current user: public

If you have questions about the server, please let us know.

Query: 5k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# Score Template Links and tools%idFirst MDLEEGVRQLYPYAAEFGALHEFPERGMPRERLLEELRSMAVREDRKWESGRCSGTMYCGDHEHYAFLNEAYGLFSHVNALQRDLCPSMNRMESEIVAMTVALLHGEAVQRHDGAHRACGALSLGGTESILNATLAYREKARAERGIERPRMIWPASAHPAFRKAAHLFGFDVTVAPIDPVTMQVDADFVRDAVDANTVMLVGSACNYPYGTIDPIGALSAIAVEKDVWLHVDGCLGGWMLPWGEALGYPDIPAFDFRLPGVTSISADTHKFGYGPKGGSVLAWRDASFRRHQYFLMTDWVGGVYGSPGLTGSRSGGLIAATWAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGKPTFCFAFTSDAFDIYHVNDFMRQRGWRFNGLQHPDALHMCVTGPQTQPGVAERFRQDLGEAVEHARHRAHARPQSSGVYGGDAAGLDLRDDARARAFFTQVLDLFTDCPLELast
1 -138.0005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model  100  1MDLEEGVRQLYPYAAEFGALHEFPERGMPRERLLEELRSMAVREDRKWESGRCSGTMYCGDHEHYAFLNEAYGLFSHVNALQRDLCPSMNRMESEIVAMTVALLHGEAVQRHDGAHRACGALSLGGTESILNATLAYREKARAERGIERPRMIWPASAHPAFRKAAHLFGFDVTVAPIDPVTMQVDADFVRDAVDANTVMLVGSACNYPYGTIDPIGALSAIAVEKDVWLHVDGCLGGWMLPWGEALGYPDIPAFDFRLPGVTSISADTHKFGYGPKGGSVLAWRDASFRRHQYFLMTDWVGGVYGSPGLTGSRSGGLIAATWAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGKPTFCFAFTSDAFDIYHVNDFMRQRGWRFNGLQHPDALHMCVTGPQTQPGVAERFRQDLGEAVEHARHRAHARPQSSGVYGGDAAGLDLRDDARARAFFTQVLDLFTDCPLE 474
2 -120.0004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  36  39..KDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMD-AFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGG--------PDSCGCVTSGGTESILMACKAYRDLAFEK-GIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEV-DVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTT------GMGAIYGMAQTTVDRNMVAELSSVFLDSLYS 494
3 -115.0003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  33  19...QSIEDELIRSDSQLMNFPQLPSNGIPQDDVIEELNKLNLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPS-------DTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENPDLDIMGNPRYVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTR--LSAHVVDEICDILRTTVQELKSESNSKPSPD----GTSALYGVAGSVKTAGVADKLIVGFLDALYK 479
4 -114.0003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  45  56...ASLRSQIKPYRDRFPSHARLPRAGLPRAEILAEIAAMGAAESPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDA-----AGGTVCGTVTSGGTESLLLAMKTYRDWARATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPLDADYRA-DVAAMREAITPNTVVVAGSAPGYPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPWAERLGYP-VPPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHYQYFIAADWPGGLYFSPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDELNIYQVMEEMAGRGWRLNGLHRPPAFHVALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKAT-------GMAPVYGMAAAAPPE-LVRQVLTGFIDLLYE 511
5 -113.0005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  44  52...ASLRSQIKPYRDRFPSHARLPRAGLPRAEILAEIAAMGAAESPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDA-----AGGTVCGTVTSGGTESLLLAMKTYRDWARATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPLDADYRA-DVAAMREAITPNTVVVAGSAPGFPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPWAERLGYP-VPPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHYQYFIAADWPGGIYASPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDELNIYQVMEEMAGRGWRLNGLHRPPAFHVALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKAT-------GMAPVYGMAAAAPPE-LVRQVSTGFIDLLYE 507
6 -105.0003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  17  9ESDVSVHSTFASRYVRTSLPRKMPENSIPKEAAYQIINDELMLDGNP------LNLASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPL----EEAETAVGVGTVGSSEAIMLAGLAFKRKWQNKKPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNTPIHVDAASGGFIAPFL-----YPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDPLVAFSLKDSHTEFEISDMLRRYGWIVPAYTMPPNAQRVVIREDFSRTLAERLVIDIEKVMRELDELPSRVIHK------ISLGQEKSESNSDNLMV-TVKKSDIDKQRD 483
7 -104.0005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  18  8.HTHETDETLKPIFGASAERHDLPKYKLAKHALEPREDRLVRDQLLDEGNSRLNLATF-CQTYMEPEAVELMKDTLEKNAIDKSEYPRTAEIENRCVNIIANLWHAPE------AESFTGTSTIGSSEACMLAGLAMKFAWRKRATAHQPNIVISAGYQVCWEKFCVYWDIDMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARLDAVTTKFPVYIHVDAASGGFYTPFIE-----PELKWDFRLNNVISINASGHKYGLVYPGVGWVIWRDQQYLPKELVFKVSYLGGELPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGPLICYESDREWTLYDLSDRLLMKGWQVPTYPLPKNMTRIVVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSD-----PQPKKYGFTH..................... 468
8 -98.8004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  29  58.......EGLSPQDILSAFDVDVEKCHFDFLSVTNDSPEREFLVGRGDGKDSGALYA-IHPKELTELLKEVYGATALTNPL-HDKWPRINAMQAEVIRWCQNLFHGS--------KEGYGLLTHGGTTSIIEAMAAYVIRARAK-GIDYPEIVVPETAHAAFKKAAELTGAILITVPVDKKTGAVNPNVMSSYITRNTAVMVGSAPSFMNGIHDPISELGQLAKKKNVPFHVDACLGGFLTAFLD----TSSEPMDFRVPGVTSISADLHKYGCCPKGTSVCLFSEDSPALSVYAALNWSGGLYATPGILDGSTSGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALEDIYVYGNPQWILGFRSNTCNAHFIADELEKRGWKLNLLQNPDGFHLCLTHVHTLVGSETQFIKDLREAVIDVKNYPPGKKPS-----GNVKVYGAVGMMPQKEICKQYQKARLDFTAA 518
9 -96.7001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  13  24IEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKIIMPGVTHWHSPYFFAYF-PTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALLAARTKVVRRAVLEKLVAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKPFFVVATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAFI------CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHDYRHWQLPLGRR-FRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVLVCFRLKGSDGLNEALLERINSARKIHCRLRGQFVLRFAICSRKVESGHVRLAWEHIRGLAAELLAAEEGKAEIKS.................................. 486
