current user: public

If you have questions about the server, please let us know.

Query: 5uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst QGMTTDDLAFDRRHIWHPYTSMTSPLPVFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDAMSHVMFGGITHAPAIELCRKLVAMTPAPLECVFLADSGSVAVEVAMKMALQYWQAKGESRQRFLTFRNGYHGDTFGAMSVCDPHNSMHSLWKGYLAENLFAPAPQSRMGGEWDERDMVAFARLMAAHRHEIAAVILEPIVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRLFACEHAGIAPDILCLGKALTGGTMTLSATLTSRQVAETISNGEAGCFMHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPAADSPQVADVRVLGAIGVVETTRPVNIAALQQFFVRQGVWVRPFGKLIYLMPPYIIQPEQLRRLTQAVNEAVREETFFSVLast
1 -118.0005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model  100  1QGMTTDDLAFDRRHIWHPYTSMTSPLPVFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDAMSHVMFGGITHAPAIELCRKLVAMTPAPLECVFLADSGSVAVEVAMKMALQYWQAKGESRQRFLTFRNGYHGDTFGAMSVCDPHNSMHSLWKGYLAENLFAPAPQSRMGGEWDERDMVAFARLMAAHRHEIAAVILEPIVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRLFACEHAGIAPDILCLGKALTGGTMTLSATLTSRQVAETISNGEAGCFMHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPAADSPQVADVRVLGAIGVVETTRPVNIAALQQFFVRQGVWVRPFGKLIYLMPPYIIQPEQLRRLTQAVNEAVREETFFSV 431
2 -116.0001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  88  1..MTTDDLAFDERHIWHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGEITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWDAKGEARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISDGEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIRPFGKLIYLMPPYIILPQQLQRLTAAVNRAVQDETFF.. 427
3 -116.0001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  88  1..MTTDDLAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGGITHAPAIELCRKLVAMTPQPLECVFLADSGSVAVEVAMKMALQYWQAKGEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCFMHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPARDAEMVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIAPFGKLIYLMPPYIILPQQLQRLTAAVNRAVQDETFF.. 427
4 -115.0006erk_A mol:protein length:451 Aminotransferase  ali model follow..  50  16..TTVSTNDFDQQHLWHPYASLPPTYPNIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGKMAHVMFGGLTHQPAIDLGKKLLSIVPAGLDAIFYADSGSIAVEVALKMALQYQIAAKRPKCQFASTHSGYYGDTWHAMSVCDPINGMHSLYGKQLPMQHFVAAPPMGFERDLTQSEREALTEFFVKNSDKLAGFIIEPIIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFGRSGKLFACEHAAISPDIMTIGKALTGGYMTFAATLSTREIADTISQSDYPALMHGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPAVSLEGVKEVRCLGAVAVIELNEAVDMPIFQTLLINNGIWVRPFGKLVYIMPPYVITDDELTTLCQALLKVVSSYLTR.. 443
5 -112.0003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  50  29...PEQIIAVDGAHLWHPYSSIGRAVSPVVAVAAHGAWLTDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAGLDTVFFSDSGSVSVEVAAKMALQYWRGRGLPKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVP----RDYDPAYSAAFEAQLAQHAGELAAVVVEPVVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGAAGALMRGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARALPAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYAMPPYICTPAEITQITSAMVEVARLVGS... 454
6 -112.0003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  51  24...PEQIIAVDGAHLWHPYSSIGRAVSPVVAVAAHGAWLTDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAGLDTVFFSDSGSVSVEVAAKMALQYWRGRGLPKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAPQVP----RDYDPAYSAAFEAQLAQHAGELAAVVVEPVVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGAAGALMHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTARALPAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYAMPPYICTPAEITQITSAMVEVARLVGS... 449
