current user: public

If you have questions about the server, please let us know.

Query: 5gp4_C mol:protein length:468 Glutamate decarboxylase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .
# Score Template Links and tools%idFirst MAMLYGKHTHETDETLKPIFGASAERHDLPKYKLAKHALEPREADRLVRDQLLDEGNSRLNLATFCQTYMEPEAVELMKDTLEKNAIDKSEYPRTAEIENRCVNIIANLWHAPEAESFTGTSTIGSSEACMLAGLAMKFAWRKRAKANGLDLTAHQPNIVISAGYQVCWEKFCVYWDIDMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARLDAVVERYNRTTKFPVYIHVDAASGGFYTPFIEPELKWDFRLNNVISINASGHKYGLVYPGVGWVIWRDQQYLPKELVFKVSYLGGELPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELTADSDREWTLYDLSDRLLMKGWQVPTYPLPKNMTDRVIQRIVVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSDPQPKKYGFTHLast
1 -140.0005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model  100  1MAMLYGKHTHETDETLKPIFGASAERHDLPKYKLAKHALEPREADRLVRDQLLDEGNSRLNLATFCQTYMEPEAVELMKDTLEKNAIDKSEYPRTAEIENRCVNIIANLWHAPEAESFTGTSTIGSSEACMLAGLAMKFAWRKRAKANGLDLTAHQPNIVISAGYQVCWEKFCVYWDIDMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARLDAVVERYNRTTKFPVYIHVDAASGGFYTPFIEPELKWDFRLNNVISINASGHKYGLVYPGVGWVIWRDQQYLPKELVFKVSYLGGELPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELTADSDREWTLYDLSDRLLMKGWQVPTYPLPKNMTDRVIQRIVVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSDPQPKKYGFTH 468
2 -116.0003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  39  1..MVLSHAVSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLAETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEG--KPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPLVAFSLKD--SSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITVLRVVIREDFSRTLAERLVIDIEKVMRELDEL-PSRVIHKISLGQEKSE 463
3 -115.0001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  41  1..MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGVGTNTIGSSEACMLGGMAMKWRWRKRMEAAG---KPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFK.... 464
4 -115.0001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  41  1..MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGVGTNTIGSSEACMLGGMAMKWRWRKRMEAAG---KPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDMHIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFK.... 464
5 -106.0004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  19  31IQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKL-KEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGP--DSCGCVTSGGTESILMACKAYRDLAFEK--------GIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPL-TKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKL------AVKYKIPLHVDACLGGFLIVFMEKAHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGS------RDFDIYRLSNLMTAKGWNLNQLQFPPSIH-----FCITLLHARKRVAIQFLKDIRESVTQIMKNPKA-KTTGMGAIYGMAQ 473
6 -105.0003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  17  10VEKEVTKVKQSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSD-TGCGTTTSGGTESLLLACLSAKMYALHHR-------GITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKI------AQKYKLPLHVDSCLGSFIVSFMENLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENPDLDIMGNPRYSVISFSS------KTLNIHELSDRLSKKGWHFNALQKPVALH-------MAFTRLSAHVVDEICDILRTTVQELKSENSKPSPDGTSALYGVAG 458
7 -104.0005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  18  2.......DLEEGVRQLYPYAAEFGALHEFPERGMPRERLLEEL-RSMAVREDRKWESGRCSGTMYGDHEHYAFLNEAYGLFSHVNALQRDLCPSMNRMESEIVAMTVALLHGEAAHRACGALSLGGTESILNATLAYREKARAER-------GIERPRMIWPASAHPAFRKAAHLFGFDVTVAPIDPVTMQVDADFVRDAVDANTVMLVGSACNYPYGTIDPIGALSAI------AVEKDVWLHVDGCLGGWMLPWGEDIPAFDFRLPGVTSISADTHKFGYGPKGGSVLAWRDASFRRHQYFLMTDWVGGVYGSPGLTGSRSGGLIAATWAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGKP---TFCFAF----TSDAFDIYHVNDFMRQRGWRFNGLQHPDALH-----MCVTGPQTQPGVAERFRQDLGEAVEHARHRAHARPQSGDAAGLDLRD 453
8 -98.4003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  18  56.........ASLRSQIKPYRDRFPSHARLPRAGLPRAEILAEI-AAMGAAESPAWRDGYASGAVYGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDAAGTVCGTVTSGGTESLLLAMKTYRDWARATK-------GITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPL-DADYRADVAAMREAITPNTVVVAGSAPGYPHGVVDPIPEIAAL------AAEHGIGCHVDACLGGFILPWAEPVPPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHYQYFIAADWPGGLYFSPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVA-------SDELNIYQVMEEMAGRGWRLNGLHRPPAFH-----VALTLRHTEPGVVDRFLADLQDAVAQVRAHPE--KATGMAPVYGMAA 491
9 -97.4005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  18  47....TMDWLASLRSQIKPYRDRFPSHARLPRAGLPRAEILAEI-AAMGAAESPAWRDGYASGAVYGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDAAGTVCGTVTSGGTESLLLAMKTYRDWARATK-------GITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPL-DADYRADVAAMREAITPNTVVVAGSAPGFPHGVVDPIPEIAAL------AAEHGIGCHVDACLGGFILPWAEPVPPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHYQYFIAADWPGGIYASPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVA-------SDELNIYQVMEEMAGRGWRLNGLHRPPAFH-----VALTLRHTEPGVVDRFLADLQDAVAQVRAHPE--KATGMAPVYGMAA 487
10 -92.4004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  19  49....MTLREEIPEEGLSPQDILSAFDVDVEKCHFDFLSVTNDS-PEREFLVGRGDGKDSGALYAIHPKELTELLKEVYGATALTNPL-HDKWPRINAMQAEVIRWCQNLFHGSKE--GYGLLTHGGTTSIIEAMAAYVIRARAK--------GIDYPEIVVPETAHAAFKKAAELTGAILITVPVDKKTGAVNPNVMSSYITRNTAVMVGSAPSFMNGIHDPISELGQL------AKKKNVPFHVDACLGGFLTAFLTSSEPMDFRVPGVTSISADLHKYGCCPKGTSVCLFSEDSPALSVYAALNWSGGLYATPGILDGSTSGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALEDIYVYGNPQWSILGFRS------NTCNAHFIADELEKRGWKLNLLQNPDGFH----LCLTHVHTLVGSFETQFIKDLREAVIDVKNYPPGKKPSGNVKVYGAVG 494
