current user: public

If you have questions about the server, please let us know.

Query: 5ohe_A mol:protein length:161 Globin-coupled histidine kinase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst GTGVPETVFEELKRYVGWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALVGGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHGDPPELERVRNALGKVLDLELAVMLHTYREDLLast
1 -74.5005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model  100  1GTGVPETVFEELKRYVGWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALVGGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHGDPPELERVRNALGKVLDLELAVMLHTYREDL 161
2 -64.4002w31_A mol:protein length:162 GLOBIN  ali model follow..  34  2......LTMQEIKAHYRFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFL-KEDLVLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFP-DPEERRQRREAVEKILDINLDIMSASYREE. 153
3 -63.4001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  21  27.LTNKHADVKKQLKMVRLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDII-NDHSSVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASIT-NQQELLKAIKATTKILNLEQQLVLE...... 178
4 -60.4002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  16  18.APFNLEDLKLLKEAVMFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTSNEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVESVPNIGYRYLVAFIYPITATPEEVEKMYQAWFKATTLQVALWSYPYVKY. 192
5 -57.5004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  15  1.MKPSPEILALRWKDT-SAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFL-SDQLVKTKLHASMQDWLESVYAAAPTEEYVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASLSAAQAAATCRYVADVTMTAVEMMSHAYSVS. 160
6 -55.2004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  19  1.MEMYFKRMKDEWTGL-VEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFL-SNEQVERQLKSAMERWIINVLSAQVDERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSS-DYSAAEKLQVYHFSINSIDIAMEVMTRAFLE.. 157
7 -53.5004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  19  1......GAMKDEWTGL-VEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFL-SNEQVERQLKSAMERWIINVLSAQVDERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSS-DYSAAEKLQVYHFSINSIDIAMEVMTRAFTFS. 153
8 -52.4004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  20  46.....SPEQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFL-THEQVKSRLHGTLRQWIVSVFSMSDDDALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQR-PLDPEHKLFGQRLISETVDLAMEIMSRAFSDA. 202
9 -18.8002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  11  1.................MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENENMRSFVDKVAITHVNLGVKEEHY----PIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK.. 140
10 -18.0001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  12  1...............VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEAPAAKDLFSFLANGVDPTNPKLTGHAEKLFAL--ASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAEVAYDELAAAI............... 140
11 -17.0001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  10  2.................LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPAILPAVKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDILDA---GKAYGVIADVFIQVEADLYAQA. 144
12 -16.6002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  11  1.................MSSETVTLYEAIGG--DATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAM-----DETIENAKLREIIWAPVERL................ 121
13 -16.3003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  12  1.................MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDEPKVRPLFKIDEKQGRKLMDVLNWIVLNLQD----DAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIE............ 131
14 -16.3004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  16  31.................................EAGALAIANRFYDIMATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTL-----DLEVDNPLLREGLKQSFGQL................ 137
15 -16.1004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  13  33.................................LQTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQRMGGP--PLYSQRHPALIGRHRPFPVTHQ----AAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHT................ 140
16 -15.5003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  10  2.................IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEPTVSVLFQNPSSQSRKLMQVLGILVQGIDN----EGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAATKVYGIAAQVM............... 130
17 -14.9003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  10  1........MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEAPSAKNLFSYLKDSPIPLEQMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKN------AWGEAYDQLVAAIKSEMKPS. 160
18 -14.8001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  2................ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEAPAAKDLFSFLKGTSEVPQNNLQAHAGKVFKL---VVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNS------AWTIAYDELAIVIKKEMDDA. 152