7 -110.0003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  34  1..MTHDLIEKSKKHLWLPFTQMKDDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHSTLLGMTNVPATQLAETLIDISPKKLTRVFYSDSGAEAMEIALKMAFQYWKNIGKPKQKFIAMKNGYHGDTIGAVSVGSI-ELFHHVYGPLMFESYKAPIPYVYRSEECRDQCLRELAQLLEEHHEEIAALSIESMVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDNLKTFFHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDLHALPHVGDIRQLGFMCGAELVRSKETKEVSLKMRELGMLTRPLGDVIAFLPPLASTAEELSEMVAIMKQAIHEVTSL.. 446
8 -107.0003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  26  5HAGASLASQLKLDAHWMPYTANRNLRDPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLSTLDYSPGFQYGHPLSFQLAEKITDLTPGNLNHVFFTDSGSECALTAVKMVRAYWRLKGQAKTKMIGRARGYHGVNIAGTSLGGVNG-NRKLFGQPMQDVDHLPHTLLASNAEGGIALADELLKIELHDASNIAAVFVEP-LAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASTEIYQTFMNQPTVEFPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGIKGAKNVIDIRNFGLAGAIQIAPRDGDAEAGMALWKAGFYVRFGGDTLQFGPTFNSKPQDLDRLFDAVGEVLNKL..... 447
9 -106.0004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  26  23...PSAAADLNLKAHWMPFSANRNHKDPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGTLDYSPGFQYGHPLSFQLAEKIAQMTPGTLDHVFFTGSGSECADTSIKMARAYWRIKGQAKTKLIGRARGYHGVNVAGTSLGGIGG-NRKMFGPLM-DVDHLPHTLQPGMATGGVELANELLKIELHDASNIAAVIVEP-MSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFGRMGKATGAEYFGVTPDIMNVAKQVTNGAVPMGAVIASSEIYDTFMNQNLVEFGHGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGLKGTKNVIDIRNCGLAGAIQIAARDGDAEASMKLWKEGFYVRFGGDTLQFGPTFNAKPEDLDRLFDAVGEALNGVA.... 462
10 -106.0003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  27  8TNAAGAVGAAMRDHILLPAQEMAKKSAQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYASPWYMATSPAARLAEKIATLTPGDLNRIFFTTGGSTAVDSALRFSEFYNNVLGRPKKRIIVRYDGYHGSTALTAACTGRTG-NWPNFDIAQDRISFLSSPNPRHAEAFLDDLVQEFEDIESLGPDTIAAFLAEP-ILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKFGVVPDIITFAKGVTSGYVPLGGLAISEAVLARISGEKGSWFTNGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASLRDLPGVAETRSVGLVGCVQCLLDPTRADIDERCFELGLIVRPLGDLCVISPPLIISRAQIDEMVAIMRQAITEVSAA.. 457
11 -105.0004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  25  9...PPVSSELNLRAHWMPFSANRNQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIAGLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPKTKLIGRARGYHGVNVAGTSLGGIGG-NRKMFGQ-LMDVDHLPHTLQPGMATGGVELANELLKIELHDASNIAAVIVEP-MSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQHAVEFSHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQGAKNVIDIRNCGLAGAIQIAPRDGDPEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALNGIA.... 448
12 -105.0003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  24  15MNKPQSWEARAETYSLYGFTDMPSQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHFFGRMSDQTVMLSEKLVEVSPFDSGRVFYTNSGSEANDTMVKMLWFLHAAEGKPKRKILTRWNAYHGVTAVSASMTGKP--YNSVFGLPLPGFVHLTCPHYWRYGQFVARLARELEEIQREGADTIAGFFAEP-VMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIGEYRGIGFMWALEAVKDKASKTIANTCTDLGLICRPLGQSVVLCPPFILTEAQMDEMFDKLEKALDKVFAE.. 465
13 -105.0004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  24  16.NKPQSWEARAETYSLYGFTDMPSQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHFFGRMSDQTVMLSEKLVEVSPFDSGRVFYTNSGSEANDTMVKMLWFLHAAEGKPKRKILTRWNAYHGVTAVSASMTGKP--YNSVFGLPLPGFVHLTCPHYWRYGQFVARLARELEEIQREGADTIAGFFAEP-VMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIGEYRGIGFMWALEAVKDKASKTIANTCTDLGLICRPLGQSVVLCPPFILTEAQMDEMFDKLEKALDKVFAE.. 465