11 -89.3001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  11  18ADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDV-EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEAGEGGGVIQGSASEATLVALLAARTKVVRRLQAASPGAVLEKLVAYASDQAHSSVERAGLIGGVKLKAIPS-DGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAF-ICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHDYRHWQLPLGRR-FRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSDGLNE----ALLERINSAR---KIHLVPCRLRGQFVLRFAISRKVESGHVRLAWEHIRGLAAELLAAEEGKAEIKS........ 486
12 -89.0003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  11  18ANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV-EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAATQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPS-DGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAF-ICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHDYRHWQIPLGRR-FRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNE----ALLQRINSAK---KIHLVPCHLRDKFVLRFAISRTVESAHVQRAWEHIKELAADVLRAERE.............. 480
13 -88.9004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  13  23CQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDI-ERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPESSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADNARLVAYASDQAHSSVEKAGLISLVKMKFLPV-DDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAF-LCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHDFMHWQIPLSRR-FRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNSLTE----NVLKEIAKAG---RLFLIPATIQDKLIIRFTVSQFTTRDDILRDWNLIRDAATLILSQ................. 481
14 -88.9003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  21  3..........................RNMQEKGVSEKEILEEL--KKYRSLDLKYEDGNIFGSMCSNV--LPITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLNNKD---AYGHIVSGGTEANLMALRCIKNIWREKRRKGL--SKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPI-KEDYTIDEKFVKDAVEDYD-----VDGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDNYKFDFSL-GVDSITIDPHKMGHCPIPSGGILFKDIGYK-RYLDVDAPYLTET-RQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENN-FKPVIEPILNIVAIEDE--------DYKEVCKKLRDRGIYVSVCNCVK------ALRIVVMPHIKREHIDNFIEILNSIKRD..................... 397
15 -87.4003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  11  18AEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDI-ERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDLGKLVGYCSDQAHSSVERAGLLGGVKLRSVQSEN--HRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAF-ICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDYRHWQIPLGRR-FRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNE----ALLKRINGRG---HIHLVPAKIKDVYFLRMAISRFTQSEDMEYSWKEVSAAADEMEQEQ................ 475
16 -85.8006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  14  34TQYYQTLETRPVQPRVKPGFLTGQLPDKAPFHGESMEVILSDV-NEKIVPGLTHWQSPNFHAYFPASSSNAGLLGELLCSGLSVIGFTWSSSPAATELENVVVDWMAKMLNLPSSGGGGGVLQANTCEAVLCTLAAARDKALNRVGDDQ----INKLVLYCSDQTHFTIHKGAKLIGIRSKNIKSKENEFKLCPNDLRDAIRSDLEAGLVPFYVCGTIGTTALGVVDPIKELGKVAREFDLWLHVDGAYGGSAC-ICPEFQHYLDGVDLVDSISMNAHKWLLSNLDCCFLWLQSPNALIESLAAEANFLKGDYKDWQISLSRR-FRAIKMWMVIRRYGVSNLIEHIRSDVSMAVRFEEMVAADDRFEIVFPRKFALVCFKLSSEKTPPSELTRELMERVNSSG---KAYLSGVQMGRIFFIRCVISSLTEERHVDNLWRLIQETAQSIVS.................. 490
17 -83.6004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  13  37CAEKHEIHDQPVVVEAKEHQEDKIKQIKIPEKGRPVNEVVSEM-MNEVYRYRGDANHPRFFSFVPGPASSVSWLGDIMTSAYNIHAGGSKLAPMVNCIEQEVLKWLAKQVGFTEN--PGGVFVSGGSMANITALTAARDNKLTDINLH-------LGTAYISDQTHSSVAKGLRIIGITDSRIIPTNSHFQMDTTKLEEAIETDKKSGYIPFVVIGTAGTTNTGSIDPLTEISALCKKHDMWFHIDGAYGASVL-LSPKYKSLLTGTGLADSISWDAHKWLFQTYGCAMVLVKDIRNLFHSFHVNPEYLKDNTWDIGMELTRP-ARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKKDWEIVSPAQMAMINFRYAPKDLTKDILNEKISHRILESG---YAAIFTTVLNGKTVLRICAHPEATQEDMQHTIDLLDQYGREIYTE................. 486
18 -83.0006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  10  29ADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDHPETLDQVLDDV-RAKILPGVTHWQSPSFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLDWVAKLLNLPEQ--FMSKGNGGGVIQGSASEAVLVVLIAARDKRSVGKNALEKLVVYSSDQTHSALQKACQIAGIHPENCRVSSTNYALRPESLQEAVSRDLEAGLIPFFLCANVGTTSSTAVDPLAALGKIANSNGIWFHVDAAYAGSAC-ICPEYRQYIDGVETADSFNMNAHKWFLTNFDCSLLWVKDQDSLTLALSTNPEFLKNDYKDWQIPLGRR-FRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEIVTPRIFALVCFRLVPVKDEENNRNRELLDAVNSSG---KLFMSHTALSGKIVLRCAIAPLTEEKHVKEAWKIIQEEASYLLHK................. 490
19 -82.6002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  12  42TSAMKSVFENAPYSGMDPKALEDAINADLDNKNAPLKSVIDDV-AELVAKNAIFTQHPDCIAHLHTPPLMPAVAAEAMIAALNQSMDSWDQASSATYVEQKVVNWLCDKYDLSE--KADGIFTSGGTQSNQMGLMLARDWIADKLQKLGLPDYADKLRIVCSKKSHFTVQKSASWMGLGEKAVVDANADGTMDITKLDEVIAQAKAEGLIPFAIVGTAGTTDHGAIDDLDFIADMAVKHDMWMHVDGAYGGALI--LSSHKSRLKGVERAHSISVDFHKLFYQTISCGALLVNDKSNFK-FLLHHADYLNRNLVDKSIATTKR-FDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDQFELLAEPSLSTVLFRATHETADLDELNKALRLEALTRG---IAVLGETIVDGKTALKFTINPCLTTSDFESLLSKINMLAVEL.................... 496