19 -14.7001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  13  12...............VSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEAPSASQMFSFLRNSDVPLEKMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHF----EVVKFALLDTIKEEVPADM--SPAMKSAWSEAYDHLVAAIKQEMKPA. 165
20 -14.5003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  7...............IVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEAPTTKKMFSFLRDSPIPAEQMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEMKV------AWGQAYDHLVAAIKAEMNLS. 159
21 -14.5002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  15  1........MSAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEAPSARQMFPFLRDSDVPLETMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHF----EVTRFALLETIKEALPADM--GPEMRNAWGEAYDQLVAAIKQEMKPA. 161
22 -14.5001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  11  9.............SVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHDPTAQRKFLRTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQ------VHDAWAKTFAIVQGVLITKH.... 157
23 -14.4005v3t_A mol:protein length:132 Globin  ali model follow..  11  1.................MSKQPMTPFEAIGG--EQCIEILVDTFYSYVSKHPDLSPIFPDD---LTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAM-----DDTGVHGHIREFVFERLALT................ 118
24 -14.4002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  3................HMERPESELIRQSWRVVSRSPLEHGTVLFARLFAEPSLLPLFSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRT------AWSRLYGAVVQAMSRGWDGE. 154
25 -14.4001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  13  12.................................AKTFDAIVSRFYAQVAEDEVLRRVY--PEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF......... 128
26 -14.4002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  13  11...............VVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEAPSAKQMFSFLRDSDVPLEKMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHF----EVTGFALLETIKEALPADM--SLEMKKAWAEAYSQLVAAIKREMKPD. 164
27 -14.3001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  10  1...............VKLSEDQEHYIKGVWKDVDH--KQITAKALERVFVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRA---KKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHA------AAYKFFRLVAEALSSNY.... 140
28 -14.3003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  11  1........MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEAPSAKNLFSYLKDSPVPLEQMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPEMKN------AWGVAYDQLVAAIKFEMKPS. 160
29 -14.2001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  1.................MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLSLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPATRA------AWSQLYGAVVQAMSRGWDGE. 151
30 -14.2003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  12  2...............SGLTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKYPDTLTPFMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLKMAKLHFNRGIRIKEL----RDGYGVLLRYLEDHCHVEGS----TKNAWEDFIAYICRVQGDFMKERL 152
31 -14.2002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  1.................MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNFPSNLEKFPFRDVPLEELSGVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESY--------NQLKGVILDVLTAASSLDESQAATWAKLVDHVYAIIFKAIDDD. 149
32 -14.2002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  1..............XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKHPETLTPFLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIKMAKLHNNRGIRASDL--------RTAYDILIHYMEDHNHMVGGAKDAWEVFVGFICKTLGDYMKE.. 150
33 -14.2004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  1.................MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLSLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRA------AWSQLYGAVVQAMSRGWDGE. 151
34 -14.1001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  12  52.................................REAVEAAVDKFYNKIVADPTVSTYF--SNTDMKVQRSKQFAFLAYALGGA--SEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTL-----TELGVPPEDITDAMAVVAST................ 154
35 -14.0001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  11  12................DLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFADPSAQNKFLRSSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRD------AWAKAFSVVQAVLLVKH.... 157
36 -13.7004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  2.................LAEKTRSIIKATVPVLEQQGTVITRTFYKNMTEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDDSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAWGEAYQAIADIFITVE.......... 137
37 -13.6004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  1.......XVDAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTRPDTKTYFGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAAALVGVVQAAL............... 150
