current user: public

If you have questions about the server, please let us know.

Query: 5m46_A mol:protein length:440 Aminotransferase class-III, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440
# Score Template Links and tools%idFirst QGPAMAGNLYGRDGAAIGSLQKLRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANPAGASILSASNAPAVALAERLTASFPGRGTHKVWFGHSGSDANEAAYRAITRATGRTGVIAFIGAYHGCTVGSMAFSGHSVQADAAKADGLILLPYPDPYRPYQDDPTGDAVLALLKERLAAVPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLAERHELIGDIRGRGLACGVELVRNRQSREPARAETAKLIYRAYELGLVLYYVGMNGNVLEMTPPLTMTEDEVRHAVNLLDQAFTELSTVSDTLVSQFAGWLast
1 -106.0005m46_A mol:protein length:440 Aminotransferase class-III  ali model  100  1QGPAMAGNLYGRDGAAIGSLQKLRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANPAGASILSASNAPAVALAERLTASFPGRGTHKVWFGHSGSDANEAAYRAITRATGRTGVIAFIGAYHGCTVGSMAFSGHSVQADAAKADGLILLPYPDPYRPYQDDPTGDAVLALLKERLAAVPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLAERHELIGDIRGRGLACGVELVRNRQSREPARAETAKLIYRAYELGLVLYYVGMNGNVLEMTPPLTMTEDEVRHAVNLLDQAFTELSTVSDTLVSQFAGW 440
2 -104.0003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  84  10...HMTKALYDRDGAAIGNLQKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANPAGATILSASNAPAVTLAERLLASFPGEGTHKIWFGHSGSDANEAAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADAAKADGLILLPYPDPYRPYRNDPTGDAILTLLTEKLAAVPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFAMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLEFTPPLTITETDIHKALDLLDRAFSELSAVSNEEIAQFAGW 446
3 -97.2004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  32  17...DKASKLIDEENKYYARSARINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKLAKIAPGNSPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSTRKIGPMLPSVVHVPYPDSYRTYPGHDVSLRYFNEFKKPFESLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKDPKTKEPDSDAATKVIYYAFAHGVVIITLA--GNILRFQPPLVIPREQLDQALQVLDDAFTAVENGEIPKDTGKIGW 462
4 -96.4005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  32  29...DKASKLIDEENKYYARSARINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKLAKIAPGNSPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSTRKIGPMLPSVVHVPYPDSYRTYPGHDVSLRYFNEFKKPFESLPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKDPKTKEPDSDAATKVIYYAFAHGVVIITLA--GNILRFQPPLVIPREQLDQALQVLDDAFTAVENGEIPKDTGKIGW 474
5 -95.0004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  31  24.GPRS-GALAERRRAAVSAGV-GSTAPVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHFTHTCFMVTPYEQYVQVAELLNALTPGDHDKRTALFNSGAEAVENAIKVARLATGRPAVVAFDNAYHGRTNLTMALTAKSKSQFGPFAPEVYRMPASYPLRDEPGLTGEEAARRAISRIETQIGAQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFARTGAWFASEHEGIVPDIVTMAKGIAGGMPLSAVTGRAELMDAVAGGLGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVKPG-TLEPDAALTKSIAAEALSQGVLILTCGTFGNVIRLLPPLVIGDDLLDEGITALSDIIRAKASH........... 452
6 -94.7003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  33  28.GPIS-QELQARKQSAVAAGVG-VTLPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTPYEGYVKVAEHLNRLTPGDHEKRTALFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAMTAKNKHGFGPFANEVYRVPTSYPFRDGE-TDGAAAAAHALDLINKQVGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHENVVPDLIVTAKGIAGGLPLSAVTGRAEIMDGPSGGLGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVKPG-TTEPDADLTKRVAAAAHAQGLVVLTCGTYGNVLRFLPPLSMPDHLLDEGLDILAAVFAEVK............. 453
7 -93.9004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  31  24.GPKS-QALAERRSAVVAAGVA-SGVPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCFMVTPYEGYVAVTEQLNRLTPGDHAKRTVLFNSGAEAVENAVKVARLATGRDAVVAFDHAYHGRTNLTMALTAKAKTNFGPFAPEVYRMPMSYPFREENPEITGAEAAKRAITMIEKIGGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGGLPLSAITGRADLLDAVPGGLGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAELSVVGDIRGRGAMLAIELVQPG-SKEPNAELTKAVAAACLKEGVIILTCGTYGNVIRLLPPLVISDELLIDGLEVLAAAIKAHA............. 456
8 -93.7003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  32  32.GPAS-LELNKRRAAAVSGGVG-VTLPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQFTHTCFMVTPYEQYVAVAEQLNRITPGSGEKRTVLFNSGAEAVENSIKVARAHTRKQAVVAFDYAYHGRTNLTMALTAKSKSGFGPFAPEIYRAPVSYPYRDNLLDKDIAAAERAINLIDKQIGAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGFPLSAVTGRAEIMDAPTSGLGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQAADDRLGDVRGRGAMIAMELVKSG-TAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIRLLPPLTISDELLSEGLDILCQILAD............... 461
9 -93.1001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  31  4...NDDATFWRNARQHLVRYGG-TFEPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSG-MLSRPVVDLATRLANITPPG-LDRALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSARKGVGPAAVGSFAIPAPFTYRPRFEAYDYLAELDYAFDLIDRQSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDRRTKEPADGLGAKITRECMNLGLSMNQLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA.............. 432