20 -82.4004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  13  33VDLILAKLTGAAERPPMPETVDLPGPITIPEAAATEATLLQAI--RDMVDGSMNPANPGYIGHMDPMPATMAILGDLVAAAVNNNMLSLEMSPSFSRLETLLLRAIAGLFGLGE--QAGGVLTSGGSLANLQALAVARNVAFDSVEPGIT-GLAQRPVIFASEAAHTSLQKAAMLLGLGTAAVVRATADSRMDPEDLRARIDQARGAGQHPFCVVATAGTTTTGNIDPLAEIGAIAREHGLWFHVDAAYGGALV-FSERHRWRLAGIEQADSITFNPQKWLYVAKTCAMVLFRDAGVLERAFRIPAPYMRANLGEIGVQGTRH-ADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRPFLRLAGEIDTNIVCFRGEPDWLPADDWNAALQALLLREG---KIFLSLPVYRGGRWLRAVLNPYTTDAVIDAMFKQIDRFAGRERGQER............... 486
21 -80.1005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  12  45LALMTETVKEKPFSGILPHELAREFSGDLDQSLGSNEAALEEL-KKLYLRDAVWFHHPKYVAHLNCPVVLPSLLAEQIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLSRIGLPAG--ADGIFTSGGTQSNLMAMLLARDSWCAAHHHRGLPHDAAKWRVFTSKLSHFSIQKSMAILGLGYDAVVDYDERYRMDVDCLKQEVQRCLQQGLIPVAVVATSGTTDFGSIDPLGAISELCKHHGMWMHVDAAYGCGLL-VSESHRPRLAGIEKADSVTVDYHKSFFQTVSCGAFFVRDKHHLS-HVTHHADYLNPNLVNKSIQTTRR-FDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPAIEVLHVPELTTQIFRYVPRPGMNDALNTNIRKAVFRSG---NAVIAGTKVNGRQYLKFTLNPNTTAADIEDVIALIVHYGREQVRGPAVTTAP.......... 518
22 -79.9006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  12  39ADYYKNVETYPVLSEVEPGYLRKRIPETAPYLPEPLDDIMKDI-QKDIIPGMTNWMSPNFYAFFPATVSSAAFLGEMLSTALNSVGFTWVSSPAATELEMIVMDWLAQILKLPKS--FMFSGTGGGVIQNTTSESILCTIIAAREREKLGPDSIGKLVCYGSDQTHTMFPKTCKLAGIYPNNIRLVETDFGISPQVLRKMVEDDVAAGYVPLFLCATLGTTSTTATDPVDSLSEIANEFGIWIHVDAAYAGSAC-ICPEFRHYLDGIERVDSLSLSPHKWLLAYLDCTCLWVKQPHLLLRALTTNPEYLKNDFKNWQIATGRK-FRSLKLWLILRSYGVVNLQSHIRSDVAMAKMFEEWVRSDSRFEIVVPRNFSLVCFRLKPDVSSLHVENKKLLDMLNSTG---RVYMTHTIVGGIYMLRLAVSSLTEEHHVRRVWDLIQKLTDDLLKEA................ 500
23 -79.8006eem_A mol:protein length:512 Tyrosine/dopa decarboxylase  ali model follow..  10  37ADYYKNVEKYPVRSQVEPGYLKKRLPESAPYNPESIETILEDV-TNDIIPGLTHWQSPNYFAYFPSSGSIAGFLGEMLSTGFNVVGFNWMSSPAATELESIVMNWLGQMLTLPKSFSSDGSSGGGGVLQGTTCEAILCTLTAARDKNKIGRENINKLVVYASDQTHCALQKAAQIAGINPKNVRAKATNFGLSPNSLQSAILADIESGLVPLFLCATVGTTSSTAVDPIGPLCAVAKLYGIWVHIDAAYAGSAC-ICPEFRHFIDGVEDADSFSLNAHKWFFTTLDCCCLWVKDSDSLVKALSTSPEYLKNDYKDWQIALSRR-FRSMKLWLVLRSYGVANLRTFLRSHVKMAKHFQGLIGMDNRFEIVVPRTFAMVCFRLKPTAIFKNEVNVKLLESVNASG---KIYMTHAVVGGVYMIRFAVATLTEERHVTGAWKVVQEHTDAILGA................. 512
24 -78.9002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  12  38....SFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHC--QTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGG-SGDGIFSPGGAISNMYAMMIARFKMFPEVKEKGM-AALPRLIAFTSEHSHFSLKKGAAALGIGTDSVIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLL-MSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQDTGDKALQCGRH-VDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVGKPQHTNVCFWYIPPSLRTSKVAPVIKARMMEYGTTMVSYQPLGD-KVNFFRMVISNPAATHQDIDFLIEEIERLGQD..................... 497
25 -77.9002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  14  48AIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERC--RAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWSSGD---GIFCPGGSISNMYAVNLARYQRYPDCKQRGL-RTLPPLALFTSKECHYSIQKGAAFLGLGTDSVVKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVL-LSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSLLKRCHGSQASYLFQDTGDKVVQCGRR-VDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGSKVAPVLKERMVKEGSMMIGYQPHGT-RGNFFRVVVANSALTCADMDFLLNELERLGQDL.................... 509
26 -76.7006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  13  63VVLKATDVNEKVCEWQPPEQLRQLLDLEMRDTGESQDKLLKLC--QDVIHFSVKTNHPRFFNQLYAGLDYYSLAARIITEALNPSIYTYEVSPVFLLVEEAVLKKMIECVGWKEGD---GIFNPGGSVSNMCAMNLARYRHCPDIKEKGL-SGLPRLILFTSAECHYSMKKAASFLGIGTQNVVETDGRGKMIPEDLEKQIWQARQEGAVPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSAL-VSRKHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKDLLKKCYSAKATYLFQDTGDKSIQCSRR-PDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFWYIPPSLRESLVAPAIKEKMMKKGSLMLGYQPHRG-KVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM.................... 524
27 -75.9003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  12  42....TFDRSTKVLDFHHPHQLLEGMEGELSDHPESLEQILVDC--RDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSK-DGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGM-AAVPKLVLFTSEQSHYSIKKAGAALGFGTDNVIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLL-MSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMHASYLFQDTGDKAIQCGRH-VDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVGEPEHTNVCFWYIPQSLRGHKVAPKIKALMMESGTTMVGYQ--PQGDKANFFRMVINPAATQSDIDFLIEEIERLGQDL.................... 505
28 -74.5002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  24IPKNMEKRGELVLNEYLKEIEDVFNHRKIPENGIDDEKIKLFLKFLSMMDVRIGEREARTYSKIHEELSSGFCHGIGRSGNLVDPQPKASGASIMYALTNKILESFFKQLGLNVH--AIATPISTGMSISLCLSAARKKY--------------GSNVVIYPYASHKSPIKAVSFVGMNMRLVELDGDRVYVPVEDIENAIKKEIELGNRPC-VLSTLTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKK---FKYRVDAVVSSSDKNLLTPIGGGLVYSTDAEFIKEISLSYPG-------------RASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKTFLDVESPIASCISV----NSDPVEIAAKLYNLRVTGPRGIKKTDHFGTYTHDYIVMNAAIGVRTEDIVNSVSKLEKIL....................... 449
29 -67.3005hsi_A mol:protein length:634 Putative decarboxylase  ali model follow..  13  36VDEHLGWRKNYIPSDPNMIGPEDQNSPAFKKTVGHMKTVLDQLSERIRTESVPWHSAGRYWGHMNSETLMPALLAYNYAMLWNGNNVAYESSPATSQMEEEVGQEFARLMGYDY---GWGHIVADGSLANLEGLWYARNIKSLPFAMKEVNPELRLGKWLVPQTKHYSWMKAADIIGIGLDQVVPIDSNYRMDIQALESIIRKYAAEKTPILGVVGVAGSTEEGAVDGIDKIVALRQKLYFYLHVDAAYGGYARAIKPEVYAAYKAFDQAESITIDPHKMGYVPYSAGGIVIQDIRMR-DTISYFATYVFELLGAYILEGSKAGATAASVWAAHHTLNVTGYGKLEGASIEGAHRYYDFLKNLKSVHPLISPDFNMVDYVLKEDGNDDLIEMNRLNHAFYEQASYVKSEVEWRHAGKVTIIRASVMTPNQRENFDYFAPRIKKAIQADLEK................. 615