10 -96.0003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  13  24IEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYF-PTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFI------CPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHDYRHWQIPLGRR-FRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVLVCFRLKGSNKVNEALLQRINSAKKIHCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE........................................ 480
11 -95.8001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  18  20..........AKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNAR-----QNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPA----PKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDADTGIDIDMHIDAASGGFLAPFVAPD-----IVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIEDPGYTLYDLSERLRLRGWQVPAFTLGGEVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQN................................. 461
12 -95.6001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  18  20..........AKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNA------QNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPA----PKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRGKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDADTGIDIDMHIDAASGGFLAPFVA-----PDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIEDPGYTLYDLSERLRLRGWQVPAFTLGGEATRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQN................................. 461
13 -94.7004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  14  29VRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAYY-PALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHPSSQGGGVLQSTVSESTLIALLAARKNKILESLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFL------CPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHDFMHWQIPLSRR-FRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRLVVFRLKGPNSLTENVLKEIAKAGRLFATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQ........................................... 481
14 -93.0003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  13  24IRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYF-PTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKETILGKLVGYCSDQAHSSVERAGLLGGVKVQSENHRMRGAALEKAIEQDVAGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFI------CPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDYRHWQIPLGRR-FRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEILVCFRLKGSNERNEALLKRINGRGHIHAKIKDVYFLRMAICSRFTQSEDMEYSWKEVSAAADEMEQEQ.......................................... 475
15 -91.0003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  24  3....................RNMQEKGVSEKEILEELKK-YRSLDLKYEDGNIFGSMCSNVLP---ITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLNNK---------DAYGHIVSGGTEANLMALRCIKNIWREKRKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPIKEDYTIDEKFVKDAVEDYDVDGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKYKKKGVNYKFDFSGVDSITIDPHKMGHCPIPSGGILFKDIGYK-RYLDVDAPYLTET-RQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPNIVAIEDED----YKEVCKKLRDRGIYVSVCNCVKALRIVV-MPHIKREHIDNFIEILNSIKRD............................................... 397
16 -90.7006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  16  40LETRPVQPRVKPGFLTGQLPDKAPFHGESMEVILSDVNEKIVPGLTHWQSPNFHAYF-PASSSNAGLLGELLCSGLSVIGFTWSSSPAATELENVVVDWMAKMLNLPSSFCF--SGGGGGVLQANTCEAVLCTLAAARDKALNRDQINKLVLYCSDQTHFTIHKGAKLIGIRIKSITTKKEFKLCPNDLRDAIRSDLPFYVCGTIGTTALGVVDPIKELGKVAREFDLWLHVDGAYGGSACI------CPEFQHYLDGVDLVDSISMNAHKWLLSNLDCCFLWLQSPNALIESLAAEANFLKGDYKDWQISLSRR-FRAIKMWMVIRRYGVSNLIEHIRSDVSMAVRFEEMVAADDRFEIVFPRLVCFKLSSEKTPTRELMERVNSSGKAYVQMGRIFFIRCVIGSSLTEERHVDNLWRLIQETAQSIVS............................................ 490
17 -90.1004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  15  43IHDQPVVVEAKEHQEDKIKQIKIPEKGRPVNEVVSEMMNEVYRYRGDANHPRFFSFV-PGPASSVSWLGDIMTSAYNIHAGGSKLAPMVNCIEQEVLKWLAKQVGFT--------ENPGGVFVSGGSMANITALTAARDNKLTDINLHLGTAYISDQTHSSVAKGLRIIGITIRRIPTNSHFQMDTTKLEEAIETDKPFVVIGTAGTTNTGSIDPLTEISALCKKHDMWFHIDGAYGASVLLS------PKYKSLLTGTGLADSISWDAHKWLFQTYGCAMVLVKDIRNLFHSFHVNPEYLKDNTWDIGMELTRP-ARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKKDWEIVSPAMINFRYAPKDLTNEKISHRILESGYAATVLNGKTVLRICAIHPEATQEDMQHTIDLLDQYGREIYTEMKKA....................................... 490
18 -86.7006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  14  35IEDFPVLSQVQPGYLHKLLPDSAPDHPETLDQVLDDVRAKILPGVTHWQSPSFFAYY-PSNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLDWVAKLLNLP--------EQFMSKGNGGGVIQGSASEAVLVVLIAARNALEKLVVYSSDQTHSALQKACQIAGIHCRVLTTSTNYALRPESLQEAVSRDLPFFLCANVGTTSSTAVDPLAALGKIANSNGIWFHVDAAYAGSACIC------PEYRQYIDGVETADSFNMNAHKWFLTNFDCSLLWVKDQDSLTLALSTNPEFLKNDYKDWQIPLGRR-FRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEIVTPRLVCFRLVPVKDENRELLDAVNSSGKLFTALSGKIVLRCAIGAPLTEEKHVKEAWKIIQEEASYLLHK........................................... 490
19 -85.6002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  15  51.QVNAPYSGMDPKALEDAINADLDNKNAPLKSVIDDVAELVAKNAIFTQHPDCIAHL-HTPPLMPAVAAEAMIAALNQSMDSWDQASSATYVEQKVVNWLCDKYDLS--------EKADGIFTSGGTQSNQMGLMLARDWIADKDYADKLRIVCSKKSHFTVQKSASWMGLGVMTVDANADGTMDITKLDEVIAQAKPFAIVGTAGTTDHGAIDDLDFIADMAVKHDMWMHVDGAYGGALI-------LSSHKSRLKGVERAHSISVDFHKLFYQTISCGALLVNDKSNF-KFLLHHADYLNRNLVDKSIATTKR-FDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDQFELLAEPTVLFRATHETADNKALRLEALTRGIAVTIVDGKTALKFTILNPCLTTSDFESLLSKINMLAVELV............................................. 497