14 -105.0004grx_A mol:protein length:465 Aminotransferase  ali model follow..  24  13ANQPQSWEARAETYSLYGFTDMPSQRGTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRFPGYHFFGRMSDQTVMLSEKLVEVSPFDNGRVFYTNSGSEANDTMVKMLWFLHAAEGKPKRKILTRWNAYHGVTAVSASMTGKP--YNSVFGLPLPGFIHLTCPHYWRYGQFVARLARELEDITREGADTIAGFFAEP-VMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFGRTGNTWGCLTYDFMPDAIISSKNLTAGFFPMGAVILGPDLAKRVEAAVEEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKRIADRPNIGEYRGIGFMWALEAVKDKPTKTIANTCTDLGLICRPLGQSIVLCPPFILTEAQMDEMFEKLEKALDKVFAE.. 463
15 -105.0004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  23  16.NKPQSWEARAETYSLYGWTDMPSQRGTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERFPGYHAFGKMSDQTVMLSEKLVEVSPFDSGRVFYTNSGSEANDTMVKMLWFLHAAEGKPKRKILTRWNAYHGATAVSASMTGFP--YNSVFGLPLPGFVHLTCPHYWRYGQFVARLARELEEIQREGADTIAGFFAEP-VMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAAIEEFPHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHIAERPNIGEYRGIGFMWALEAVKDKASKTIANTCTDLGLICFPLGQSVVLCPPFILTEAQMDEMFDKLEKALDKVFAE.. 465
16 -104.0005ghf_A mol:protein length:456 Aminotransferase class-III  ali model follow..  28  2TAQPNSLEARDIRYHLHSYTDAVRAEGPLVIERGDGIYVEDVSGKRYIEAMSGLWSVGVGFSEPRLAEAAARQMKKLPFYHFSYRSHGPVIDLAEKLVSMAPVPMSKAYFTNSGSEANDTVVKLIWYRSNALGEPRKKIISRKRGYHGVTIASASLTGLPN-NHRSFDLPIDRILHTGCPHFYREGQFATRLADELEQIIAEGPHTIAAFIGEP-VMGAGGVVVPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNLFGSQTFDMKPDILVMSKQLSSSYLPISAFLINERVYAPIAEESHGTLGTGFTASGHPVAAAVALENLAIIEERDLVANARDRGTYMQKRLRELQDHPLVGEVRGVGLIAGVELVTDKQAKTANAVLQERGVISRAMGDTLAFCPPLIINDQQVDTMVSALEATLNDVQAS.. 453
17 -103.0004a0f_A mol:protein length:831 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  24  323.ERLNGMAKLAGEVFWWPYTQHKHQETVTVIDSRCGENFSNSSLSQQFDACASWWTQGPDPTFAELAREMGYTAARFGHVMFPENVYEPALKCAELLLDGVGKGASRVYFSDNGSTAIEIALKMAFRKFCVDHHIVVKVIALRGSYHGDTLGAMEAQAPSPYTGFLQQPWYTGRGLFLDPPTVFLRIYSAYLSKHLQEHSVRQSAHVGALIIEPVIHGAGGMHMVDPLFQRVLVNECRNRKIPVIFDEVFTGFWRLGVETTTELLGCKPDIACFAKLLTGGMVPLAVTLATDAVFDSFSGDSLKALLHGHSYSAHAMGCATAAKAIQWFKDPETNHNITSQGKTLRELVQQISSHSAVQRVVVIGTLFALELKADASNSSLLIMLREDGIFTRPLGNVIYLMCGPCTSPEICRRLLTKLYKRLGEFN.... 823
18 -102.0005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  26  20SAQTQHWQALSREHHLAPFTDYKQEKGARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLELPYYNFFQTAHPPALELAKAIADIAPEGMNHVFFTGSGSESNDTVLRMVRHYWSIKGKPKKVVIGRWNGYHGSTVAGVSLGGMKA-LHSQGDLPIPGIVHIAQPYWYGEGEFGVWAAEQLEKILEVGEENVAAFIAEP-IQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVIVRDEIVDTLNEG--GEFYHGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQLADHPLVGEARGVGMVGALELVKNKKTRECREHCFRNGLIMRAVGDTMIISPPLVITKPEIDELITLARKCLDQTAA... 464
19 -102.0003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  27  12...TAELQALDAAHHLHPFSANNAEEGTRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRELPYYNFFKTTHVPAIALAQKLAELAPGDLNHVFFAGGGSEANDTNIRMVRTYWQNKGQPKTVIISRKNAYHGSTVASSALGGMAG--MHAQSGLIPDVHHINQPNWWAEGEFGLARARELEEILELGENRVAAFIAEP-VQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYAPIGGSIVCDEVAHVIGKD---EFNHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWELTDHPLVGEAKIVGMMASIALTPNKASRACRERCFANNLIMRHVGDRMIISPPLVITPAEIDEMFVRIRKSLDEAQAE.. 455