30 -37.0001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  24......................PKAEDLIPKEEVDELTLVRHY--TGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLHPYQDRTAQGALRLMWELGEYLKALTGMD---AITLEPAAGAHGELTGILIIRAYHEDRGE-------GRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEG-EVDLEALKRELGPHVAALMLTNPNTLGLFERRILEISRL------CKEAGVQLYYDGANLNAIMGWARPVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVERGEEGFYDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVA-----QPPEGFRALDLAKGLLELGFHPPTVYFPLIVKE--ALMVEPTETEAKETLEAFAEAMGALLKKPKEWLENAPYSTPVR...... 455
31 -31.0003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  1......RQGCEARRAHEHLIRLLLEQGKCPEDGWDEHELAVMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASC--FVVPMATGMSLTLCFLTLRHKRPKAK-----------YIIWPRIDQKSCFKSMVTAGFEPVVIENEGDELRTDLKAVEAKIQEHILCLHSTTACFAPRVPDRLEEL------AVICANYDIPHVVNNAYGL--SSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNEPFIQD-------------ISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQ-TFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVRKEQTRA............. 450
32 -27.1003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  13  13VSPAYVRQGCEARRSHEHLIRLLLEKGKCPENGWDESTL------ELFLHELAIMDSNNFLGNCGVGEREGRVASALVARDISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANC--FVVPMATGMSLTLCFLTLRHKRPKAK-----------YIIWPRIDQKSCFKSMITAGFEPVVIELEGDELRTDLKAVEAKVQECILCIHSTTSCFAPRVPDRLEEL------AVICANYDIPHIVNNAYGV--SSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQE-------------ISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYLHTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRGYTFRGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYD....... 474
33 -26.5001v72_A mol:protein length:356 Aldolase  ali model follow..  13  12................................................................FSSDNIAGASPEVAQALVKHSSGQAGPYELTAQVKRKFCEIF--------ERDVEVFLVPTGTAANALCLSAMTPPWGN---------------IYCHPASHINNDEAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSFANALVSLGCSPAEMTWK-AGVDALSFGATKNGVLAAEA--IVLFNTSLATE-MSYRRKRAGHLSSKMRFLSAQ----------IDAYLTDDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSA----------MIDALLKAGFGFYHDRWGPNV-----VRFVTSFATTAEDVDHLLNQVRLAADRTQER................. 356
34 -26.5001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  10  18................................................................FVNDYSVGMHPKILDLMARDNMTQHAGYSHCAKAARLIGELLER-------PDADVHFISGGTQTNLIACSLALRPWEA---------------VIATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLADIARLTDMFYIGATKAGGMFGEA--LIILNDALKPNARHLI-KQRGALMAKGWLLGIQ----------FEVLMKDNLFFELGAHSNKMAAILKAGLEACG-IRLAWPSASNQLFPIL------ENTMIAELNNDFDMYTVEPLK-------DGTCIMRLCTSWATEEKECHRFVEVLKRLVAS..................... 357
35 -26.3005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  11  8................................................................FASDNYSGICPEAWAAMEKANHGHDRAYQWTERASEYFRNLF--------ETDCEVFFAFNGTAANSLALASLCQSYHS---------------VICSETAHVETDEAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVDELKAISATCKELGLNLHMDGAFTNACAFLGCSPAELTWK-AGVDVLCFGGTKNGMAVGEA--ILFFNRQLAEDFDYRC--------KQAGQLASKMRFLSAPWVGLLED-----WLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMPE----------HAIEALRAKGWRFYTFIGSGGA------RFMCSWDTEEERVRELAADIRSIIT...................... 345
36 -24.5005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  12  57.................................................................RGGILPKEAKKAVYEYWDGYSVCDYCHGRLDEVTCPPIK-IAKFLNMDC------RPTHGAREGKFIVMHAICKE-----------------YVVLDKNAHYTSYVAAERAKLNVAEVGYEEPTYKINLEGYKEVIDNLEDKGKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPV-------NGKEVKADFIVASGHKSMAASAPCGILAFSEEFSDK---ITKTSEKFPVKEIEMLGCTSRGLPIVTLMASFPHV---ERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPV-------LDEIAKKDKRRGFFFYDELKKRGIGGIVTKEIKMS-GLEWEQVEYVVNAIKEIVESCK................... 411
37 -24.3003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  13  9................................................................LRSDTVTQPTDAMRQCMLHAEVGDYGEDPGVNALEAYGADLLGK---------EAALFVPSGTMSNLLAVMSHCQRGEG---------------AVLGSAAHIYRYEAAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGALFNAVVASGHTVREL---VAPFDSVSICLSKGLGAPVGS--LLVGSHAFIARARRLRKMVGGG--------MRQAGILAQAGLFAL-----QQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTSGESA-----PLLAFMKARGILFSGYGE---------LRLVTHLQIHDDDIEEVIDAFTEYLGA..................... 341
38 -24.2003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  14  33.................................................................ATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIIN-LAKMIGGKPQD----IFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHAKPHFITSSVEHDSIRLPLEHLVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNQERVAPILVHTDAAQALGKQRV-------DVEDLGVDFLTIVGHKF-YGPR-IGALYIRGLG---EFTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAE-LVTQNCEAYEAHMRDVRDYLEERLAEFGQKRIHLNSQFNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSLRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQA................ 440