10 -93.0003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  32  21.GPRS-QALIDRKGTAVARGVG-TTMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDFTHTCFMVTPYEGYVAVCEQLNRLTPVRGDKRSALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKVKDGFGPFAPEIYRAPLSYPFRGKELATDGELAAKRAITVIDKIGADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGGLPLSAVTGRAEIMDSPVSGLGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLQAEDDRIGDVRGRGAMIAMELVKAG-TTEPDADLTKALCAGAHAAGVIVLSCGTYGNVVRFLPPLSIGDDLLNEGLDVLEEVLRGA.............. 451
11 -92.3005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  27  12VPQTANDLLARRYATIGPHSPLFYRQPLELVSGSGVWLTDAQGKVYLDGYNN--VPHVGHANPAVADAIYQQLLTVNLHTR--YLNSRVVEYAEALLSKFDGA-LERLFLTNSGSEANELALRIARQHTGNTGVLVSDFSYHGNTTSLAEITTGLTVH-EPLGAHVRALRIPDVSGIAEVPVLLEQSLADVDAAIASLAGHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSMWGYQMFNVEPELVTMGKPMGNGHPIGAVVTTAELLDEFHNMFFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIAQRSGNVGSVRGRGLFFGIDIIESDGSRNPAPALTKILIEDMRERGVLISRVGPHDNVLKMRPPLVFGREHADILLGQLELSLASLPQPGNLVL...... 446
12 -91.5001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  30  2...NSNKELMQRRSQAIPRGVG-QIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPY-SAGMGLMPGHVYRALYPCPLHGISEDDAIASIHRIFKNAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQCFDEAKQ............ 426
13 -89.4005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  22  9....NWEQVKEWDRKYLMRTFSNEYQPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDRYGFVWDT-YATDYKAKAAKIIIEDILGDWPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSFRSGSCSSAVLMAPSSNTFQDSNGENGELLSVKYTRRMIENYGPEQVAAVITEVSQGVGS-TMPPYEYVPQIRKMTKELGVLWISDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSPAGAVVVSKEIAAFMDKHSVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKTNPNQIPTQIIMEKALEKGVLI--GGAMPNTMRIGASLNVSRGDIDKAMDALDYALDYLESGEWQQ....... 475
14 -89.4005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  22  9....NWEQVKEWDRKYLMRTFSNEYQPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDRYGFVWDT-YATDYKAKAAKIIIEDILGDWPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSYRGSSYNSAVLMAPSPNMFQDSDGENGELLSVKYTRRMIENYGPEQVAAVITEVSQGAGS-AMPPYEYIPQIRKMTKELGVLWINDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSPAGAVLVSKEIAAFMDKHSVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKTPPNQIPTQIIMKKALEKGVLIG--GVMPNTMRIGASLNVSRGDIDKAMDALDYALDYLESGEWQALE..... 477
15 -85.6003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  27  7...KQTDELLAKDEQYVWHGMRSPNSTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQTLSYFPMS-QSHEPAIKLAEKLNEWLGGE--YVIFFSNSGSEANETAFKIARQYYHRYKFMSRYRGYHGNTMATMAATGQAQRRYEPFASGFLHVTPPDCYRMPGINIYDVECVKEVDRVMTWELSETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKAFGFMNYDVKPDIITMAKGITSAYPLSATAVKREIYEAFKGKHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGIELVNDKETKEPDNDKIASVVNACKEKGLIIGRNGMYNNILTLAPPLVISSEEIAFVIGTLKTAMERI.............. 452
16 -84.8005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  27  16...TDFDQLFEQDRAHFMHPSTGALPGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKELAYYHTYVHSTEAIIELSSRIIRDWAPAGMKKVYYGLSGSDANETQIKLVRYYNQKKKIISRQRGYHGSGIMTGSLTGLPHQHFDLPVEGIKHTVCPHWYKAPAGAAFVRYCADELEKLILAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFGRLGSKMGSQRYGMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIEKAHGWTYSGHPICAAAALANLDILERENLTANAADVGAYLNQRLRETFEGHPLVGEVRGDGMLAALEFMADREARTPALKVGPKVSAACLEDGMIARA-MPHGDILGFAPPLVLTRAEADEIVGIAKAAVDEVAGEV.......... 472
17 -84.6005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  16...TDTDDLLEMDRAHFRDHASGELPGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKELAYYHTYVHSNEPIIELSERIIREWAPAGMSKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPHNHFDLPLEPIRHTTCPHYYRAPAGAEFSRHCADELEKMILAEGPDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFGRTGSMFGSHHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWKVLEQGHGWTYSGHPICAAAALANLDIIERENLTGNAADTGAYFQQRMRETFGDHPLVGEVRGVGLMAALEFVADKDKRTRSLKVGPRVSAACLEDGMIARA-MPHGDILGFAPPLVITRAEVDEIVDIAKQAVDAVADEL.......... 472
18 -84.6005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  28  16...QSLDQLFEMDRAHFMHPSTGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYVHSTDAIIELSSRIIRDWAPAGMKKVYYGMSGSDANETQIKLVWYYNNKKKIISRERGYHGSGIVTGSLTGLPHQHFDLPIDRVKHTVCPHWYRAPAGAQFVAYCVEELEKLIAREGADTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKMGSQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMADKDARTPALKVGPKVSAAALEDGMIARA-MPHGDILGFAPPLVTTRAEVDEIVGIAKQAVDEVADEV.......... 472