20 -101.0003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  23  3.LKNDQLDQWDRDNFFHPSTHLAQHAANRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQARELAYYHYVGHGTEASITLAKMILDRAPKNMSKVYFGLGGSDANETNVKLIWYYNNILGRPKKKIISRWRGYHGSGLVTGSLTGLEL-FHKKFDLPVEQVIHTEAPYYFRREQFVAHCVAELEAIEREGADTIAAFIGEP-ILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTMFGSDHYGLEPDIITIAKGLTSAYAPLSGSIVSDKVWKVLEQGENGPIGHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEASQHANVGDVRGEGLLCAVEFVKDRDSRTISAKLLEQDKIIARQGDILGFAPPFCLTRAEADQVVEGTLRAVKAV..... 456
21 -100.0003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  25  3LNQSNELNAWDRDHFFHPSTHMGTESPTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHYVGHGTEASITLAKMIIDRAPKGMSRVYFGLSGSDANETNIKLIWYYNNVLGRPKKKIISRWRGYHGSGVMTGSLTGLDL-FHNAFDLPRAPVLHTEAPYYFRREQFSQHCADKLEEILAEGPETIAAFIGEP-ILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAKGLTSAYAPLSGVIVADRVWQVLVQGSDGSLGHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAGGHKNVGEVRGDGMLAAVEFVADKDDRVVATALAASGVIGRAQGDILGFAPPLCLTREQADIVVSKTADAVKSVFAN.. 459
22 -99.6005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  34  2.GSSYEKYKNAEKKFWHPMGSSAARDKTLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDELAYYQFDGIAHPRVFDLAERLTGMAQERMARVLFSSGGSDAVETALKMARQYWIASGEPRTRFLSLRNGYHGVHMGGTSVGGNGV-YHYNHGQLLAGCHLLDTPWLYRNPALTAHCIRQLEEIALLGAQTIAALIAEP-VQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFGRSGCMLGSRGWGVAPDILCLAKGITAGYIPLGATLFNQRIADAIENGQGHMIMHGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLERYAVVGEVRGKGLMIALDLVSDKRTRQIADEARRAGVLVRPIGNKIILSPPLTLTRDEAGLMVSALEAAFARC..... 451
23 -96.9003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  26  1...........MSNVFYRSSK-----PYPVAVRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHGSQFSSDVLEEYAGRLARFVGLPTFRFWAVSGGSEATESAVKLARQYHVERGEPRFKVITRVPSYHGASLGSLAASGMGA-RRELYTPLMRPEAWPKLPKPDPARNGAEDAEGLRALLEREGPETVAAFMAEPVVGASDAALAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIAVLGKGLAAGYAPLAGLLAAPQVYETVMGGS-GAFMHGFTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALARFPQMMQVRGTGLLLGVVLGDLATASRIGAAALKRGLITYPGGDHLLLGPPLSITAAEVDGLLALLAGALEDV..... 428
24 -96.8004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  27  4QRTTSQWRELDAAHHLHPFTDTASQAGARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNFFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPKKTLIGRWNGYHGSTIGGASLGGMKY-MHEQGDLPIPGMAHIEQPWWYKHGEFGVVAARWLEEILEIGADKVAAFVGEP-IQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAG--GDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDIGPYMQKRWRETSRFEHVDDVRGVGMVQAFTLVKNKAKRECRDIFFRNNLIMRACGDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQT.. 452
25 -96.6005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  25  16.TSLEQLLEMDRAHFMHPSTHASGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQLAYYHYVGHSNDPVIELSSRIIEWAPAGMKKVFYGMSGSDANETQIKLVWYYNNVLGRPKKKIIARERSYHGSGIVTGSLTGLPS-FHQHFDLPIDRVKHTVCPHWYNAPQFVAYCVEELEKIAREGADTIAAFIAEP-VMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKTGSEHYGIKPDLITVAKGLTSAYAPLSAVIVSEKVWDVIEKGEHGVMGHGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAGAHPLVGEVRGVGMLAALEFMADKGARTVAAAALEDGLIVRALGDILGFAPPLVTTRAEVDEIVAIAKEAFDEVADAVL 473
26 -96.2005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  23  16.TDFDQLFEQDRAHFMHPSTHAHDHAPGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKELAYYHYVGHSTEAIIELSSRIIRWAPAGMKKVYYGLSGSDANETQIKLVRYYNNVLGRPKKKIISRQRGYHGSGIMTGSLTGLPS-FHQHFDLPVEGIKHTVCPHWYKAPAFVRYCADELEKILAEGPDTVAAFIGEP-VMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFGRLGSKMGSQRYGMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIEKASQGAMGHGWTYSGHPICAAAALANLDILERENLTANAADVGAYLNQRLRETEGHPLVGEVRGDGMLAALEFMADREARTVSAACLEDGMIARAMGDILGFAPPLVLTRAEADEIVGIAKAAVDEVAGEVL 473