39 -24.2003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  10  47............................................................................................AIIEPFEQKF----ADVLGMD-----DAVFFPSGTMAQQVALRIWSDETDNR-------------TVAYHPLCHLEIHEQDGLKELPIETILVGAADRLMTLDEIKALPDIACLLLELPQREIG-----VAPAFSELETISRYCRERGIRLHLDGALFEMLPYYEKTAAEI---AGLFDSIYISFYKGLGGIAGA--ILAGPAAFCQTARIWKRRYGGDLIS-------------LYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISP--KLEQVQEETGLGFVGYLVDKDG------YCSTEISVGDAYGELDQQTRDAGFARLRQA................. 355
40 -23.9003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  14  24.................................................................ATTPVDPRVAEKMMQFMNPASRSHRFGWQAEEAVDIARNQIADLVGADPRE----VFTSGATESDNLAIKGAANFYQKKGK-----------HIITSKTEHKAVLDTCRQLGFEVTYLAPQRNG-IIDLKELEAAMRDDTILVSIMHVN------NEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPI-------DLSQLKVDLMSFSGHKI-YGPKGIGALYVRRKPRVR------EAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGA-ILNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPS-LAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSP............... 398
41 -23.8004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  12  8.................................................................SAKPVDERILEAMLPYMTESFGNPSSVHSYGFKAREAVQKVAKLVNGGGGT----VFTSGATEANNLAIIGYAMRNARKGK-----------HILVSAVEHMSVINPAKFLGFEVEYIPVGKYG-EVDVSFIDQKLRDDTILVSVQHAN------NEIGTIQPVEEISEVLAGKAA-LHIDATASVGQIEV-------DVEKIGADMLTISSNDI-YGPKGVGALWIRKEAKLQ-------PVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESYLNGHPE-NNVNVRFSYIEGESIVLSLDMAGIQASTGSACSSKTLQPS-EAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSP............... 378
42 -23.5005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  12  11.................................................................ATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAKLYKGINARDIDDV--IITSCATESNNWVLKGVYFDECLKKGKN---------HIVTTVAEHPAVRSTCNFLGVEVTYLPINEHG-SITAEQVREAITEKTALVSVMWAN------NETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPV-------DVLKANADFLSFSAHKF-HGPKGIGGLYIRSGVGLT-------PLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDPNTTLVSVRGIEGE--------AMLWDLNRSNIAASTGSACASEDAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVRLRNISS............... 385
43 -23.5004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  15  9............................................................NATTFIDPRVKEFIISLMDKELNPSSAHSSGRFAKNLIETV--AQIATALGITLSSREY-TFTSSGTEGNNLIMK-----------------NFYDGDIFISAIEHLSIYNHINY-APNIKVISVNTQG-LVDLEHLEELLAQSNTSKKLVSIIMAN---NESGVLQDIAEIGKITKKYEAKFHSDLVQGFGRIPI-------NIKALGLDFATISGHKI-GGGQGGAALISSSNFQIT-------PMIIGGGQEKSVRSGTENVLAIAGFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSNNV-NTTLITIPNTDAQAKLIGFDLHNICVSSGSACSSGKISKS-EAKSSIRISLSHTNTVRDIEAFIEAFEEIYDVIPS.................. 374
44 -23.4002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  12  10................................................................LRSDTVTKPTEEMRKAMAQAEVGDYGEDPTINELERLAAETFGK---------EAALFVPSGTMGNQVSIMAHTQRGDE---------------VILEADSHIFWYEVGAMAVLGVMPHPVPGKNGAMDPDDVRKAIRPRN-TSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGAIFNASIASGVPVKEY---AGYADSVMFCLSKGLCAPVGS--VVVGDRDFIERARKARKMLGGG--------MRQAGVLAAAGIIAL-----TKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRT----DNLKVNAHGFIEALRNSGVLANAV-------SDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS................... 349
45 -23.3005i90_A mol:protein length:427 PvdN  ali model follow..  10  54...............................................................LHFANFLLTSHPRPVREAIERLRVRFDRNPGIWKYEDEARAWAGRYFAVQPGQ----ALTGSTTDGLAAIYGGLLVQPGKE--------------ILTSSHEHYSLEYRHKRMGTQVREFPLFKDPHRVSLSSIAAQIRPQTRVLGMTWVQSGSGVKLPIREIGKLVREQKRDEQDRIIYVVDGVHGFGVEDV-------SFADFDCDYFIAGTHKWLFGPRGTGVIIARSEQLQEHLVPSIPTFSRADNFGTLMGGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHPKVRLVTPTSSGFTFFRV------EGRDCEAVAKHLMAHRVISDAVDRDVG-----VVRLAPSLLNDEAEIDRVLEILAPQLA...................... 427
46 -23.1001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  13  29..................................................................PTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNT----TITDNVTTGCDIVLWGLDWHQGDE--------------ILLTDCEHPGVQAIAARFGITYRFFPVAATNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQ--GNYPVRVLVDGAQSAGSLPL-------DFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGE----INPTYVGWRSITYGAKATSAYPQYAGLLAALQLHQRQGTAEERQAICQRSEFLWRGLNQLPHVHCLAAPQAGLVSF-----TVDSPLGHRAIVQKLEEQRIYL------RTIADPDCIRACCHYITDEEEINHLLARLADFG....................... 389
47 -23.0003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  13  26.................................................................ATTPLEPEVIQAVTEAMKEAWGNPSSSYVAGRKAKDIIN-LAKMIGGKPQD----IFTSGGTESNNLVIHSTVRCFHEQQTLQGRTVDQTRPHFITCTVEHDSIRLPLEHLVAEVTFVPVSKVNGQVEVEDILAAVRPTTCLVTIMLANNETGVIMPISEISRRIKALNQIRAARVLVHTDAAQALGKRRV-------DVEDLGVDFLTIVGHKF-YGPR-IGALYVRGVG---KLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAD-LVSENCETYEAHMRDIRDYLEERLEAEFGKRIHLNSRFNTCNFSIQGSQLRGYMVLAQCQTLLASVGASCHSDHEDRPSPVLLSVRLSVGRSTTRAEVDLIVQDLKQAVNQLEG.................. 430