19 -84.5005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  25  16...TDYAKLFEQDRAHFMHPSTGALPGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQLAYYHTYVHASEAIIELSARIIRDWAPAGMKKVYYGLSGSDANETQVKLVRYYNQKKKIISRQRGYHGSGIVTGSLTGLASFHFDLPVEGVKHTLCPHFYKAPAGAAFVRHCAQELENLILAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFGRLGDKMGSQRHAMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIDSAHGWTYSGHPICAAAALANLDILERENITANAADVGGYLNQQLRQAFEGHPLVGEVRGDGMLAALEFMADREARTPALKVGPKVSAACLERGMIARA-MPHGDILGFAPPLVLSRAEADEVVGIAKAAVDAVAAEV.......... 472
20 -84.5005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  29  16...TSLEQLLEMDRAHFMHPSTGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQLAYYHTYVHSNDPVIELSSRIIEDWAPAGMKKVFYGMSGSDANETQIKLVWYYNNKKKIIARERSYHGSGIVTGSLTGLPHQHFDLPIDRVKHTVCPHWYNAPPGAQFVAYCVEELEKLIAREGADTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKTGSEHYGIKPDLITVAKGLTSAYPLSAVIVSEKVWDVIEKGHGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMADKGARTPALKVSQKVAAAALEDGLIVRA-LPHGDILGFAPPLVTTRAEVDEIVAIAKEAFDEVADAV.......... 472
21 -84.5005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  27  16...TDLDQLFEMDRAHFMHPSTGALPGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKELAYYHTYVHSTEAIIELSSRIIRDWAPAGMKKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPHQHFDLPIERIKHTVCPHWYKAPAGAQFVRYCADELEKLILAEGPDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFGRLGSKMGSQHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLRETFGGHPLVGEVRGVGMLAALEFMADKDARTPALKVGPKVSAACLEDGMIARA-MPHGDILGFAPPLVITRAEVDEIVGIAKQAVDEVADEV.......... 472
22 -84.4005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  28  16...TSLDQLFEEDRAHFMHPSTHAHDGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYVHSTDAIIELSSRIIRDWAPAGMKKVYYGMSGSDANETQIKIVWYYNNKKKIISRERGYHGSGIVTGSLTGLPSFHFDLPIDRVKHTVCPHWYKAPAGAQFVAYCVEELEKLIAREGADTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFGRLGSKMGAQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMADKDARTPALKVGPKVSAAALEDGVIARA-MPHGDILGFAPPLVTTRAEVDEIVGIVKQAVDEVADEV.......... 472
23 -83.9005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  23  21...AQTQHWQALSREHHLAPFTDYKQARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLELPYYNLFFTAHPPALELAKAIADIAPEG-MNHVFFTGSGSESNDTVLRMVRHYPQKKVVIGRWNGYHGSTVAGVSLGGMKALHGDLPIPGIVHIAQPYWYGEGGDEEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYPMGGVIVRDEIVDTLNEGHGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQELADHPLVGEARGVGMVGALELVKNKKTRERENGVGMLCREHCFRNGLIMRAVG---DTMIISPPLVITKPEIDELITLARKCLDQTAAVALS........ 468
24 -83.9003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  26  1.GMLKNDQLDQWDRDNFAQHARGESANRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQARELAYYHSYVHGTEASITLAKMILDRAPKN-MSKVYFGLGGSDANETNVKLIWYYNEKKKIISRWRGYHGSGLVTGSLTGLELFHFDLPVEQVIHTEAPYYFRREDEEQFVAHCVAELEALIEREGADTIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTMFGSDHYGLEPDIITIAKGLTSAYPLSGSIVSDKVWKVLEQGHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEALSQHANVGDVRGEGLLCAVEFVKDRDSRTFADKIGPQISAKLLEQDKIIARAMPQGDILGFAPPFCLTRAEADQVVEGTLRAVKAV.............. 456
25 -83.9005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  26  31...ALNREVIEYFKEHVNPGFLGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQE-LLDPLRAMLAKTLAALTPGK-LKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRFMPLLPGFRHVPFGN--------------IEAMRTALNEKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPLVQEARGKGMLMAIEFVDNEIGYN--------FASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAMRQQVA......... 455
26 -83.2003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  24  11....PTAELQALDAAHHLHPFSGEEGTRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRELPYYNTFFTTHVPAIALAQKLAELAPGD-LNHVFFAGGGSEANDTNIRMVRTYPEKTVIISRKNAYHGSTVASSALGGMAMHAQSGLIPDVHHINQPNWWAEGGDEEFGLARARELEEAILELGENRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYPIGGSIVCDEVAHVIGKDHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASRAKFATIGYICRERCFANNLIMRHVG---DRMIISPPLVITPAEIDEMFVRIRKSLDEAQAEIEKQ....... 459
27 -83.0004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  25  390....AREDTLDRYHQYINPMMKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPNIQYISIPEQTAKLAEVLCRLAPGN-MGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSITGRDRRYFTPLLDAMVEVPFGD-----------------LAALREALNREDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLPIGATLCRADLWQKAFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQFDQAFTGAVNASFCMKFVTKLCQDHKILTFITANSSTVIRIQPPLIISKAEIDRFVGAFATVCEELSTFLD......... 853