27 -96.1005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  23  16.TDLDQLFEMDRAHFMHPSTHAHDHAPGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKELAYYHYVGHSTEAIIELSSRIIRWAPAGMKKVYYGMSGSDANETQIKLVWYYNNVLGRPKKKIISRQRGYHGSGIMTGSLTGLPS-FHQHFDLPIERIKHTVCPHWYKAPQFVRYCADELEKILAEGPDTVAAFIGEP-VMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFGRLGSKMGSQHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSQGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLRETGGHPLVGEVRGVGMLAALEFMADKDARTVSAACLEDGMIARAMGDILGFAPPLVITRAEVDEIVGIAKQAVDEVADEVL 473
28 -96.1005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  24  18...LDQLFEEDRAHFMHPSTHAHDHAPGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHYVGHSTDAIIELSSRIIRWAPAGMKKVYYGMSGSDANETQIKIVWYYNNVLGRPKKKIISRERGYHGSGIVTGSLTGLPS-FHQHFDLPIDRVKHTVCPHWYKAPQFVAYCVEELEKIAREGADTIAAFIAEP-VMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFGRLGSKMGAQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGEHGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAGAHPLVGEVRGVGMLAALEFMADKDARTVSAAALEDGVIARAMGDILGFAPPLVTTRAEVDEIVGIVKQAVDEVADEVL 473
29 -95.8005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  24  18...LDQLFEMDRAHFMHPSTHAHDHAPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHYVGHSTDAIIELSSRIIRWAPAGMKKVYYGMSGSDANETQIKLVWYYNNVLGRPKKKIISRERGYHGSGIVTGSLTGLPS-FHQHFDLPIDRVKHTVCPHWYRAPQFVAYCVEELEKIAREGADTIAAFIAEP-VMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKMGSQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGEHGPMGHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAGAHPLVGEVRGVGMLAALEFMADKDARTVSAAALEDGMIARAMGDILGFAPPLVTTRAEVDEIVGIAKQAVDEVADEVL 473
30 -95.7005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  22  16.TDYAKLFEQDRAHFMHPSTHAHDHAPGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQLAYYHYVGHASEAIIELSARIIRWAPAGMKKVYYGLSGSDANETQVKLVRYYNNVLGRPKKKIISRQRGYHGSGIVTGSLTGLAS-FHQHFDLPVEGVKHTLCPHFYKAPAFVRHCAQELENILAEGPDTVAAFIGEP-VMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFGRLGDKMGSQRHAMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIDSAREGAMGHGWTYSGHPICAAAALANLDILERENITANAADVGGYLNQQLRQAEGHPLVGEVRGDGMLAALEFMADREARTVSAACLERGMIARAMGDILGFAPPLVLSRAEADEVVGIAKAAVDAVAAEVL 473
31 -95.5005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  25  16.TDTDDLLEMDRAHFFHPSTHLRDELPGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKELAYYHYVGHSNEPIIELSERIIRWAPAGMSKVYYGMSGSDANETQIKLVWYYNNVLGRPKKKIISRQRGYHGSGIMTGSLTGLPA-FHNHFDLPLEPIRHTTCPHYYRAPEFSRHCADELEKILAEGPDTVAAFIGEP-VMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFGRTGSMFGSHHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWKVLEQGSDGPIGHGWTYSGHPICAAAALANLDIIERENLTGNAADTGAYFQQRMRETGDHPLVGEVRGVGLMAALEFVADKDKRTVSAACLEDGMIARAMGDILGFAPPLVITRAEVDEIVDIAKQAVDAVADELV 473
32 -93.1003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  28  6TKQTDELLAKDEQYVWHGMRPFSP-NSTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQTLSYFP-MSQSHEPAIKLAEKLNEWLG-GEYVIFFSNSGSEANETAFKIARQYYAQKGEPRYKFMSRYRGYHGNTMATMAATGQAQ-RRYQYEPFASGFLHVTPPDCYRMPIYDVECVKEVDRMTWELSETIAAFIMEP-IITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKAFGFMNYDVKPDIITMAKGITSAYLPLSATAVKREIYEAFKGKGEEFFRHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEGEHPLVGDIRGKGLLVGIELVNDKETKEVVNACKEKGLIIGRNGNILTLAPPLVISSEEIAFVIGTLKTAMERI..... 452