38 -13.5004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  15  43.................................EETFTRLARRFFEGVAADPVLRPMF--PEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAV-----DDLALPAHLEQQLWEYLVYA................ 147
39 -13.5004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  7...............MQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMENPETFQIFMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEAKWSE-----EKKEAWLKAYGIITVMVTE...... 154
40 -13.4004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  12  1.....XSRVAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKSPSAKGKFGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAAASLVAVVQAAL............... 152
41 -13.4005d1v_A mol:protein length:127 Globin  ali model follow..  15  13.................................EATFRRIVDIFYARVEADPRLRHLFPAD---LEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAAL-----NEAGVPEPARSVMENYFRHA................ 116
42 -13.3002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  16  10.................................EETFTRLARRFYEGVAADPVLRPMY--PEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAV-----DDLALPAHLEQQLWEYLVYA................ 114
43 -13.2001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  13  2.................LDAQTIATVKATIPLLVETGPKLTAHFYDRMTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENPALLPAVEKIAQKHTSFQIKPEQY----NIVGEHLLATLDEMFSPGQEVLDAWGKAYGVLANVFINREAEIYNEN. 142
44 -13.2001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  17  22.................................HEAIEVVVEDFYVRVLADDQLSAFF--SGTNMSRLKGKQVEFFAAALGGP--EPYTGAPMK--QVHQGRGITMHHFSLVAGHLADAL-----TAAGVPSETITEILGVIAPL................ 122
45 -13.1002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  16  22.................................HEAIEVVVEDFFVRVLADDQLSAFF--SGTNMSRLKGKVVEFFAAALGGP--EPYTGAPMK--QVHQGRGITMHHFSLVAGHLADAL-----TAAGVPSETITEILGVIAPL................ 122
46 -13.1002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  17  13.................................EETVAKLVEAFYRRVAAHPDLRPIFPDD---LTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAM-----DEIGLSGPAREQFYHRLVLT................ 116
47 -13.1001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  1...............XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEFPDSANFFIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLQFAKEHVGFGVGSAQF----ENVRSMFPGFVASVAAPPAG----ADAAWTKLFGLIIDALKAAG.... 146
48 -13.1001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  12  14.................................EELLSQLVDTFYERVASHPLLKPIFPSD---LTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAM-----DHVGLEGEIREFLFGRLELT................ 117
49 -13.0001spg_A mol:protein length:144 HEMOGLOBIN  ali model follow..  1...............XSLSATDKARVKALWDKIEGKSAELGAEALGRMLVFPQTKIYFSEWGQDLGPQTPQVRNHGAVIMAA---DNLVGGLSQLSELHAFLRVDPANFKILAHNIILVISMYFPGDFTPEVHL------SVDKFLACLALALSEKY.... 143
50 -13.0004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  14  60.................................EELLRKLVEVHHENLMK-SKIHYLFPTSHEQLRSLVKRSADFVVEMCGGP--PYYTLTRPKMRARHFSVTIDEKAREIWLACYKHAL-----KDVHFPLSVLEEFWQWIESF................ 165
51 -12.9001cqx_A mol:protein length:403 FLAVOHEMOPROTEIN  ali model follow..  2.................LTQKTKDIVKATAPVLAEHGYDIIKCFYQRMEAHPELKNVFNMAHQEQGQQQQALARAVYAYAENIEDNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLMGME.......... 137
52 -12.9002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  1.................MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKYPHNLNHFPW-KTHGTRILRQVDEGVKALSVDFGDKKFDDVWKKLAQTHHEKKVERRSY----NELKDIIIEVVCSCVKLNEK----QVHAYHKFFDRAYDIAFAEMAKM. 150
53 -12.7002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  1...............XSLSAKDKANVKAIWGKILPKSDEIGEQALSRMLVVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQ---DDLFGFLTKLSELHAKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHL------SVDKFLQQLALALAEKY.... 142
54 -12.7003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  14  14.................................ENAMKAAVPLFYKKVLADERVKHFF--KNTDMDHQTKQQTDFLTMLLGGP--NHYKGKNMT--EAHKGMNLQNLHFDAIIENLAATL-----KELGVTDAVINEAAKVIEHT................ 114
55 -12.6001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  1................SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEFPDSANFFIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLQFAKEHVGFGVGSAQF----ENVRSMFPGFVASVAAPPAG----ADAAWTKLFGLIIDALKAAG.... 145
56 -12.6003pmc_A mol:protein length:139 Uncharacterized protein pXO2-61/BXB0075/GBAA_pXO2_0075  ali model follow..  11  1..................GSHMEEIKCLLCRYLKERQEKFISDWKKKVIIRERDPY----KEEIIKNGEHLLSAFIMYLKEEISLQEIEITSKKIARERIDAKVNIAEFIHNTNVAKIEIMNIL-TLLNPDLQQYQALVKKINQFFDHLIYYTVHSYYE.. 136