20 -83.7004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  20  46.......RPPMPETVDLPGPITIPEAAATEATLLQAIRD-MVDGSMNPANPGYIGHM-DPMPATMAILGDLVAAAVNNNMLSLEMSPSFSRLETLLLRAIAGLFGLG--------EQAGGVLTSGGSLANLQALAVARNVAFDSGLAQRPVIFASEAAHTSLQKAAMLLGLGVIPVRATADSRMDPEDLRARIDQARPFCVVATAGTTTTGNIDPLAEIGAIAREHGLWFHVDAAYGGALVFS------ERHRWRLAGIEQADSITFNPQKWLYVAKTCAMVLFRDAGVLERAFRIPAPYMRATDGFINLVQGTRHADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRPFLRLAGEIIVCFRGEPDWLPNAALQALLLREGKIFPVYRGGRWLRAVLLNPYTTDAVIDAMFKQIDRFAGRERGQER......................................... 486
21 -83.6005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  16  54.GVEKPFSGILPHELAREFSGDLDQSLGSNEAALEELKKLYLRDAVWFHHPKYVAHL-NCPVVLPSLLAEQIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLSRIGLP--------AGADGIFTSGGTQSNLMAMLLARDSWCAAHDAAKWRVFTSKLSHFSIQKSMAILGLGVIPVDYDERYRMDVDCLKQEVQRCLPVAVVATSGTTDFGSIDPLGAISELCKHHGMWMHVDAAYGCGLLVS------ESHRPRLAGIEKADSVTVDYHKSFFQTVSCGAFFVRDKHHL-SHVTHHADYLNPNLVNKSIQTTRR-FDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPAIEVLHVPTQIFRYVPRPGMNTNIRKAVFRSGNAVTKVNGRQYLKFTLLNPNTTAADIEDVIALIVHYGREQVRGPAVTTAP.................................... 518
22 -83.5006eem_A mol:protein length:512 Tyrosine/dopa decarboxylase  ali model follow..  15  43VEKYPVRSQVEPGYLKKRLPESAPYNPESIETILEDVTNDIIPGLTHWQSPNYFAYF-PSSGSIAGFLGEMLSTGFNVVGFNWMSSPAATELESIVMNWLGQMLTLPKSFL----FSSDGSSGGGGVLQGTTCEAILCTLTAARENINKLVVYASDQTHCALQKAAQIAGINVRAIKTSKNFGLSPNSLQSAILADIPLFLCATVGTTSSTAVDPIGPLCAVAKLYGIWVHIDAAYAGSACI------CPEFRHFIDGVEDADSFSLNAHKWFFTTLDCCCLWVKDSDSLVKALSTSPEYLKNDYKDWQIALSRR-FRSMKLWLVLRSYGVANLRTFLRSHVKMAKHFQGLIGMDNRFEIVVPRMVCFRLKPTAIFNVKLLESVNASGKIYAVVGGVYMIRFAVGATLTEERHVTGAWKVVQEHTDAILGA........................................... 512
23 -83.0006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  14  45VETYPVLSEVEPGYLRKRIPETAPYLPEPLDDIMKDIQKDIIPGMTNWMSPNFYAFF-PATVSSAAFLGEMLSTALNSVGFTWVSSPAATELEMIVMDWLAQILKLP--------KSFMFSGTGGGVIQNTTSESILCTIIAARDSIGKLVCYGSDQTHTMFPKTCKLAGIYIRLIPTTVDFGISPQVLRKMVEDDVPLFLCATLGTTSTTATDPVDSLSEIANEFGIWIHVDAAYAGSACIC------PEFRHYLDGIERVDSLSLSPHKWLLAYLDCTCLWVKQPHLLLRALTTNPEYLKNDFKNWQIATGRK-FRSLKLWLILRSYGVVNLQSHIRSDVAMAKMFEEWVRSDSRFEIVVPRLVCFRLKPDVSSNKKLLDMLNSTGRVYTIVGGIYMLRLAVGSSLTEEHHVRRVWDLIQKLTDDLLKEA.......................................... 500
24 -81.8002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  15  41.RSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQT-TLKYAIKTGHPRYFNQL-STGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPG-------GSGDGIFSPGGAISNMYAMMIARFKMFPEAALPRLIAFTSEHSHFSLKKGAAALGIGVILIKCDERGKMIPSDLERRILEAKPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMS------RKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQMHASYLFQQDKHYDLSQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVFDGNVCFWYIPPSLRAPVIKARMMEYGTTMVSYQKVNFFRMVISNPAATHQDIDFLIEEIERLGQD............................................... 497
25 -79.9002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  16  56..SQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRA-VIRYSVKTGHPRFFNQL-FSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWS---------SGDGIFCPGGSISNMYAVNLARYQRYPDRTLPPLALFTSKECHYSIQKGAAFLGLGVRVVKADERGKMVPEDLERQIGMAEPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLS------QTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSLLKRCHGSQASYLFQDTGDKVVQCGRR-VDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPNVCFWFVPPSLRAPVLKERMVKEGSMMIGYQRGNFFRVVVANSALTCADMDFLLNELERLGQDL.............................................. 509
26 -78.9003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  15  45.RSTKVLDFHHPHQLLEGMEGELSDHPESLEQILVDCRD-TLKYGVRTGHPRFFNQL-STGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSS-------KDGDGIFSPGGAISNMYSIMAARYKYFPEAAVPKLVLFTSEQSHYSIKKAGAALGFGVILIKCNERGKIIPADFEAKILEAKPFYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMS------RKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKEKGILQGCNQMHASYLFQQDKHYDVSQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVFNGNVCFWYIPQSLRAPKIKALMMESGTTMVGYDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL.............................................. 505
27 -78.7006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  15  69DVNEKVCEWQPPEQLRQLLDLEMRDTGESQDKLLKLCQD-VIHFSVKTNHPRFFNQL-YAGLDYYSLAARIITEALNPSIYTYEVSPVFLLVEEAVLKKMIECVGWK---------EGDGIFNPGGSVSNMCAMNLARYRHCPDSGLPRLILFTSAECHYSMKKAASFLGIGVYFVETDGRGKMIPEDLEKQIWQARPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSALVS------RKHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKDLLKKCYSAKATYLFQDTGDKSIQCSRR-PDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPNVCFWYIPPSLRAPAIKEKMMKKGSLMLGYQKVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM.............................................. 524
28 -75.8002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  13  33...ELVLNEYLKEIEDVFNHRKIPENGIDDEKIKLFLKFLSMMDRIGEREARTYSKI-HEELSSGFCHGIGRSGNLVDPQPKASGASIMYALTNKILESFFKQLGLN--------VHAIATPISTGMSISLCLSAARKK-------YGSNVVIYPYASHKSPIKAVSFVGMNVETVLDGDRVYVPVEDIENAIKKENRPCVLSTLTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKKA-------FKYRVDAVVSSSDKNLLTPIGGGLVYSTDAEFIKEISLSYP-------------GRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKTFLDVEASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDTHDYIVMNAAIGVRTEDIVNSVSKLEKIL................................................. 449