33 -89.4005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  22  10...WEQVKEWDRKYLMRTFSTQNEY-QPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDRYGFVW-DTYATDYKAKAAKIIIEDILGDEDKVRFVSTGSEAVETALNIARLY-----TNRPLVVTREHDYHGWTGGAATVTRLRSYRSGPGSSYNSAVLMAPSPNMFQDSNGELLSVKYTRRMIEYGPEQVAAVITEV-SQGAGSA-MPPYEYIPQIRKMTKELGVLWINDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVLVSKEIAAFM---DKHRWESVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELLQEHKSIGNFDGYGLLWIVDIVNAKTKTPIMKKALEKGVLIGGVPNTMRIGASLNVSRGDIDKAMDALDYALDYLES... 470
34 -88.3005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  22  10...WEQVKEWDRKYLMRTFSTQNEY-QPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDRYGFVW-DTYATDYKAKAAKIIIEDILGDEDKVRFVSTGSEAVETALNIARLY-----TNRPLVVTREHDYHGWTGGAATVTRLRS-FRSGLVGENSAVLMAPSSNTFQDSNGELLSVKYTRRMIEYGPEQVAAVITEV-SQGVGST-MPPYEYVPQIRKMTKELGVLWISDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVVVSKEIAAFM---DKHRWESVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLQEHKSIGNFDGYGLLWIVDIVNAKTKTIIMEKALEKGVLIGGAPNTMRIGASLNVSRGDIDKAMDALDYALDYLES... 470
35 -83.3002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  24  2..LSRKIIEESDIYLATSTRDPELF--PLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAAANDFYNIPQLELAKKLVTYSPGNFKKVFFSNSGTEAIEASIKVVKNT------GRKYIIAFLGGFHGRTFGSISLTASKAVQRSIVGPFMPGVIHVPYPNPYRNPELVNRVIEFIEDYILVPPEEVAGIFFEP-IQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGIMPIGATIFRKDLDFKPGM-------HSNTFGGNALACAIGSKVIDIV--KDLLPHVNEIGKIFAEELQGL-----ADDVRGIGLAWGLEYNEKKVRDRIIGESFKRGLLLLPAGSAIRVIPPLVISEEEAKQGLDILKKVIKVVK.... 419
36 -83.1001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  22  3LNDDATFWRNARQHLVRYGGTFE----PMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLF-SGMLSRPVVDLATRLANITPPGLDRALLLSTGAESNEAAIRMAKLV-----TGKYEIVGFAQSWHGMTGAAASATYSA--GRKGVGPAAVGSFAIPAPFTYRPAYDYLAELDYAFDLIDQSSGNLAAFIAEP-ILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGL-PLAAIVTSAAIEERAHELG---YLFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMEFDCIGDVRGRGLLLGVEIVKDRRTKEITRECMNLGLSMNIVGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA..... 432
37 -82.3004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  25  16LKTEEDFFACDRQYVCQNYAPV-----PVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRA-FGNDVTGPACRFMAEMF--GYDRVLLMNTGAEAGESALKIARKWAYEVKPDSAKVILCNNNYWGRTITACSSSTTFD-CYNNFGPFTPGFELIDY-----------DDVGALEEALK--DPNVAAFFVEP-IQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGT-----HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREGKVPWIKEIRGRGLLNAVEVDSDADPNDVVMKLKENGILSKPTRRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEER. 424
38 -82.3001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  26  38.PTSDDIFEREYKYGAHNYHPL-----PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRA-FYNNVLGEYEEYITKLF--NYHKVLPMNTGVEAGETACKLARKWGYTVKKYKAKIVFAAGNFWGRTLSAISSSTDPT-SYDGFGPFMPGFDIIPY-----------NDLPALERALQ--DPNVAAFMVEP-IQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGE-----HGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKLPS-DVVTAVRGKGLLNAIVIKETKDAWKVCLRLRDNGLLAKPTHDIIRFAPPLVIKEDELRESIEIINKTILSF..... 439
