKLPAFIESFQPALSVAQHLLTKPNASHLPSSLTSKLNDLASHLSRLLQLSRLSRRPLELHHHRPLAIKTYIPKFEDDFKHYDPNRERAELAKLKAEHKRERKGALRELRKDAQFIR............... 860
5 -6.7505wx9_A mol:protein length:131 Ethylene-responsive transcription factor ERF096  ali model follow..  1........................................................................................................................................................................MDQGGRGVGAEHGKYRGVRRRPGKYAAEIRDSRKHGERVWLGTFDTAEEAARAYDQAAYSMRGQAAILN............................ 70
6 -6.1802gcc_A mol:protein length:70 ATERF1  ali model follow..  13  1.................................................................................................................................................................................AKGKHYRGVRQRPGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLN............................ 61
7 -5.9502jy9_A mol:protein length:148 Putative tRNA hydrolase domain  ali model follow..  16  8...............................................................................................................................VSIADNELEITAIRAQGA-QHVNKTSSAIHLRFDIRASGLP-ISDDGVIIIKAQEFRSQELNREAAIARLVAV--IKELTAEQKSRRATRPTRASKERRLSSKAQKSSVKALR......................... 132
8 -5.6505mke_A mol:protein length:968 Polycystin-2  ali model follow..  406VASLKKNVWLDRGT-FSVYNANINLFCVVRLLVFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGIEDQNTFPNFEHLAYWQIQFNNIAAVTV-FFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAI----MFFIIFLAYAQLAYLVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFF-NMFLAIINDTYSEVKSDLAQQKAEMELSDLIR................. 705
9 -5.6006du8_A mol:protein length:805 Polycystic kidney disease 2-like 1 protein  ali model follow..  285LRALQEGLWLDRGT-FSVYNANINLFCVLRLVVFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVLLQQPNTYADFEFLAFWQTQYNNMNAVNL-FFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAV----MFFIVFFAYAQLGYLLENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFF-NMFLAIINDTYSEVKEELAGQKDELQLSDLL.................. 584
10 -5.5601a0r_P mol:protein length:245 PHOSDUCIN  ali model follow..  135...................................................................................................................TIVVHIYEDGIKGCDALNSSLICLAAEYPMVKFCKIKASNTGAGDRFSSDVLPTLLELLSNFISVTEQLAEEFFTGDVESFLNEYGLL.............................................................. 227

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.