29 -66.4005hsi_A mol:protein length:634 Putative decarboxylase  ali model follow..  19  57...............EDQNSPAFKKTVGHMKTVLDQLSERIRTESVPHSAGRYWGHM-NSETLMPALLAYNYAMLWNGNNVAYESSPATSQMEEEVGQEFARLMGYD---------YGWGHIVADGSLANLEGLWYARNIKSGKNLQRLGKWLVPQTKHYSWMKAADIIGIGVVPVPIDSNYRMDIQALESIIRKYAILGVVGVAGSTEEGAVDGIDKIVALRQKLYFYLHVDAAYGGYARALFLDYIKPEVYAAYKAFDQAESITIDPHKMGYVPYSAGGIVIQDIRMR-DTISYFATYVFELLGAYILEGSKAGATAASVWAAHHTLNVTGYGKLEGASIEGAHRYYDFLKNLKSVHPLISPMVDYVLKEDGNDDLIEMNRLNHA--EWRHAGKVTIIRASVMTPMNQRENFDYFAPRIKKAIQADLEKVYASVNQKE.................................. 624
30 -38.7001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  14  10.SRKGRRGLKLVKAVPKAE-DLIPKEEVDELTLVRHYTGLSRRQVGVDTTFYPLGSCTM--KYNPKLHEEAARLFADLHPYQDRTAQGALRLMWELGEYLKALTGMDA---------ITLEPAAGAHGELTGILIIRAYHEDRGEGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEG-EVDLEALKRELGPHVAALMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNAIMGWARPGDM-DVVHLNLHKTFTVPHGGGGPGSGPVGVKAHLAPYLPVPLVERG-GFYLDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMFVAQPPEGFRALDLAKGLLELGFHPPTVYFPLIVKEALMTETEAKETLEAFAEAMGALLKKPKEWLENAPYSTPV................................. 454
31 -31.7003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  20...................QGKCPEDGWDESTLELFLHELAVMDSNNFLGNCGVGE--REGRVASALVARRHYRFIHGIGRSGDISAVQPKAASSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAK----YIIWPRIDQKSCFKSMVTAGFEPVVIELEGDELRTDLKAVEAKIPEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQS------SKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNEPFIQDI-------------SKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLANERLLQTPQLGSMLFTRQVSGARAVPLGNVQGFMSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVRKEQTRA....................................... 450
32 -28.5003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  38...................KGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGE--REGRVASALVARRHYRFIHGIGRSGDISAVQPKAASSLLNKITNSLVLDIIKLAGVHTVANCFVVPMATGMSLTLCFLTLRHKRPKAK----YIIWPRIDQKSCFKSMITAGFEPVVIELEGDELRTDLKAVEAKVPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQS------SKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQEI-------------SKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSNERLLHTPQLGSMLFTRQVSGARVVPLGSMQGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDN--YDKTEDVDIEEMALKLDNVLLDTYQDAS..... 500
33 -24.3005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  12  56......................................................QRGGILPKEAKKAVYEYWDGYSVCDYCHGRLDEVTCPPIKDFLEDIAKFLNMDCA-----------RPTHGAREGKFIVMHAICKEG---------YVVLDKNAHYTSYVAAERAVAEVGYEEEYPTYKINLEGYKEVIKGKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV------------KADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEK---FPVKEIEMLGCTSRGLPIVTLMASFPHV--VERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFIGGIRAGVTKEIKMSVYGLEWEQVEYVVNAIKEIVESCK............................................. 411
34 -23.8001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  13  30...................................................................ILDLMARDNMTQHAGYGQDSHCAKAARLIGELL-------------ERPDADVHFISGGTQTNLIACSLALRPWEA--------VIATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENR--LVYISNTTEVGTQQELEDISASCKEHGLYLFLDGALASALSSPVNDLTLADIA------RLTDMFYIGATKAGGMFGEA--LIILNDALKPNARHLIK----------QRGALMAKGWLLGI-QFEVLMKDNLFFELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEPLK-DGTCIMRL-CTSWATEEKECHRFVEVLKRLVAS............................................... 357
35 -23.8003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  13  18........................................................IYLDYSATTPVDPRVAEKMMNPASRSHRFGWQAEEAVDIARNQIADLVGADPRE----------VFTSGATESDNLAIKGAANFYQKKGK----HIITSKTEHKAVLDTCRQLGFEVTYLAPQRNG-IIDLKELEAAMRDDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQL------------KVDLMSFSGHKI-YGPKGIGALYVRRKPRVR------EAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSIRFSLGR-FTTEEEIDYTIELVRKSIGRLRD............................................ 395
36 -23.7001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  13  23......................................................GGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNT----------TITDNVTTGCDIVLWGLDWH-------QGDEILLTDCEHPGVQAIAARFGITYRFFPVAATNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQVRVLVDGAQSAGSLPLDFSRL------------EVDYYAFTGHKWFAGPAGVGGLYIHGDCLGE----INPTYVGWRSITYGAKATSAYPQYAGLLAALQLHQRQGTAEERQAICQRSEFLWRGLNQLPHVHCLATSLVSFTV-DSPLGHRAIVQKLEEQRIYLRTIADPDCIRACC-HYITDEEEINHLLARLADFG................................................. 389
37 -23.6004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  15  9....................................................................................AKPVDERILEAMLPYMTESFGNPSSVHSYGFKAREAVFTSGATEANNLAIIGYAMRNARKGK----HILVSAVEHMSVINPAKFLGFEVEYIPVGKYG-EVDVSFIDQKLRDDTILVSVQHANNEIGTIQPVEEISEVLAGKAA-LHIDATASVGQIEVDVEKI------------GADMLTISSNDI-YGPKGVGALWIRKEAKLQ-------PVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESYLNGHPE-NVNVRFSYIEGESIVLSLDMAGIQAST-EAHGTLLLTLGR-YNTDEDVDRLLEVLPGVIERLRS............................................ 375
