current user: public

If you have questions about the server, please let us know.

Query: 5irx_E mol:protein length:75 Tau-theraphotoxin-Hs1a, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRLast
1 -66.6005irx_E mol:protein length:75 Tau-theraphotoxin-Hs1a  ali model  100  1DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYR 75
2 -7.6505o57_A mol:protein length:95 Dickkopf-related protein 4  ali model follow..  22  16HGARKGSQCLSDTDCNT------------FCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLC............ 68
3 -6.9903qhy_B mol:protein length:282 Beta-lactamase inhibitory protein II  ali model follow..  22  77.ALKDGEVIAWGGN--EDGQTTVPAEARSGVDAIAAGAWASY-ALKDGKVIAWGDDSDGQTTVPAE......... 138
4 -6.9401st8_A mol:protein length:543 fructan 1-exohydrolase IIa  ali model follow..  21  23.......................PNGPMLYQGVYHFFYQYNPYAATFGDVIIWGHAVSYDLHLDPAIYP...... 72
5 -6.8802job_A mol:protein length:102 antilipopolysaccharide factor  ali model follow..  15  22..........WRNEKTELLGHECKFTVKPYLKRFQVYYKGRMWCPGWTAIRGEASTRSQSGVAGKTAKDFVRK.. 84
6 -6.6204l8r_C mol:protein length:120 Histone RNA hairpin-binding protein  ali model follow..  17  27..MRRQKQINYGKNTIAYDRY---IKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQ................... 77
7 -6.3406fgn_A mol:protein length:124 Histone acetyltransferase p300,Tumor protein 63  ali model follow..  27  33...........................LPSCQKMKRVVQHTKGCKRK-ALAAYHAKHCQENKCP---VPFCLNIK 88
8 -6.1903io2_A mol:protein length:114 Histone acetyltransferase p300  ali model follow..  27  33...........................LPSCQKMKRVVQHTKGCKRK-ALAAYHAKHCQENKCP---VPFCLNIK 88
9 -6.1705tbk_I mol:protein length:421 Regulator of chromosome condensation  ali model follow..  18  256..SHEGHVYGFGLS--GTESCFIPQNLTSFKNSTKSWVGFSGGMDSEGKAYSLGRAEYGRL.............. 326
10 -6.1203p57_P mol:protein length:112 Histone acetyltransferase p300  ali model follow..  29  32...........................LPSCQKMKRVVQHTKGCKRK-ALCCYHAKHCQENKCP---VPFCLNIK 87

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.