57 -12.4001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  1................AFTACEKQTIGKIAQVLAKSPEAYGAECLARLFVHPGSKSYFEYDYSAAGAKVQVHGGKVIRAVVKAAEDDLHSHLETLALTHGKLLVDPQNF----PMLSECIIVTLATHLTEFSPDTHC---AVDKLLSAICQELSSRY.... 139
58 -12.4001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  18  9.................................QAAVQAVTAQFYANIQADATVATFF--NGIDMPNQTNKTAAFLCAALGGP--NAWTGRNLK--EVHANMGVSNAQFTTVIGHLRSAL-----TGAGVAAALVEQTVAVAETVRGDVVTV......... 116
59 -12.4004esa_A mol:protein length:143 Hemoglobin alpha chain  ali model follow..  1...............XSLSDKDKAAVKLLWSKISKSSDAIGNDALSRMIVVYPQTKTYFAHWPDLSPGSPHVKAHGKTVMGGKIDDLRAGLLDLSEQHAYKLRVDPANFKILSHCILVVISMMFPKEFTPEAHV------SLDKFLSGVSLALSERY.... 142
60 -12.4002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  12  2.................LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFFDLSHGSAQVKAHGKKVADGLTLAVGHDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHA------SLDKFLSSVSTVLTSKY.... 140
61 -12.2006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  10.................................AAAVAATVDVFYKKLMNDPDLEPFF--RGVDMVTLIAKQNRFLAYAFGAT--THYHGKDIV--MGHAHLIINRGLNLTHFDKVAGHFVDSL-KEMGVGQELIDEAAGVLIGV................ 114
62 -12.2001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  12  6....GEMEIERRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVFPSAKQYFMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLLVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPETQR------AWAKLRGLIYSHVTAAYKE.. 168
63 -12.2004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  11  17.................................EAAVEKAVDVFYERIVADPQLAPFF--ANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTL-----QELGVAQELKAEAMAIVASA................ 121
64 -12.2001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  14  11.................................TTAVDLAVDKFYERVLQDDRIKHFF--ADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEM--------PEDLIAEVAAVAGAPAHKRDVL........ 122
65 -12.2003bj1_A mol:protein length:142 hemoglobin alpha  ali model follow..  10  1................SLSSKDKDAVKALWGKIADKAEEIGADALGRMLAVYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGG---DDLNAGLLALSELHATLRVDPANFKILSHCILVQLAVKFPKDFTPEVHL------SYDKFFSAVARALAEKY.... 141
66 -12.2001g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  12  2.................LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFFDLSHGSAQVKAHGKKVGDALTLAVGHDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHA------SLDKFLSSVSTVLTSKY.... 140
67 -12.1001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  11  1................SLEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCTFAANHKARGISAGQLEAAFKVLSGFMKSYG-----GDEGAWTAVAGALMGEIEPDM........... 142
68 -12.1001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  1................GLSAAQRQVVASTWKDIAGSDNGVGKECFTKFLSHHDMAAVFGFSGASDPGVADLGAKVLAQIGV----GKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAAAAYADISGAL............... 141
69 -12.1001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  11  1................SLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDHDDVFAKFVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCTFAANHKARGISAGQLEAAFKVLAGFMKSYG-----GDEGAWTAVAGALMGMIRPDM........... 142
70 -12.0002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  14  10.................................AAAVDLAVEKFYGKVLADERVNRFF--VNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQEL--------SQDLIDEVVTIVGSVQHRNDVL........ 121
71 -12.0003mkb_A mol:protein length:140 Hemoglobin subunit alpha  ali model follow..  1................AFTGVERSTIGAIAKILASTPEAYGAEALARLFAHPGAKSYFDYADYSAA--GAKVQLHGGKVIRA---DDLHAHLMVLAVTHGKLLVDPSNF----PMLSECILVTLATHLAEFSPATHC---AVDKLLSAISSELSSKY.... 139
72 -12.0001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  11  1................SLSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCTFAANHKARGISAGQLEAAFKVLSGFMKSYG-----GDEGAWTAVAGALMGEIEPNM........... 142
73 -11.9001v5h_A mol:protein length:193 Cytoglobin  ali model follow..  12  9....GEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVFPSAKQYFMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLLVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPETQR------AWAKLRGLIYSHVTAAYKE.. 171
74 -11.9005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  13  2.............SHMGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFTHPETLEKFDKKTEDEMKASEDLKKHGNTVLTA---GHHEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLQSKHPGDFGADAQG------AMNKALELFRNDIAAKYKE.. 152
75 -11.9001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  1................GLSAAQRQVVASTWKDIADNGAGVGKECLSKFISHPEMAAVFGFSGASDPGVAELGAKVLAQIGV----GKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAAAAYGDISGAL............... 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.