38 -23.6004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  10  9......................................................NATTFIDPRVKEFIISLMDKELNPSSAHSSGRFAKNLIETV--AQIATALGITLSSREYD------TFTSSGTEGNNLIM----------KNFYDGDIFISAIEHLSIYNHINY-APNIKVISVNTQGLVDLEHLEELLAQSNKKLVSIIMANNESGVLQDIAEIGKITKKYEAKFHSDLVQGFGRIPINIKAL------------GLDFATISGHKI-GGGQGGAALISSSNFQIT-------PMIIGGGQEKSVRSGTENVLAIAGFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSNNV-TTLITIPNTDAQAKLIGFDLHNICVSS-EAKSSIRISLSH-TNTVRDIEAFIEAFEEIYDVIPS............................................ 374
39 -23.5001v72_A mol:protein length:356 Aldolase  ali model follow..  13  14............................................................SDNIAGASPEVAQALVKHSSGQAGPYELTAQVKRKFCEIF--------------ERDVEVFLVPTGTAANALCLSAMTPPWGN--------IYCHPASHINNDEAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKV-ACVSITQATEVGSIDEIEAIGDVCKSSSLGLHMDGS-------FANALVSLGCSPAEMTWAGVDALSFGATKNGVLAAEA--IVLFNTSLATEM----------SYRRKRAGHLSSKMRFLSA-QIDAYLTDDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCR----DSAMIDALLKAGFGFYHDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQER........................................... 356
40 -23.5005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  15  12....................................................................................TTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIITSCATESNNWVLKGVYFDECLKK--GKNHIVTTVAEHPAVRSTCNFLGVEVTYLPINEHG-SITAEQVREAITEKTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKA------------NADFLSFSAHKF-HGPKGIGGLYIRSGVGLT-------PLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRI-TTLVSVRGIEGEAMLWDLNRSNIAAST-LAHTAIRLSLSR-FNTEAEIDKTIEVFSQAAVRLRN............................................ 382
41 -23.3005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  13  10............................................................SDNYSGICPEAWAAMEKANHGHDRAYQWTERASEYFRNLF--------------ETDCEVFFAFNGTAANSLALASLCQSYHS--------VICSETAHVETDEAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATEVGTVDELKAISATCKELGLNLHMDGA-----FTNACAFLGCSPAELTWK-AGVDVLCFGGTKNGMAVGEA--ILFFNRQLAEDF----------DYRCKQAGQLASKMRFLSA-PWVGLLEDGAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQ----PEHAIEALRAKGWRFYTFIGSGGARF-MCSWDTEEERVRELAADIRSIITA............................................... 346
42 -23.3003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  15  23....................................................................................TTRVDQRVADIVLHWMTAEFGNAGSRHEYGIRAKRGVFTSGATESNNIALLGLAPYGERT---GRRHIITSAIEHKAVLEPLEHLGFEVDFLTPGPSG-RISVEGVMERLRPDTLLVSLMHVNNETGVIQPVAELAQQLRATPTYLHVDAAQGYGKVPGDLTT-------------PIDMISISGHKI-GAPKGVGALVTRRREEMDDERVPLEPIMFGGGQERKLRPGTLPVPLIMGLAEAAKIFEAEHAQWQVAAQDLRSRLLAGLASTS--VVPHILNLSFEDVDAEAFLVTLKDLVAATGSASTSASFTPSLRFSWTPGQATDLDVEELARGVAKLKP................................................ 392
43 -23.3002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  10  11....................................................NIDPLQTGGKLTEEARQALLEWGDGYSVCDFCTTGRLDEIKTPPINQLPKFLGCDVA-----------RVTNGAREAKFAVMHSLAK--------KDAWVVMDENCHYSSYVAAERAGLNIALVPKTDY-ENFAQTIEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI------------GADFIVGSGHKSMAASGPIGVMGMKEEWA---EIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHV--RERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKKAKGGRFFLYRELKSRKIHFKLSTYGLSDEEVDYVLNAFKEIIEKY.............................................. 370
44 -22.9004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  16  12......................................................AATTPMHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIEEA--ELIADKLGARPSE----------IFTAGGTESDNLAVKGI--WARRDAEPHRRRIVTTEVEHHAVLDSVNWLGAHVTWLPTAADGSVSATALREALQHDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLP------------LDFGASGLSAMSVAGHKF-GGPPGVGALLLRRDVTCV-------PLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVAEIDDVCLNGADD-NAHFTFRGCEGDALLMLLDANGIECST-SARGSLRLSLGH-TSVEADVDAALEVLPGAVARARR............................................ 388
45 -22.8005i90_A mol:protein length:427 PvdN  ali model follow..  12  59......................................................FLLTSHPRPVREAIERLRVRFRNPGEAVDWHREEIWKYEDEARAWAGRYFAVQPGQ----------ALTGSTTDGLAAIYGGLL---------PGKEILTSSHEHYSLEYRHKRMGTQVREFPLFKDPHRVSASSIAAQIRPQTRVLGMTWVQSGSGVKLPIREIGKLVRELNIIYVVDGVHGFGVEDVSFADF------------DCDYFIAGTHKWLFGPRGTGVIIARSEQLQEHLVPSIPTFSRADNFGTLMGGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHPKVRLVTPTS-FTFFRVEGRDCEAVAKHLMAHRVISDAVDVGPVVRLAP-SLLNDEAEIDRVLEILAPQLA................................................ 427
46 -22.8003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  13  47......................................................................................AIIEPFEQKF----ADVLGMDD-----------AVFFPSGTMAQQVALRIWSDETDNR------TVAYHPLCHLEIHEQDGLKELPIETILVGAADRLMTLDEIKALPDIACLLLELPQ-REIGGVASELETISRYCRERGIRLHLDGA---FEMLPYYEKTAAEI------AGLFDSIYISFYKGLGGI--AGAILAGPAAFCQTARIWKRRYGGDLIS-------------LYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVMFHLHFDGQAADISPLEQVQEETGLGFVGYLVDKDGYC-STEISVGDAYGELDQQTRDAGFARLRQA........................................... 355
47 -22.7005usr_A mol:protein length:426 Cysteine desulfurase, mitochondrial  ali model follow..  15  29....................................................................................TTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESEAIFTSGATESNNIAIKGVARFYRSRKK----HLITTQTEHKCVLDSCRSLGFQVTYLPVQKSG-IIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKIPLDVNDM------------KIDLMSISGHKI-YGPKGVGAIYIRRRPRVR------EALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIKSLPDVVMNGDPKLSFAYVEGESLLMALKDVALSSGSACTSASLEPSIRFGIGR-FTTEEEVDYTVEKCIQHVKRLRE............................................ 398