28 -83.0005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  31  2...GSSYEKYKNAEKKFSSAAPHRDKTLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDELAYYQTFDIAHPRVFDLAERLTGMFAQERMARVLFSSGGSDAVETALKMARQYPGRTRFLSLRNGYHGVHMGGTSVGGNGVYHHGQLLAGCHLLDTPWLYRNPWDQALTAHCIRQLEEQIALLGAQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFGRSGCMLGSRGWGVAPDILCLAKGITAGYPLGATLFNQRIADAIENGHGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLVERYAVVGEVRGKGLMIALDLVSDKRTRQPAAGQPSRIADEARRAGVLVRPIG---NKIILSPPLTLTRDEAGLMVSALEAAFARC.............. 451
29 -82.6004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  23  16...NKPQSWEARAETYSLYGWTHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERFPGYHAAFKMSDQTVMLSEKLVEVSPFD-SGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGATAVSASMTGFPYNSFGLPLPGFVHLTCPHYWRYGEEEQFVARLARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAE-RPNIGEYRGIGFMWALEAVKDKASKTPNLSVSERIANTCTDLGLICFPLG---QSVVLCPPFILTEAQMDEMFDKLEKALDKVFAEVA......... 467
30 -82.6003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  25  4...NQSNELNAWDRDHFGTHARGESPTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHAYVHGTEASITLAKMIIDRAPKG-MSRVYFGLSGSDANETNIKLIWYYNEKKKIISRWRGYHGSGVMTGSLTGLDLFHFDLPRAPVLHTEAPYYFRSMSEEQFSQHCADKLEEMILAEGPETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAKGLTSAYPLSGVIVADRVWQVLVQGHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVADKDDRVFSQKIGPQVATALAASGVIGRA-MPQGDILGFAPPLCLTREQADIVVSKTADAVKSVFANL.......... 460
31 -82.4003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  23  16...NKPQSWEARAETYSLYGFTHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFFRMSDQTVMLSEKLVEVSPFD-SGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSFGLPLPGFVHLTCPHYWRYGEEEQFVARLARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAE-RPNIGEYRGIGFMWALEAVKDKASKTPNLSVSERIANTCTDLGLICRPLG---QSVVLCPPFILTEAQMDEMFDKLEKALDKVFAEVAAA....... 469
32 -82.4004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  23  16...NKPQSWEARAETYSLYGFTHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFFRMSDQTVMLSEKLVEVSPFD-SGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSFGLPLPGFVHLTCPHYWRYGEEEQFVARLARELEETIQREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAE-RPNIGEYRGIGFMWALEAVKDKASKTPNLSVSERIANTCTDLGLICRPLG---QSVVLCPPFILTEAQMDEMFDKLEKALDKVFAEVA......... 467
33 -82.4004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  25  33...ALNREVIEYFKEHVNPGFGGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQE-LLDPLRAMLAKTLAALTPGK-LKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRFMPLLPGFRHVPFGN--------------IEAMRTALNEKTGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPLVQEARGKGMLMAIEFVDNEIGYN--------FASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAMRVSVEEALE..... 461
34 -82.3004grx_A mol:protein length:465 Aminotransferase  ali model follow..  23  14...NQPQSWEARAETYSLYGFTHQRGTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRFPGYHAFFRMSDQTVMLSEKLVEVSPFD-NGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSFGLPLPGFIHLTCPHYWRYGEEAQFVARLARELEDTITREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFGRTGNTWGCLTYDFMPDAIISSKNLTAGFPMGAVILGPDLAKRVEAAHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKRIAD-RPNIGEYRGIGFMWALEAVKDKPTKTPNLSVSERIANTCTDLGLICRPLG---QSIVLCPPFILTEAQMDEMFEKLEKALDKVFAEVA......... 465
35 -81.7004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  24  5...RTTSQWRELDAAHHLHPFTNQAGARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFFTTHPAVVELSSLLAEVTPAG-FDRVFYTNSGSESVDTMIRMVRRYPEKKTLIGRWNGYHGSTIGGASLGGMKYMHGDLPIPGMAHIEQPWWYKHGKDDEFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYPIGAVFVGKRVAEGLIAGHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKRELFGEIGTLCRDIFFRNNLIMRACG---DHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLKAR....... 456
36 -81.5002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  28  2....LSRKIIEESDIYLATSTDPELFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAAANDFYNIPQLELAKKLVTYSPGNFQKKVFFSNSGTEAIEASIKVVKN-TGRKYIIAFLGGFHGRTFGSISLTASKRSIVGPFMPGVIHVPYPNPYRNPWHSELVNRVIEFIEDYINLVPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGMPIGATIFRKDLDFK-PGMHSNTFGGNALACAIGSKVIDIV--KDLLPHVNEIGKIFAEELQGL------ADDVRGIGLAWGLEYNEKKVRDR--------IIGESFKRGLLLLPAG--RSAIRVIPPLVISEEEAKQGLDILKKVIKVVK............. 419
37 -81.5003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  27  9...NAAGAVGAAMRDHILLPAQEMAKQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYASPWYMATSPAARLAEKIATLTPGD-LNRIFFTTGGSTAVDSALRFSEFYPQKKRIIVRYDGYHGSTALTAACTGRTGNWFDIAQDRISFLSSPNPRHAGNQEAFLDDLVQEFEDRIESLGPDTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKFGVVPDIITFAKGVTSGYPLGGLAISEAVLARISGENGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASLRD-LPGVAETRSVGLVGCVQCLLDPTRADGDKAFTLKIDERCFELGLIVRPLG---DLCVISPPLIISRAQIDEMVAIMRQAITEVSAAHGLTAKEPA.. 466