48 -22.8003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  15  22.................................................................ATTRVDQRVADIVLHWMTAEFGNAGSRHEYGIRAKRGVE-LASTVSAEPDE----IFTSGATESNNIALLGLAPYGERTGRRH----------IITSAIEHKAVLEPLEHLGFEVDFLTPGPSG-RISVEGVMERLRPDTLLVSLMHVN------NETGVIQPVAELAQQLRATPTYLHVDAAQGYGKVPGDLTT--------PIDMISISGHKI-GAPKGVGALVTRRREEMDDERVPLEPIMFGGGQERKLRPGTLPVPLIMGLAEAAKIFEAEHAQWQVAAQDLRSRLLAGLASTSFQVNGDQDHVVPHILNLSFEDVDAEAFLVTLKDLVAATGSASTSASFTPS-AASKSLRFSWTPGQA---TDLDVEELARGVAKLKP.................. 392
49 -22.3005usr_A mol:protein length:426 Cysteine desulfurase, mitochondrial  ali model follow..  14  28.................................................................ATTPLDPRVLDAMLPYLINYYGNPHSR-ESEAAMERARQQVASLIGADPRE----IFTSGATESNNIAIKGVARFYRSRKK-----------HLITTQTEHKCVLDSCRSLGFQVTYLPVQKSG-IIDLKELEAAIQPDTSLVSVMTVN------NEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKIPL-------DVNDMKIDLMSISGHKI-YGPKGVGAIYIRRRPRVR------EALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIKSLPDVVMNGDPKHHY-CINLSFAYVEGESLLMALKDVALSSGSACTSASLEPS-LAHSSIRFGIGRFTTEEEVDYTVEKCIQHVKRLREMSP............... 401
50 -22.2002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  12  18.................................................................GGKLTEEARQALLEWGDGYSVCDFCTTGRLDEIKDFIHNQLPKFLGCDV------RVTNGAREAKFAVMHSLAK---------------KDAWVVMDENCHYSSYVAAERAGLNIALVPKTYPDYAITPENFAQTIEETKKRGEVVLALITY-PDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE--------GADFIVGSGHKSMAASGPIGVMGMKEEWA---EIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHV--RERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAE-SKKAKGGRFFLYRELKSRKIHGIKPGLTRYFK-------LSTYGLSDEEVDYVLNAFKEIIEKY.................... 370
51 -22.0004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  13  12............................................................AATTPMHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIEEA--ELIADKLGARPSE----IFTAGGTESDNLAVKGIYWARRDA--------EPHRRRIVTTEVEHHAVLDSVNWLGAHVTWLPTAADG-SVSATALREALQSHDDVALVSVMWA-----NEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLPL-------DFGASGLSAMSVAGHKF-GGPPGVGALLLRRDVTCV-------PLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVAEIDDVCLNGADD-GNAHFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPS-SARGSLRLSLGHTSVEADVDAALEVLPGAVARARRAALAAAGASR........ 398
52 -21.7003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  10  20.................................................................NGPRNVGVLTEALQNIDDNLESDYGNGAVIEDFETKI----AKILGKQS-----AVFFPSGTMAQQIALRIWADRKENR-------------RVAYHPLSHLEIHEQDGLKELQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPA---FEELEKISEYCHEQGISLHLDGALWEITPFYQKSAEEI---CALFDSVYVSFYKGIGGIAGA--ILAGNDDFVQEAKIWKRRYGGDLIS-------------LYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSADEIGAI--LTKIQDETGVGISGYLQEK-------SADVCAFEVSVGDAFAEIKNLELVFRCLEKE................. 358
53 -21.6001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  13  9.................................................................ATTRVDDRVLEEMIVFYREKYGNPNSAHGMGIEANLHME-VAKVLGVSPSE----FFTSCATESINWILKTVAETFEKRKR-----------TIITTPIEHKAVLETMKYLGFKVKYVPVDSRG-VVKLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDVTRIVK----KKNKETLVHVDAVQTIGKIPF-------SLEKLEVDYASFSAHKF-HGPKGVGITYIRKGVPIR-------PLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTLQNLLSGYYVSTSSACTSKDERLR-IAQGAIRISLCKYNTEEEVDYFLKKIEEILSFLDLTGNNRR............ 384
54 -20.7003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  10  4................................................................LRSDTVTRPSRAMLEAMMAAPVGDYGDDPTVNALQDYAAELS---------GKEAAIFLPTGTQANLVALLSHCERGEE---------------YIVGQAAHNYLFEGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHF-TKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGAIFNAVVAYGCELKEI---TQYCDSFTICLSKGLGTPVGS--LLVGNRDYIKRAIRWRKMTGGG--------MRQSGILAAAGIYAL-----KNNVARLQEDHDNAAWMAEQLREAGA--DVMRQDTNMLFVRV------GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR..................... 333
55 -20.5004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  11  4................................................................LRSDTVTRPSRAMLEAMMAAPVGDYGDDPTVNALQDYAAELS---------GKEAAIFLPTGTQANLVALLSHCERGEE---------------YIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGAIFNAVVAYGCELKEI---TQYCDSFTICLSKGLGTPVGS--LLVGNRDYIKRAIRWRKMTGGG--------MRQSGILAAAGMYAL-----KNNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV--------GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR..................... 333
56 -20.3002hzp_A mol:protein length:501 Kynureninase  ali model follow..  12  99...............................................................IYFLGNSLGLQPKMVKTYLEEELDKWAKKRPWITGDESIVGLMKDIVGANEKE----ALMNALTVNLHLLMLSFFKPTPKRYK------------ILLEAKAFPSIESQLQLHGLNIEESMREETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAI------TKAGQAKGCYVGFDLAHAVGNVEL-------YLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPALVGWFGHELST---ISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHNPVVNIITPSHGCQLTITF-------SVPNKDVFQELEKRGVVC-------DKRNPNGIRVAPVPYNSFHDVYKFTNLLTSILDSAETKN................ 495