48 -22.7002hzp_A mol:protein length:501 Kynureninase  ali model follow..  11  63LDEEDKLRHFREC--------YIPKIQDLPPVDLSLVN---KDENAIYFLGNSLGLQ---PKMVKTYLEEELDKWAKIAAYGHEVKRPWITGDESIVGLMKDIVGANEKE----------IALMNALTVNLHLLMLSFFKPTPKRY----KILLEAKAFPSIESQLQLHGLNIEESMREETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDW------------GVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPALVGWFGHELST---ISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHNPVVNIITPCQLTITFSVPN---KDVFQELEKRG-VVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN.......................................... 495
49 -22.4003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  16  10...........................................................RSDTVTQPTDAMRQCMLHAEVGDYGEDPGVNALEAYGADLL---------------GKEAALFVPSGTMSNLLAVMSHCQRGEG--------AVLGSAAHIYRYEAAVLGSVALQPVPMQADGSLALADVRAAIAPDDTPTRLVCLENTHNGKVPYLREMRELVDEHGLQLHLDGAFNAVVASGHTVREL---------VAPFDSVSICLSKGLGAPVGS--LLVGSHAFIARARRLRKMVGGG--------MRQAGILAQAGLFAL-----QQHVVRLADDHRRARQLAEGLAALPGIRLDLAQV-MVFLQLTSGESAPLLAFMKARGILF---SGYGELRL-VTHLQIHDDDIEEVIDAFTEYLGA............................................... 341
50 -22.4001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  13  35......................................................NSLGARPVAALARAQAVIAEEWGNGLIRSWNSAGWRDLSERLGNRLATLIGARDGE----------VVVTDTTSINLFKVLSAALRVQATRSPERRVIVTETSNFPTAEGLADMLQQGYTLRLVDS------PEELPQAIDQDTAVVMLTHVNYKTGYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ-------------GADYAIGCTYKYLNGPGSQAFVWVSPQLCHSRQFAMEPRYEPSNGIARYLCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRHELTLVTPSHVSFEHPEG----YAVIQALIDRG-VIGDYREPRIMRFGFTPLYTTFTEVWDAVQILGEILDRKTWAQAQFQVRHSV................................. 415
51 -22.0001wyt_A mol:protein length:438 glycine dehydrogenase (decarboxylating) subunit 1  ali model follow..  14  10.EIREMLRRVGAASLEDLF-AHLPKEPLPEWKVLEELRRLAAQNLPAHKAFLGGGVRSHHVPPVVQALAARGEFLTAYTPYQPEVSQGVLQATFEYQTMIAELAGLE----------IANASMYDGATALAEGVLLALRETGRMG------VLVSQGVHPELRAYLEAVGAKLLTLPLEGG------RTPLPEVGEEVGAVVVQNPNF-LGALEDLGPFAEAAHGAGALFVAVADPLSLGVLKPPGAY------------GADIAVGDGQSLGFGGPHFGFLATKKARGFILTLQAREQYIRRAKAKSNI--TNAQLTALMGAMYLAALGPEGLREVALKSVEMAHKLHALLLEVPGVRPFTPKPFFNEFAALPKDPEAVRRALAERGFHVPREYGENLALFAATELH-EEEDLLALREALKEVLA................................................ 438
52 -21.9003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  16  34....................................................................................TTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIIFTSGGTESNNLVIHSVVKHFHANQTSAKPHFITSSVEHDSIRLPLEHLVAAVTFVPVSKVSGQTEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEISQRIKALNILVHTDAAQALGKQRVDVEDL------------GVDFLTIVGHKF-----RIGALYIRGLG---EFTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAE-LVTQNCEAYEAHMRDVRDYLEERLAEFGQKRIHLNSQFTCNFSIRGPRLQGHVVLAQCRVLMASV-VARNALRLSVGR-STTRAEVDLVVQDLKQAVAQLED............................................ 438
53 -21.6001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  15  10....................................................................................TTRVDDRVLEEMIVFYREKYGNPNSAHGMGIEANLHMFTSCATESINWILKTVAETFEKRKR----TIITTPIEHKAVLETMKYLGFKVKYVPVDSRG-VVKLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDVTRIVKKKNTLVHVDAVQTIGKIPFSLEKL------------EVDYASFSAHKF-HGPKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSF----PNIRGSTLQNLLSGYGIYVST-IAQGAIRISLCK-YNTEEEVDYFLKKIEEILSFLDL............................................ 378
54 -21.6002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  15  12............................................................SDTVTKPTEEMRKAMAQAEVGDYGEDPTINELERLA----AETFGKEA-----------ALFVPSGTMGNQVSIMAHTQRG---------EVILEADSHIFWYEVAVLSGVMPHPVP-GKNGAMDPDDVRKAIRPRNSLIAIENTHNRSGGRVENIKEICTIAKEHGINVHIDGAFNASIASGVPVKEY---------AGYADSVMFCLSKGLCAPVGS--VVVGDRDFIERARKARKMLGGG--------MRQAGVLAAAGIIAL-----TKMVDRLKEDHENARFLALKLKEIGYSVNPEDVMVILRTDNLKVNAHGFIEALRNSGVLANAVS-DTEIRL-VTHKDVSRNDIEEALNIFEKLFRKFS............................................. 349
55 -21.1003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  16  27....................................................................................TTPLEPEVIQAVTEAMKEAWGNPSSSYVAGRKAKDIIFTSGGTESNNLVIHSTVRCFHEQQTLTRPHFITCTVEHDSIRLPLEHLVAEVTFVPVSKVNGQVEVEDILAAVRPTTCLVTIMLANNETGVIMPISEISRRIKALNVLVHTDAAQALGKRRVDVEDL------------GVDFLTIVGHKF-----RIGALYVRGVG---KLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAD-LVSENCETYEAHMRDIRDYLEERLEAEFGKRIHLNSRFTCNFSIQGSQLRGYMVLAQCQTLLASV-VARNAVRLSVGR-STTRAEVDLIVQDLKQAVNQLEG............................................ 430
56 -21.0005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  10  1MGDRGPEFVATTVELPLQQKADAAQTVTGPLPFGNSLLKELDPAYRNLNHGSF-----TIPSAIQQKLRSYQTA-AEARPCPFLRYQTPVLLD-ESRAAVANLLKVPVETV---------VFVANATMGVNTVLRNIVWSADGKD-----EILYFDTIYGACGKTIDYVIVSSRCIPLIYPAAFRDAIKKSREEGKRPRLAVIDVVSSMPGVRFPFEDIVKICKEEEIISCVDGAQGGMVDLKITET-------------DPDFLISNCHKWLFTPRGCAVFYVPVRHLIRSTLPTSHGFVPAFVSNFEFVGTVDNSPFFCVKDAIKWREEGGEERIMEYMTKLAREGGQKVAEILGTRVLENSMVNIALEEANMAFKWMYNVLQDE---MTFHRRRFWARLSA-QVYLEMSDFEWAGKTLKELCERVAKGEYKESALEVDLQGDHGLSAWSHPQFEK................ 501