38 -81.3005ghf_A mol:protein length:456 Aminotransferase class-III  ali model follow..  27  3...AQPNSLEARDIRYHLHSYTEAEGPLVIERGDGIYVEDVSGKRYIEAMSGLWSVGVGFSEPRLAEAAARQMKKLPFYHTFSRSHGPVIDLAEKLVSMAPVP-MSKAYFTNSGSEANDTVVKLIWYRPERKKIISRKRGYHGVTIASASLTGLPNNHFDLPIDRILHTGCPHFYREGQAEQFATRLADELEQLIIAEGPHTIAAFIGEPVMGAGGVVVPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNLFGSQTFDMKPDILVMSKQLSSSYPISAFLINERVYAPIAEETGFTASGHPVAAAVALENLAIIEERDLVANARDRGTYMQKRLRELQD-HPLVGEVRGVGLIAGVELVTDKQAKTGTGALGAKANAVLQERGVISRAMG---DTLAFCPPLIINDQQVDTMVSALEATLNDVQASLTR........ 456
39 -81.0004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  22  22....APSAAADLNLKAHSANRNFHKDPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGTLDYSPGFQYGHPLSFQLAEKIAQMTPGT-LDHVFFTGSGSECADTSIKMARAYAQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMGPLMDVDHLPHTLQPGMAFTETGGVELANELLKLIELHDASNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFGRMGKATGAEYFGVTPDIMNVAKQVTNGAPMGAVIASSEIYDTFMNQHGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGLKG-TKNVIDIRNCGLAGAIQIAARDGDAIVRPF---EASMKLWKEGFYVRFGG---DTLQFGPTFNAKPEDLDRLFDAVGEALNGVA............. 462
40 -80.6003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  23  6...AGASLASQLKLDAHTANRNFLRDPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLSTLDYSPGFQYGHPLSFQLAEKITDLTPGN-LNHVFFTDSGSECALTAVKMVRAYATKTKMIGRARGYHGVNIAGTSLGGVNGNRFGQPMQDVDHLPHTLLASNAYSKEGGIALADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAPMGAVIASTEIYQTFMNQHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGIKG-AKNVIDIRNFGLAGAIQIAPRDGDAIVRPF---EAGMALWKAGFYVRFGG---DTLQFGPTFNSKPQDLDRLFDAVGEVLNKL.............. 447
41 -80.2004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  22  8....APPVSSELNLRAHSANRNFQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIAGLLPGE-LNHVFFTGSGSECADTSIKMARAYPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMGQLMDVDHLPHTLQPGMAFTQTGGVELANELLKLIELHDASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAPMGAVIASSEIYDTFMNQHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQG-AKNVIDIRNCGLAGAIQIAPRDGDPTVRPF---EAGMKLWQQGFYVRFGG---DTLQFGPTFNARPEELDRLFDAVGEALNGIA............. 448
42 -79.2005dds_A mol:protein length:523 CrmG  ali model follow..  20  2...THPSGEPVYADAVLNGWLTSMGLGVEYVRAEGNTVYDDEGREVLDHACGFGSLIFGHNHPEIIAHAKAALDAGTVVHAQLSRQPRANQISRILNDIMRRDDRYNAIFANSGAEANEICMKHAELEAERPLFLTLDGSFHGKLVGSIQLTQNEPWRFTALSSPARFLPADEPELIGKDERRSVLTLSLDKDTVRERDFPVVAAIFVEPVRGGSGMKTVTPELAEELHRLRDTLGCPLVVDEVQTGIGRTGAFFGSALLGIRGDYYTLAKAIGGGIVKSVALIRQDRFLPAEVIHSSTFAKDGLSASIALKVLEMVEADRVYQRVRERGQRLEAMLESVRADHSVVSAVWGTGLMLALELRDQSNATSQAIREYVLAGFLLREHHIRVLPAGPRSGFLRFSPSLYITDEEIDRTETALRSLFTALRDQDGDRL...... 520
43 -78.3003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  28  7.....................RSSKPYPVAVRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHGSQFSSDVLEEYAGRLARFVGLP-TFRFWAVSGGSEATESAVKLARQYPGRFKVITRVPSYHGASLGSLAASGMGARRYTPLMRPEAWPKLPKPDPA----RNGAEDAEGLRALLEREGPETVAAFMAEPVVGADAALAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIAVLGKGLAAGYPLAGLLAAPQVYETVMGGHGFTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALQARFPQMMQVRGTGLLLGVVLG-DLATGQATPGIASRIGAAALKRGLITYPGNGRGDHLLLGPPLSITAAEVDGLLALLAGALEDV.............. 428
44 -78.3003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  27  2.....THDLIEKSKKHLTQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHSTLLGMTNVPATQLAETLIDISPKK-LTRVFYSDSGAEAMEIALKMAFQYPEKQKFIAMKNGYHGDTIGAVSVGSIELFHYGPLMFESYKAPIPYVYRSESGDECRDQCLRELAQLLEE-HHEEIAALSIESVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFYDDHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHA-LPHVGDIRQLGFMCGAELVRSKETKEPDRRIGYKVSLKMRELGMLTRPLG---DVIAFLPPLASTAEELSEMVAIMKQAIHEVTSLED......... 448
45 -78.1004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  26  32...KTEEDFFACDRQYVCQ--NYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRA-FGNDVTGPACRFMAEMFGYD---RVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFYNNFGPFTPGFELIDYDD-----------------VGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREYGKVPWIKEIRGRGLLNAVEVDSDAID-------PNDVVMKLKENGILSKPTR--GRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEERKK........ 441
46 -78.0001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  24  21...KTPEDYINNELKYGAH--NYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRA-FFSVPLGICERYLTNLLGYD---KVLMMNTGAEANETAYKLCRKWENMAKIVVCKNNFSGRTLGCISASTTKTSNFGPFAPQFSKVPYDD-----------------LEALEEELKDPNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIPGEHGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVN-------VLDICLKLKENGLITRDVH--DKTIRLTPPLCITKEQLDECTEIIVKTVKFFDERF.......... 427