57 -19.9005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  52............................................................HGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLD-ESRAAVANLLKVPVET----VFVANATMGVNTVLRNIVWSADGK-------------EILYFDTIYGACGKTIDYVIVSSRCIPLIPAEDDDVVAAFRDAIKKSREEGKRPRLAVIDVVSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDL-------KITETDPDFLISNCHKWLFTPRGCAVFYVPVRHLIRSTLPTSHGFVPAFVSNFEFVGTVDNSPFFCVKDAIKWREEGGEERIMEYMTKLAREGGQKVAEILGTRVLENSTRCAMVNIALPPHEEANMAFKWMYNVLQDE----NTFVPMTFHRRRFWARLSAQVYLEMSDFEWAGKTLKELCERVAKGEYKESALEVD....... 484
58 -19.6001wyt_A mol:protein length:438 glycine dehydrogenase (decarboxylating) subunit 1  ali model follow..  11IREMLRRVGAASLEDLFAHLPKEILSPPIDPEPLPEWKVLEELRRLAAQNLPAHKAFLGGGVRSHHVPPVVQALAARGEFLTAYTPYQPEVSQGVLQATFEYQTMIAELAGLE----IANASMYDGATALAEGVLLALRETGRM-------------GVLVSQGVHAVLRAYLEAVGAKLLTLPLEGG------RTPLPEVGEEVGAVVVQNPNF-------LGALEDLGPFAEAAHGAGALFVAVADPLSLGVLKPPGA--------GADIAVGDGQSLGFGGPHFGFLATKKARGFILTLQAREQYIRRAKAKSNI-TTNAQLTALMGAMYLAALGPEGLREVALKSVEMAHKLHALLLEVPGVRPFTPKPFFNEFAL------ALPKDPEAVRRALAERGFHGATPVPREYGEN--LALFAATELHEEEDLLALREALKEVLA...................... 438
59 -19.1001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  11  41..................................................................PVAALARAQAVIAEEWGNGLIRSWNSAGWRDLSERLGNRLATLIGARDGE----VVTDTTSINLFKVLSAALRVQATRSPERR--------VIVTETSNFPTAEGLADMLQQGYTLRLV------DSPEELPQAIDQDTAVVMLTHVNYKTGYMHDMQAL------TALSHECGALAIWDLAHSAGAVPV-------DLHQAGADYAIGCTYKYLNGPGSQAFVWVSPQLCHSRQFAMEPRYEPSNGIARYLCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRHELTLVTPREGSHVSFEHPEG--------YAVIQALIDRGVIG-------DYREPRIMRFGFTP-TTFTEVWDAVQILGEILDRKTWAQAQFQVRHSVT...... 416
60 -18.7003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  11  1......................................MAGAYDVARVRGLHPSLGDGWVHFDAPAGMLIPDSVATTVSTAFRRSGASHPSARRSAAVLDAAREAVADLVNADPGG----VLGADRAVLLSLLAEASSSRAGLG-------------EVIVSRLDDEAWLRAAHRYGAKVKWAEVDIETGELPTWQWESLISKSTRLVAVNSASGTLGGVTDLRAM------TKLVHDVGALVVVDHSAAA-------PYRLLDIRETDADVVTVNAHAW-GGPPIGA-MVFRDPSVMNSFGSVSTNPYATGPARLEI-GVHQFGLLAGVVASIEYLAAVSMQSADAYLNRVFDYLMVSLRSLPLVMLIGRPEAQIPVVSFAVHKVPAD----RVVQRLADNGILAIVLDVLGVNDVGGAVTVGLAHYSTMAEVDQLVRALASL........................ 399
61 -18.5005b7s_A mol:protein length:419 Cysteine desulfurase  ali model follow..  11  2.................................SSENLYFQGHMASMRIPEDVRKDIPLTNEVIYFDNTATSLTPKPVVEAMNVHRGVHRLSQMATHKYEESRKIVADFIGAKFEE----VFTKNTSESLNLVALGLGHIFKRG-------------KIVTTPYEHHSWQRLATKLGLKLEFIEGDDEG-NLDLSDAEKKIKGAKLVAVQHVSNA-------LGVIHEVEELGKIAKDEGAIFVVDAAQS--------GHMEVNVKKLHADFLAFSGHKGPMGPTGIGVLYIR-----EEFFDTFEPPLIGGGTIEDVSGTPNIGGAIGLAAGIRYIERIGLGRIERQEHKLVKRTTEGLDELEVPWYGPRNLKKHAGVVSFN----PGLHPHDVAAILDDHSIMV-ALPVMKKLGINGTVRASFHVYNSLEEVETFLGVMEELVKGLKT.................. 413
62 -18.3001c0n_A mol:protein length:406 PROTEIN (CSDB PROTEIN)  ali model follow..  14  21.......................................................GLPLAYLDSAASAQKPSQVIDAEAEFYAVHAGAHTLSAQATEKMENVRKRASLFINARSAEEL--VFVRGTTEGNLVANSWGNSNVRAG-------------NIIISQMEHHAWQMLCARVGAELRVIPLNPDG-TLQLETLPTLFDAATRLLAITHVSNVLGTENPLAEM------ITLAHQHGAKVLVDGAQA--------MHHPVDVQALDCDFYVFSGHKL-YGPTGIGILYVKEALLMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQARLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLL.................... 405
63 -18.3004lw2_A mol:protein length:404 Cysteine sulfinate desulfinase  ali model follow..  15  30.................................................................ATALKPEAVVEATQQFYNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDKTI--VWTRGTTESNMVAQCYARPRLQPG-------------EIIVSVAEHHAWLMVAQQTGAKVVKLPLNAQR-LPDVDLLPELITPRSRILALGQMSNVTGGCPDLARA------ITFAHSAGMVVMVDGAQG--------VHFPADVQQLDIDFYAFSGHKL-YGPTGIGVLYGK-----SELLEAMSPWLGGGKMVHEVSGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDF------AGVHHSDMVTLLAEYGIAL-AQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLVD.................. 404
64 -18.2001jf9_A mol:protein length:408 SELENOCYSTEINE LYASE  ali model follow..  13  23.......................................................GLPLAYLDSAASAQKPSQVIDAEAEFYAVHRGIHTLSAQATEKMENVRKRASLFINARSAEEL--VFVRGTTEGNLVANSWGNSNVRAG-------------NIIISQMEHHAWQMLCARVGAELRVIPLNPDG-TLQLETLPTLFDEKTRLLAITHVSNVLGTENPLAEM------ITLAHQHGAKVLVDGAQA--------MHHPVDVQALDCDFYVFSGHKL-YGPTGIGILYVKEALLMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLL.................... 407
65 -18.1001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  14  33............................................................................................DYNIGVVEQIRQQLTALATASEGYTSVLLQGSGAVEAVLGSALGPQD----------------KVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVA-RPDVQAIDAILNADPTISHIAMVHSETT----TGMLNPIDEVGALAHRYGKTYIVDASFGGIPMDIAA----------HIDYLISSANKCIQGVPGFAFVIAREQKLAACKLDLYAQWRCMEDNHGKWRFTSPTHTVLAFAQALKEL-EGGVAARHQRYQQNQRSLVAGMRAL-GFNTLLDDELHSPIITAFYSPEDPQYRFSEFYRRLKEQGFVI----YPGKVSQSDCFRIGNIGEVYAADITALLTAIRTAMYWTK................... 366
66 -18.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  14  67..............................................................................................IDRVESLAIERAKALFGA----AWANVQPHSGSQANMAVYMAL------------MEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVGVRPDTELIDLEEVRRLALEHRPKVIVA-------GASAYPRFWDFKAFREIADEVGAYLVVDMAFAGLVAAGLHPNP-----LPYAHVVTSTTHKTLRGPRG-GLILSNDPELGKR----------DKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARR-GYRIVTGGTDNHLFLVDLRPKGLTG---KEAEERLDAVGITVNKNAIPFDPKPPRVIRIITTRGFTPEEMPLVAELIDRALLEGPSEALREEVRRLALAHPM.. 406