39 -82.1005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  26  6TKNSEYFIELEEKHGAHNYHPL-----PVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRA-FYNSKLGEYEQKITSLL--GFDKVLPMNSGAEAVETAVKLARKWSYEVKENAAKIIVCENNFHGRTTTIVSFSNDPD-ANQNYGPFTPGFIRIPY-----------NDIAALEEVLSKEAGNIAAFLVEP-IQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKLIACHHEDVQPDILILGKALSGGMYPVSAVLANNNIMDVIKPGQ-----HGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLEKTDLITKVRGKGLLNAILINDTPDAWNLCLALKENGLLAKPTHNIIRLAPPLVITEEQLLDCVKIIEKTILEF..... 413
40 -81.9004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  26  32KALNREVIEYFKEHVNPGFLEYRKDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQE-LLDPLRAMLAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRG--KFTFIATSGAFHGKSLGALSATA-KSTFRKPFMPLLPGFRHVPFG--------NIEAMRTALNECKKTGDDVAAVILEP-IQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNPF---LHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLKTIRIEPPLTLTIEQCELVIKAARKALAAMRVS.. 455
41 -81.4004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  23  17.DKASKLIDEENKYYARSARINYY---NLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKLAKIAPGNSKMVSFGNSGSDANDAIIKFARAY-----TGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTRKIGPMLPSVVHVPYPDSYRTHDVSLRYFNEFKKPFESPADETACVLIEP-IQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPA-----HLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQHPMIGDVRMWGLNGGIELVKDPKTKEVIYYAFAHGVVIITLANILRFQPPLVIPREQLDQALQVLDDAFTAVENGEV 451
42 -81.4004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  25  31LKTEEDFFACDRQYVCQNYAPV-----PVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRA-FGNDVTGPACRFMAEMF--GYDRVLLMNTGAEAGESALKIARKWAYEVKPDSAKVILCNNNYWGRTITACSSSTTFD-CYNNFGPFTPGFELIDY-----------DDVGALEEALK--DPNVAAFFVEP-IQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGT-----HGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREGKVPWIKEIRGRGLLNAVEVDSDADPNDVVMKLKENGILSKPTRRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEER. 439
43 -81.3004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  25  26..KSQALAERRSAVVAAGVASGV----PVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCFMVTPYEGYVAVTEQLNRLTPGDAKRTVLFNSGAEAVENAVKVARLA-----TGRDAVVAFDHAYHGRTNLTMALTAKAMPYKTNFGPFAPEVYRMPMSYPFREENPEITGAEAAKRAITMGGDQVAAIIIEP-IQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGG-LPLSAITGRADLLDAVHPGG-----LGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAGSVVGDIRGRGAMLAIELVQPGSTKAVAAACLKEGVIILTCGNVIRLLPPLVISDELLIDGLEVLAAAIKAHA.... 456
44 -81.3005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  26  30KALNREVIEYFKEHVNPGFLEYRKDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQE-LLDPLRAMLAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRG--KFTFIATSGAFHGKSLGALSATA-KSTFRKPFMPLLPGFRHVPFG--------NIEAMRTALNECKKTGDDVAAVILEP-IQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDNPF---LHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLKTIRIEPPLTLTIEQCELVIKAARKALAAMRQQ.. 453
45 -79.8001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  25  2.NSNKELMQRRSQAIPRGVGQIH----PIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFKKTLLVTTGSEAVENAVKIARAA-----TKRSGTIAFSGAYHGRTHYTLALTG-KVNPYSAGMGLMPGHVYRALYPCPLHGISEDDAIASIHRIFKNDPEDIAAIVIEP-VQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGG-FPLAGVTGRAEVMDAVAPGG-----LGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEHPEIGDVRGLGAMIAIELFEDGDHNKIVARARDKGLILLSCGNVLRILVPLTIEDAQIRQGLEIISQCFDEAK.... 425