47 -78.0001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  22  24.GPRSRELMKQLNIIQNA---EAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALGILPPENFVEKLRESLAPKGMSQLITMACGSCSNENAFKTIFMWCPDYSILSFMGAFHGRTMGCLATTHSKKIDIPSFDWPIAPFPRLKYPLEEFNQQEEARCLEEVEDLIVRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLPADVMTFSKKMMTGGFFHKEEFRPNA----PYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPFISRVRGRGTFCSFDTPDESIRNK--------LISIARNKGVMLGGCG--DKSIRFRPTLVFRDHHAHLFLNIFSDILADFK............. 472
48 -77.9004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  27  13...EQTAITRATFDEVILP--VYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNV-FTNEPALRLGRKLIDATFAE---RVLFMNSGTEANETAFKLARHYPFKTKIIAFHNAFHGRSLFTVSVGGQPSDGFGPKPADIIHVPFNDL------------------HAVKAVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFVGSHGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGR------ARDFLYAGAEAGVMVLNAG--ADVMRFAPSLVVEEADIHEGMQRFAQAVGKVVAL........... 415
49 -77.8006erk_A mol:protein length:451 Aminotransferase  ali model follow..  21  12QGHMTTVSTNDFDQQHL-ASLPPTYPNIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGKMAHVMFGGLTHQPAIDLGKKLLSIVPAG-LDAIFYADSGSIAVEVALKMALQYPSKCQFASTHSGYYGDTWHAMSVCDPIHSLYGKQLPMQHFVAAPPMGF----ERDLTQSEREALTEFFVKNSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFGRSGKLFACEHAAISPDIMTIGKALTGGYTFAATLSTREIADTISQSHGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPAVS-LEGVKEVRCLGAVAVIELNEAVDMPI--------FQTLLINNGIWVRPFG---KLVYIMPPYVITDDELTTLCQALLKVVSSYLTRKD......... 445
50 -77.6002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  21  14..PTTPDRVHEVLGRSMLV--DGLDIVLDLTRSGGSYLVDITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKDVYSVAMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHQVLHLRGAFHGRSGYTLSLTNTKPTIFPKFDWPRIDAPYMRPGLDEPAMAALEAEALRQARAAFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCVMAGRRVDEVADNVFAPSRLNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPVVLDPRGRGLMCAFSLPTTADRDE--------LIRQLWQRAVIVLPAG--ADTVRFRPPLTVSTAEIDAAIAAVRSALPVVT............. 449
51 -77.4001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  26  37..PPTSDDIFEREYKYGAH--NYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRA-FYNNVLGEYEEYITKLFNYH---KVLPMNTGVEAGETACKLARKWKYKAKIVFAAGNFWGRTLSAISSSTDPYDGFGPFMPGFDIIPYND-----------------LPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLPVSAVLCDDDIMLTIPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKL--PSDVVTAVRGKGLLNAIVIKETKDWD------AWKVCLRLRDNGLLAKPTH--GDIIRFAPPLVIKEDELRESIEIINKTILSF.............. 439
52 -77.4004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  26  17...KTEEDFFACDRQYVCQ--NYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRA-FGNDVTGPACRFMAEMFGYD---RVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFYNNFGPFTPGFELIDYDD-----------------VGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREYGKVPWIKEIRGRGLLNAVEVDSDAID-------PNDVVMKLKENGILSKPTR--GRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEERKK........ 426
53 -77.2004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  26  2....SQPITRENFDEWMIP--VYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNG-YTNEPVLRLAKKLIDATFAD---RVFFCNSGAEANEAALKLARKFSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSFAPLPADIRHAAYNDI------------------NSASALIDDSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQ------AKQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVTTGLDRFAAACEHFVSRGSS........ 406
54 -77.2003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  22  8...KSSQDYMNNELTYGAH--NYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRA-FFSDSLGVCERYLTNLFGYD---KVLMMNTGAEASETAYKLCRKWENSAKIIVCNNNFSGRTLGCVSASTDKKNNFGPFVPNFLKVPYDD-----------------LEALEKELQDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGYPISAILANDDVMLVLPGEHGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVN-------VWDICLKFKENGLITRSVH--DKTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNLLQ........ 416
55 -77.0001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  28  7...EDWRALLEAEKTLDSG--VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT-LPTPMRGEFYRTLTAILPPE-LNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYRFLPLVEPVEFIPYNDV------------------EALKRAVDEETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPK--IREVRGMGLMVGLELKEK---------AAPYIARLEKEHRVLALQAG--PTVIRFLPPLVIEKEDLERVVEAVRAVLA................ 395
56 -76.9005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  29  7...KNSEYFIELEEKHGAH--NYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRA-FYNSKLGEYEQKITSLLGFD---KVLPMNSGAEAVETAVKLARKWENAAKIIVCENNFHGRTTTIVSFSNDPNQNYGPFTPGFIRIPYND--------------IAALEEVLSK-EAGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKLIACHHEDVQPDILILGKALSGGMPVSAVLANNNIMDVIPGQHGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLIEKTDLITKVRGKGLLNAILINDTPDSST-----AWNLCLALKENGLLAKPTH--GNIIRLAPPLVITEEQLLDCVKIIEKTILEF.............. 413