57 -20.5003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  11  2.........................................MTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDYGNGAVIEDFETKI----AKILGKQS-----------AVFFPSGTMAQQIALRIWADRKENRR------VAYHPLSHLEIHEQDGLKELQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLEELEKISEYCHEQGISLHLDGA-----LWEITPFYQKSAEEI---CALFDSVYVSFYKGIGGIAGA--ILAGNDDFVQEAKIWKRRYGGDLIS-------------LYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVMFHVYFENSADEIGAILTKIQDETGVGISGYLQEKSAD-VCAFEVSVGDAFAEIKNLELVFRCLEKE........................................... 358
58 -20.4004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  14  6............................................................SDTVTRPSRAMLEAMMAAPVGDYGDDPTVNALQDYAAELS---------------GKEAAIFLPTGTQANLVALLSHCERG---------EYIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDARTKLLSLENTHNGKVEYLKEAWEFTRKRNLALHVDGAFNAVVAYGCELKEI---------TQYCDSFTICLSKGLGTPVGS--LLVGNRDYIKRAIRWRKMTGGG--------MRQSGILAAAGMYAL-----KNNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRVGE-----ENAAALGEYMKARNVLINASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR............................................... 333
59 -20.3003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  14  6............................................................SDTVTRPSRAMLEAMMAAPVGDYGDDPTVNALQDYAAELS---------------GKEAAIFLPTGTQANLVALLSHCERG---------EYIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDARTKLLSLENTHNGKVEYLKEAWEFTRERNLALHVDGAFNAVVAYGCELKEI---------TQYCDSFTICLSKGLGTPVGS--LLVGNRDYIKRAIRWRKMTGGG--------MRQSGILAAAGIYAL-----KNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGE-----ENAAALGEYMKARNVLINASPIVRLVTHLDVSREQLAEVAAHWRAFLAR............................................... 333
60 -19.3002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  17  4........................................................LTPGPTPIPERVQKALLRPMRGH-----LDPEVLRVNRAIQERLAALFDPGEGALV--------ALAGSGSLGMEAGLANLDR--------GPVLVLVNGAFSQRVAEMAALHGLDPEVLDFPPGEPVDPEAVARALKRRRYRMVALVHGETSTGVLNPAEAIGALAKEAGALFFLDATLGMLPFSMRA---------------GVDYAFTGSQKCLSAPPGLAPIAASLEAR-KRGWYLDLARVAEHWERGGYHHTTPVLLHYALLEALDLVLEEGVAARERRAREVYAWVLEELKAR-GFRPYPKPTVLVVRPPEGVDADRLVRALYAEGVAVAGGIGPQVLRLGLMGEGARREAYQAFLKALDRALALA.............................................. 353
61 -19.2005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  13  31........................................................LGPGPSNLPPRIMAAGGLQMIGS-----MSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSG-----HCALEAALVNVLEPGDSFL---------VGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVNSSLGGTPLYMDR---------------GIDILYSGSQKALNAPPGTSLISFSDKAKKK-DIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQAL-GLQLFVKPTVTTVAVPAGYDWRDIVSYVIDHDIEIMGGLGPKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKK.......................................... 396
62 -19.2003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  11  33............................................................PDSVATTVSTAFRRSGASTVGAHPSARRSAAVLDAAREAVADLVNADPGGV---------VLGADRAVLLSLLAEASSSRAGLGY-----EVIVSRLDDEAWLRAAHRYGAKVKWAEVDIETGELPTWQWESLISKSTRLVAVNSASGTLGGVTDLRAMTKLVHDVGALVVVDHSAAA------------PYRLLDIRETDADVVTVNAHAW-GGPPIGAMVFRDPSVMNSFGSVSTNPYATGPAR----IGVHQFGLLAGVVASIEYLAAVSMQSADAYLNRVFDYLMVSLRSLPLVMLIGRPE-VVSFAVHKVPADRVVQRLADNG-VLGVNDVGGAVTVGLAHYSTMAE-VDQLVRALASL.................................................. 399
63 -19.1003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  12  27........................................................LGPGPSNLAPRVLAAGSLRMIGH-----MQKEMLQIMEEIKQGIQYVFQTRNPLTLVVSGSG-----HCAMETALFNLLEPGDSFL---------TGTNGIWGMRAAEIADRIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLVHGESSTGVVQPLDGFGELCHRYQCLLLVDSSLGGVPIYMDQ---------------GIDIMYSSSQKVLNAPPGISLISFNDKAKYK-DITYLAKLWGCEGETRVIHHTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEM-GLKFFVKPTITTVTVPAGYNWRDIVSYVLDHFSIEIS--EERVLRIGLLGYNATTENVDRVAEALREALQHCPKNK.......................................... 392
64 -19.0002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  14  22........................................................MGPGPSNCSKRVLTAMTNTVLSN-----FHAELFRTMDEVKDGLRYIFQTENRATMCVSGSA-----HAGMEAMLSNLLEEGDRVL---------IAVNGIWAERAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQPKCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDASLCGVPFYMDK---------------EIDAVYTGAQKVLGAPPGITPISISPKALDV-DLLLLGNYWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKM-GLDIFVKPTVTGIMIPKGVDWWKVSQYAMNNSLEVQGGLGPKAWRVGIMGECSTVQKIQFYLYGFKESLKATHPDYIFEESNGF.................................. 395
65 -18.9002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  13  26........................................................LGPGPSNLPPRIMAAGGLQMIGS-----MSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSG-----HCALEAALVNVLEPGDSFL---------VGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSSLGGTPLYMDR---------------GIDILYSGSQKALNAPPGTSLISFSDKAKKK-DIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQAL-GLQLFVKPTVTTVAVPAGYDWRDIVSYVMDHDIEIMGGLGPKVLRIGLLGCNATRENVDRVTEALRAALVAQ.............................................. 387
66 -18.9004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  13  26........................................................LGPGPSNLPPRIMAAGGLQMIGH-----MSKEMYQIMDEIKEGIQYVFQTRNPLTLVISGSG-----HCALEAALVNVLEPGDSFL---------VGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSSLGGTPLYMDR---------------GIDILYSGSQKALNAPPGTSLISFSDKAKKK-DIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQAL-GLQLFVKPTVTTVAVPAGYDWRDIVSYVMDHDIEIMGGLGPKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKK.......................................... 391