67 -17.9005vpr_A mol:protein length:414 Cysteine desulfurase  ali model follow..  13  22.......................................................GKDLVYLDNAATSQKPKMVLDAINNYYNVHRGIHTLSQVATEMMEDARKKVQRFINAKHDYEV--LFTKGTTEGINLVAYAMTDLIKKD-------------EIIISYLEHHSWQMLCQRTGAKLRVIPMNEDG-TLQIDVLDEWLSEKTKLVSVNQVSNALGIVNPIDEIIRKVRAKS-----NAFIFIDGAQA--------PHFEIDVQTMDCDFFAFSGHKM-YGPTGTGILYGKASEMIDHCTFEKTTYAGLPFR----AGTPNIAGNIAIGTAVDFMEKVGRSNIAAHEHALLEYAQRKLLEIEGLKVYGEKANRAGVVSFNLSGIGIASDVGMILDKIAVRTGHHCTQPIMEYFGVAGTVRASFAVYNTFEEIDILTEGVKKAQKML.................... 407
68 -17.8005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  12  1....................MAMFANISISEFDPELAQAIASEDER----------QEAHIELIASENYCSPAVMEAQGSKLTNKYAEYGGCEFVDVIEQMAIDRAKELFGA----DYANVQPHAGSQANSAVYLAL------------LNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQLNAETGEIDYEEVERLALEHKPRMIVA-------GFSAYSRVVDWQRFRDIADKVGAYLFVDMAVAGLVAAGVYPNP-----VQIADVTTTTTHKTLRGPRS-GLILAKANEEIEKKLQSAV---------PGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIAR-GYDVVSGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGDEKVIADVK...... 404
69 -17.8005xt5_A mol:protein length:419 Cysteine desulfurase SufS  ali model follow..  12  22.......................................................GHDLVYLDSAATSQKPRAVIETLDKYYNVHRGVHTLGTRATDGYEGAREKVRKFINAKSMAEI--IFTKGTTTSNMVALSYARANLKPG-------------EVVITYMEHHAWQQAVKATGATLKYIPLQEDG-TISLEDVRETVTSNTKIVAVSHVSNVLGTVNPIKEM------AKIAHDNGAVIVVDGAQS--------PHMKIDVQDLDCDFFALSSHKM-CGPTGVGVLYGKKAEMIDFVGLYESTWKELPWK----AGTPIIAGAIGLGAAIDFLEEIGLDEISRHEHKLAAYALERFRQLDGVTVYGPEERAGLVTFNLDDVHPHDVATVLDAEGIAVRAGHHCAQPLMKWLDVTATARASFYLYNTEEEIDKLVEALQKTKEYFTN.................. 407
70 -17.7003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  11  6.....................NPFFSQSLAERDASVRGAILKELER----------QQSQVELIASENIVSRAVLDAQGSVLTNKYAEYGGCEFADEVEALAIERVKRLFNA----GHANVQPHSGAQANGAVMLAL------------AKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQVSRDTMLIDYDQVEALAQQHKPSLIIA-------GFSAYPRKLDFARFRAIADSVGAKLMVDMAIAGVIAAGRHANP-----VEHAHVVTSTTHKTLRGPRG-GFVLTNDEEIAKK----------NSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAG-GVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTNPEGDHATEQRVRR 413
71 -17.5006c9e_A mol:protein length:422 Cysteine desulfurase  ali model follow..  11  31.......................................................EYDLVYFDNAATTQKPKAVIDAIAQFYNVHRGVHALSVRATEMYEAARAKVKRFINARSPREC--IFVRGTTEANLVAQSLVAPRILPD-------------EILITHMEHHSWQMVCKKMGCKLQVAPISLNG-EVILEEFERKLNENTKMVAINYASNSLGTINPVKTM------IKMAHEVGAKVLLDGAQA--------AHLIVDVQDLDCDFYAFSGHKM-YGPTGIGVLWGKEEEMINSVSFEATEYAAIPHK----AGTPNIAGAIGLAAAIDYIWSLDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAANKVPIISFVHGKIHA----HDIGTILDSEGIAI-TMPLMDFYDVAATSRISMSFYNTFKEIDYCMEALQRVKEVF.................... 415
72 -17.4004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  11  1...............MRGSGSMIFDKEDYKAFDPELWNAIDAEAER----------QQNNIELIASENVVSKAVMAAQGTLLTNKYAEYGGTAVIDVVETLAIERAKKLFGA----KFANVQPHSGSQANAAVYMSL------------IQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVNVDKESELLDYDAILAQAKEVRPKLIVA-------GASAYSRIIDFAKFREIADAVGAYLMVDMAIAGLVASGHHPSP-----VPYAHVTTTTTHKTLRGPRG-GLILTDDEDIAKK----------NSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVDV---TKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIR...... 409
73 -17.4001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  50..................................................................TDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLKDKA----KELFNYDY------IPAHQGRGAENILFPVLL--------KYKQKEGKAKNPVFISNFHFDTTAAHVELNGCKAINIVTEDWKGDFDIKKLKENIAQHGADNIVAIVSTVTCNSAG--SMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARDPKYKNYKYADALTMSAKKDPLLNIG-GLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTE-------EEYLHYRIGQVKYLGDRLREAG-IPIQYPTGGHAVFVKLVPQIPGDQFPAQAVINALYLESGV-DPATGEQKHADMEFMRLTIARRVTNDHMDYIADALIGLKEKFATLKGLEFEYEPPVLRHFT. 460
74 -17.4004w91_A mol:protein length:422 Aminotransferase  ali model follow..  12  31.......................................................GKTLVYLDNGASAQKPQSVIDAVTHAYNVHRGLHFLSNAATDAYEKSRETVRRFLNAGSVDEI--VFTKNATEAINTVAYGYGMPFIGEGD-----------EILLSIMEHHSWHFIRERQGAKLVFTPVDDNG-VFHIEEFEKRLSERTKLVAITHMSNTLGTVVPIKKI------VELAHARGIPVLVDGSQG--------VHLPVDVQDLGCDWYVFTGHKV-YGPSGIGVLYGRAQEMIEEVTEENVTYNHPPHR----AGTPPIVQAIGLGAALEYMEKIGRHAILAHEADLRDYAHERLGRINSLRIFGNAPDKGAIISFALEGIHA----HDVSMVIDRAGVAV-AQPLLKRFGVTSTCRASFALYNTRAEVDALAEALEKARKFF.................... 415
75 -17.3001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  13  39..........................................................................PVSVKRALIDNLDCIERYPDADYFH--LHQALARHHQVPASWILAG---NGETESIFTVASGLKPR-----------------RAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADR---CKSLNINLILDEAF----IDFIPHETGFIPALKDNPHIWVSLTKYAIPGLRLGYLVNSDDAAMARMRRQQMPW---------------SVNALAALAGEVALQDSAWQQATWHWLREEGRFYQALCQLPLLTVYPGRANYLLL--------RCEREDIDLQRRLLTQRILIRSCANYPGLDSRY-YRVAIR---SAAQNERLLAALRNVLTGIAPAD................ 364

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.