57 -76.7004a0f_A mol:protein length:831 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  20  323...ERLNGMAKLAGEVFQHKLVHQETVTVIDSRCGENFSNSSLSQQFDACASWWTQGPDPTFAELAREMGYTAARFGHVMFPENVYEPALKCAELLLDGVGKGWASRVYFSDNGSTAIEIALKMAFRKHIVVKVIALRGSYHGDTLGAMEAQAPSPYTQQPWYTGRGLFLDPPTVFLSNGRIYSAYLSKHLQEHSGVRQSAHVGALIIEPVHGAGGMHMVDPLFQRVLVNECRNRKIPVIFDEVFTGFWRLGVETTTELLGCKPDIACFAKLLTGGMPLAVTLATDAVFDSFSGDHGHSYSAHAMGCATAAKAIQWFKDPETNHNITSQGKTLREELVQQISSHSAVQRVVVIGTLFALELKADASNSGYASLYAKSLLIMLREDGIFTRPLG---NVIYLMCGPCTSPEICRRLLTKLYKRLGEFNRT........... 825
58 -76.5002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  27  1........MGSDKIMYLMN--TYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNL-FWNRPQMELAELLSKNTFGG---KVFFANTGTEANEAAIKIARKYGKKYRILSAHNSFHGRTLGSLTATGQPKYQFEPLVPGFEYFEFNNV------------------EDLRRKMSEDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSNRE--------VATKCFENKLLVVPAG--NNTIRFLPPLTVEYGEIDLAVETLKKVLQGI.............. 391
59 -76.5001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  25  2.....TTDDLAFDQRHI-TSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQP-LECVFLADSGSVAVEVAMKMALQYEARQRFLTFRNGYHGDTFGAMSVCDPDHSLWKGYLPENLFAPAPQSRMD---GEWDERDMVGFARLMAA-HRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTTLSATLTTREVAETISNGHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARD-AEMVADVRVLGAIGVVETTHPVNMAA--------LQKFFVEQGVWIAPFG---KLIYLMPPYIILPQQLQRLTAAVNRAVQDETFFCQ......... 429
60 -76.3001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  25  2.....TTDDLAFDERHI-TSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGEITHAPAIELCRKLVAMTPQP-LECVFLADSGSVAVEVAMKMALQYEARDRFLTFRNGYHGDTFGAMSVCDPDHSLWKGYLPENLFAPAPQSRMD---GEWDERDMVGFARLMAA-HRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTTLSATLTTREVAETISDGHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARD-AEMVADVRVLGAIGVVETTHPVNMAA--------LQKFFVEQGVWIRPFG---KLIYLMPPYIILPQQLQRLTAAVNRAVQDETFFCQ......... 429
61 -76.2005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  25  2...GMTTDDLAFDRRHI-TSMTSPLPVFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDAMSHVMFGGITHAPAIELCRKLVAMTPAP-LECVFLADSGSVAVEVAMKMALQYESRQRFLTFRNGYHGDTFGAMSVCDPHHSLWKGYLAENLFAPAPQSRMGGEWDERDMVAF----ARLMAAHRHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRLFACEHAGIAPDILCLGKALTGGTTLSATLTSRQVAETISNGHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPAAD-SPQVADVRVLGAIGVVETTRPVNIAA--------LQQFFVRQGVWVRPFG---KLIYLMPPYIIQPEQLRRLTQAVNEAVREETF............ 428
62 -76.0003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  23  28....TPEQIIAVDGAHLSSIGREAVSPVVAVAAHGAWLTDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAG-LDTVFFSDSGSVSVEVAAKMALQYPGKRRLMTWRGGYHGDTFLAMSICDPHHSLWTDVLAAQVFAPQVPRD-------YDPAYSAAFEAQLAQ-HAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYSLAATLCTADVAHTISAGRGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARA-LPAVTDVRVCGAIGVIECDRPVDLAV--------ATPAALDRGVWLRPFR---NLVYAMPPYICTPAEITQITSAMVEVARLVGS............ 454
63 -75.6003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  23  23....TPEQIIAVDGAHLSSIGREAVSPVVAVAAHGAWLTDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAG-LDTVFFSDSGSVSVEVAAKMALQYPGKRRLMTWRGGYHGDTFLAMSICDPHHSLWTDVLAAQVFAPQVP-------RDYDPAYSAAFEAQLAQ-HAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYSLAATLCTADVAHTISAGHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARA-LPAVTDVRVCGAIGVIECDRPVDLAV--------ATPAALDRGVWLRPFR---NLVYAMPPYICTPAEITQITSAMVEVARLVGS............ 449
64 -75.5003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  22  2.......KMDYKEQSHIIP--TYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSNL-YYNENIAAAAKNLAKASALE---RVFFTNSGTESIEGAMKTARKYAKGGQFIAFKHSFHGRTLGALSLTANEKYQFKPLISGVKFAKYNDI------------------SSVEKLVNEKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSAGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKSVKVAK--------VIQKCQENALLLISCG--ENDLRFLPPLILQKEHIDEMSEKLRKALKSF.............. 395
65 -74.0002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  28  6.....................NYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSNL-YENPWQEELAHKLVKHFWTE--GKVFFANSGTESVEAAIKLARKYKNKWKFISFENSFHGRTYGSLSATGQPKFHFEPLVPGFSYAKLNDI------------------DSVYKLLDEETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFPGSHGSTFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELG-----KGKVKGRGLMLGLELERE----------CKDYVLKALEKGLLINCTA--GKVLRFLPPLIIQKEHIDRAISVLREIL................. 375