67 -18.8004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  13  28........................................................LGPGPSNLPPRIMAAGGLQMIGS-----MSKDMYQIMDEIKEGIQYVFQTRNPLTLVISGSG-----HCALEAALVNVLEPGDSFL---------VGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSFLGGTPLYMDR---------------GIDILYSGSQKALNAPPGTSLISFSDKAKKK-DIKWLANFWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQAL-GLQLFVKPTVTTVAVPAGYDWRDIVSYVIDHDIEIMGGLGPKVLRIGLLGCNATRENVDRVTEALRAALQHCPKKK.......................................... 393
68 -18.2005b7s_A mol:protein length:419 Cysteine desulfurase  ali model follow..  10  37......................................................TATSLTPKPVVEAMDEYYLKYANVHRGVHRLSQMATHKYEESRKIVADFIGAKFEEI---------VFTKNTSESLNLVALGLGHIFKRGD-----KIVTTPYEHHSWQRLATKLGLKLEFIEGDDEGNLDLSDAEKKI--KGAKLVAVQHVSNALGVIHEVEELGKIAKDEGAIFVVDAAQSAGHMEVNVKKL------------HADFLAFSGHKGPMGPTGIGVLYIREEGTIEDVSLDGYKLTEPPER----AGTPNIGGAIGLAAGIRYIERIGLGRIERQEHKLVKRTTEGLDELEVPWYGPRNL-VVSFNVPGLHPHDVAAILDDHSIMVRSLGINGTVRASFHVYNSLEE-VETFLGVMEELVKGLKT............................................ 413
69 -18.2002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  13  23........................................................MGPGPSNAPQRVLDAMSRPILGH-----LHPETLKIMDDIKEGVRYLFQTNNIATFCLSASG-----HGGMEATLCNLLEDGDVIL---------IGHTGHWGDRSADMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLTQGDSSTGVLQGLEGVGALCHQHNCLLIVDTSLGGAPMFMDR---------------EIDAMYTGSQKVLGAPPGITPVSFSHRAVER-DMSLVGDYWGCFGRPRIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDA-GFELYADSTVTTIKVPQGVDWLKAAQYAMKTLVEISGGLGPQVFRIGLMGQNATTERVDRVLQVFQEAVAAV.............................................. 383
70 -18.0003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  12  15........................................................MTPGPVEVDPRVLRVMSTPVVGQ-----FDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTS-----RAGIEAVLASVIEPEDDVL---------IPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALFIVDATIGGCEVKVDE---------------KIDAAIGGTQKCLSVPSGMAPITYNERVAITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAM-GLRLFGDPVVTCVEIPGGIDGESVRDMLLAQGIEIASSFGPKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYENAGRQAA..................... 415
71 -17.8001vjo_A mol:protein length:393 alanine--glyoxylate aminotransferase  ali model follow..  12  32........................................................LGPGPSNAHPSVLQAMNVSPVGH-----LDPAFLALMDEIQSLLRYVWQTENPLTIAVSGTG-----TAAMEATIANAVEPGDVVL---------IGVAGYFGNRLVDMAGRYGADVRTISKPWGEVFSLEELRTALETHRPAILALVHAETSTGARQPLEGVGELCREFGTLLLVDTSLGGVPIFLDA---------------GVDLAYSCSQKGLGCSPGASPFTMSSRAIVANWYLDMNLLGKYWGSERVYHHTAPINLYYALREALRLIAQEGLANCWQRHQKNVEYLWERLEDI-GLSLHVEPTLTTVCIPDGVDGKAVARRLLNENIEVGGGLGEKVWRVGLMGFNSRKESVDQLIPALEQVLR................................................ 387
72 -17.8001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  110................................FFKSLKEYVSRYLIQFDCPGHQG----GQYYRKHPAGREFYDFFGETVFRADLCNADVALGDAAEKHAARVYNADKTY----------FVLGGSSNANNTVTSALVS--------NGDLVLFDRNNHKSVYNSALAMGGRPVYLQTNRNPYLAAKVDPERAKWKRPFRLAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRNSSPLLIDDLGPEPGIIVVQSVHKQQAGFSQTSQIHKKDSHIKGQLRYCDHKHFNNSFN--LFMSTSPFYPMYAA-NAAMQEGEAG-RKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVGDYEDFGVPATIVANYLRDHGIIPEKSDLNSIL--FLMTPAETPAKMNNLITQLLQLQRLIEEDAPLKQVLPSIYAANEERYNGYTIRELCQELHDFYK........ 604
73 -17.8001c0n_A mol:protein length:406 PROTEIN (CSDB PROTEIN)  ali model follow..  15  30......................................................AASAQKPSQVIDAEAEFYRHGAAVHAGAHTLSAQATEKMENVRKRASLFINARSAEE---------VFVRGTTEGINLVANSWGNSNVRAGD----NIIISQMEHHAWQMLCARVGAELRVIPLNPDGTL-QLETLPTLFDAATRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQAL------------DCDFYVFSGHKL-YGPTGIGILYVKEAGSMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQA-VIAFNLGAHHAYDVGSFLDNYGIAVRTYNVPAMCRASLAMYNTHEE-VDRLVTGLQRIHRLL.............................................. 405
74 -17.7006c9e_A mol:protein length:422 Cysteine desulfurase  ali model follow..  13  40......................................................AATTQKPKAVIDAIAQFYEKDSNVHRGVHALSVRATEMYEAARAKVKRFINARSPRE---------IFVRGTTEAINLVAQSLVAPRILPDE----EILITHMEHHSWQMVCKKMGCKLQVAPISLNGEV-ILEEFERKLNENTKMVAINYASNSLGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQDL------------DCDFYAFSGHKM-YGPTGIGVLWGKEEEMINSVSFEATEYAAIPHK----AGTPNIAGAIGLAAAIDYIWSLDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAA-IISFVHGKIHAHDIGTILDSEGIAIRSYDVAATSRISMSFYNTFKE-IDYCMEALQRVKEVF.............................................. 415
75 -17.7004w91_A mol:protein length:422 Aminotransferase  ali model follow..  14  40......................................................GASAQKPQSVIDAVTHAYANEANVHRGLHFLSNAATDAYEKSRETVRRFLNAGSVDE---------VFTKNATEAINTVAYGYGMPFIGEGD----EILLSIMEHHSWHFIRERQGAKLVFTPVDDNGVF-HIEEFEKRLSERTKLVAITHMSNTLGTVVPIKKIVELAHARGIPVLVDGSQGAVHLPVDVQDL------------GCDWYVFTGHKV-YGPSGIGVLYGRAQEMIEEVTEENVTYNHPPHR----AGTPPIVQAIGLGAALEYMEKIGRHAILAHEADLRDYAHERLGRINSLRIFGNAP-IISFALEGIHAHDVSMVIDRAGVAVRAFGVTSTCRASFALYNTRAE-VDALAEALEKARKFF.............................................. 415

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.