66 -73.9003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  26  1......KDIIELTDTYGAN--NYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRA-FHSDQLGPWYEKVAKLTNKE---MVLPMNTGAEAVETAIKTARRWANRAEIIVCEDNFHGRTMGAVSMSSNEKRGFGPMLPGIIVIPYGDL------------------EALKAAITPNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGFPISCAAANRDILGVFPGSHGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEP----------ARPYCEQLKAAGLLCKETH--ENVIRIAPPLVISEEDLEWAFQKIKAVLS................ 392
67 -53.7003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  24  6...TKSEALHKEALEHIVGGVNSPGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAEN---GVLYGTPTALEVKFAKMLKEAMPA--LDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGPDSAGVPQSIAQEVITVPFNN------VETLKEALDK-WGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAF-RFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTE-----TKEDIEYTIEAVGRAFAALADN........... 433
68 -53.6006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  23  12...EGSVFWAQRARSVMPDTRVFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSH---GVQYAASHPLEVRWAERIVAAFPS--IRKLRFTGSGTETTLLALRVARAFTGRRMILRIATHYHGWHDFSASGYNSHFD--GQPAPGVLPEIAKNTLLIRPDD------IEGMREVFAQ-HGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPAEVARPDVKMIAAMRMALILEGVDIGGRG------SVFLSAQHEREHVEHLVTTFDRVLDRLADE........... 438
69 -53.6002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  24  12...EGSVFWAQRARSVMPDGVTFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSH---GVQYAASHPLEVRWAERIVAAFPS--IRKLRFTGSGTETTLLALRVARAFTGRRMILRFEGHYHGWHDFSASGYNSHFD--GQPAPGVLPETTANTLLIRPDD------IEGMREVFAN-HGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPAEVARPDVKMIAAMRMALILEGVDIGGRG------SVFLSAQHEREHVEHLVTTFDRVLDRLADE........... 438
70 -53.4005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  22  4...SRSETLFNNAQKHIPGGVNSPVTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDH---GLSYGAPTALEVEMADLVCSMVPS--MEMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLLVKAGSGALTFGPNSPGVPAAFAKHTLTLPFND------IEAVRKTLGE-VGKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLQAGTLSGNPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAAGIPFVTTQAGGMFGLYFSGAEDVMASDVERFKRFFHLMLDGGVYLAPSAFEAGFTSIA-----GDKELEITLNAAEKAFAALK............. 429
71 -53.3004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  23  5...SKSENLYAQAQQLIPGGVNSPVIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVER---GLSFGAPTEMEVKMAQLVTDLVPT--MDMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGPNSPGVPTDFAKHTLTCTYND------LASVRQAFEQ-YPQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGF-RVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTQAGTLSGNPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFTNAQDVMNCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSLA-----SNEDIQKTVNAARRCFAKL.............. 429
72 -53.2002epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  23  10...EKSRMLFERTKELFPGGVNVKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAVEEALAR---GWLYGAPGEAEVLLAEKILGYVKR--GGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGPTSAGVPEAVARLTLVTPYND------VEALERVFAE-YGDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGF-RLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQNAGTFNAHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFIGVEAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLP-----QGEALEIAVEGLRSSLKTVLGS........... 434
73 -53.2002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  24  9...IKSDEIFAAAQKLMPGGVSSPVQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEK---GTSFGAPCALENVLAEMVNDAVPS--IEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGPSSPGVPKKTTANTLTTPYND------LEAVKALFAE-NPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLA-----TEEDIDATLAAARTVMSAL.............. 432
74 -53.0005hdm_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic  ali model follow..  19  11...QKSEEAFNAAKNLMPGGVNSPVQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKK---GTSFGAPCLLENVLAEMVISAVPS--IEMVRFVNSGTEACMGVLRLARAFTNKEKFIKFEGCYHGHANAFLVKAGSGVATLGPDSPGVPKAATSDTLTAPYND------LEAVEKLFAA-HKGEISAVILEPVVGNSGFIPPTPEFINGLRQLTKDNGVLLIFDEVMTGF-RLAYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAQAGTLSGNPLAMTAGIHTLKRLKQAGTYEYLDKITKELTNGILEAGKKTGHPMCGGYISGMFGFFFAEGADSKKSDTEKFGRFFRGMLEEGVYFAPSQFEAGFTSLA-----TPEDIQLTIAAAERVLSRI.............. 434
75 -53.0004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  22  23...PTNAESLDGIKSVIAGGVSSSMLPLVVRSAGGCLLRDVEDGEIIDLNMGYGPHLFGYADREVLDAVADQFAK---GHMTGLPHELDARAGALIAELVPG--VEQVRFANSGTEAVASALRLARATTGRTLVVTFEGHYHGAGKTALHMEGTRPTDVVPGALGMIPEALAHTVQLGWND------PDALRELFAR-DGDRIAAVIVEPVLANAGVIPPAPGFLQLLRELTGRSGAMLVFDEVITGF-RVARGGAQERYGVEPDLTVLSKVMGGGFPVAAFGGRRHAMRMLASNHAGVYAGNHAALRAVVAMLGKIRSLDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMSVALLKGQLAALVDFPRHRRLQTLAQKEGVYFHPNALEPWFLSTA-----TRDVIDKVAGALQRSLVGLG............. 458

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.