46 -79.5005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  23  29.DKASKLIDEENKYYARSARINYY---NLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKLAKIAPGNSKMVSFGNSGSDANDAIIKFARAY-----TGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTRKIGPMLPSVVHVPYPDSYRTHDVSLRYFNEFKKPFESPADETACVLIEP-IQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPA-----HLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQHPMIGDVRMWGLNGGIELVKDPKTKEVIYYAFAHGVVIITLANILRFQPPLVIPREQLDQALQVLDDAFTAVENGEV 463
47 -79.4003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  28  1....KDIIELTDTYGANNYHPL-----PIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRA-FHSDQLGPWYEKVAKLT--NKEMVLPMNTGAEAVETAIKTARRWAYDVKANRAEIIVCEDNFHGRTMGAVSMSSNEE-YKRGFGPMLPGIIVIPY--------------GDLEALKAAITPNTAAFILEP-IQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILGVFEPGS-----HGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI-DNPMITEVRGKGLFIGIELNEP--ARPYCEQLKAAGLLCKETHNVIRIAPPLVISEEDLEWAFQKIKAVLS....... 392
48 -79.2003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  25  8.KSSQDYMNNELTYGAHNYDPI-----PVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRA-FFSDSLGVCERYLTNLFG--YDKVLMMNTGAEASETAYKLCRKWGYEVKENSAKIIVCNNNFSGRTLGCVSASTDKK-CKNNFGPFVPNFLKVPY-----------DDLEALEKELQ--DPNVCAFIVEP-VQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGE-----HGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQKDSKVVREVRGKGLLCAIEFKNDLNVWDICLKFKENGLITRSVHKTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNLL 415
49 -79.2003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  25  23..RSQALIDRKGTAVARGVGTTM----PVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDFTHTCFMVTPYEGYVAVCEQLNRLTPVRDKRSALFNSGSEAVENAVKIARSH-----THKPAVVAFDHAYHGRTNLTMALTAKVMPYKDGFGPFAPEIYRAPLSYPFRDATDGELAAKRAITVIDKGADNLAAVVIEP-IQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGG-LPLSAVTGRAEIMDSPHVSG-----LGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLQADDRIGDVRGRGAMIAMELVKAGTTKALCAGAHAAGVIVLSCGNVVRFLPPLSIGDDLLNEGLDVLEEVLRGA..... 451
50 -79.0003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  25  30..ISQELQARKQSAVAAGVGVTL----PVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTPYEGYVKVAEHLNRLTPGDHKRTALFNSGAEAVENAVKIARAY-----TRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKHGFGPFANEVYRVPTSYPFRDGDGAAAAAHALDLINKQGADNVAAVVIEP-VHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHENVVPDLIVTAKGIAGG-LPLSAVTGRAEIMDGPQSGG-----LGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAADPRIGEVRGRGAMIAVELVKPGTTERVAAAAHAQGLVVLTCGNVLRFLPPLSMPDHLLDEGLDILAAVFAEVK.... 453
51 -78.4003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  24  34..ASLELNKRRAAAVSGGVGVTL----PVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQFTHTCFMVTPYEQYVAVAEQLNRITPGSEKRTVLFNSGAEAVENSIKVARAH-----TRKQAVVAFDYAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPVSYPYRDNLLDKDIATDGELAAERGAANLAAVIIEP-IAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGF-PLSAVTGRAEIMDAPHTSG-----LGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQADDRLGDVRGRGAMIAMELVKSGTTQKLAAAAHAAGVIVLTCGNVIRLLPPLTISDELLSEGLDILCQILAD...... 461
52 -78.4002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  19  14PTTPDRVHEVLGRSMLVDGLDI-----VLDLTRSGGSYLVDATGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNSDVYSVAMARFVETFARVLDPALPHLFFVEGGALAVENALKAAFDWKSRHNQLGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPYMRPPAMAALEAEALRQARAAFETRPHDIACFVAEP-IQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSR-----LNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADAVVLDPRGRGLMCAFSLPTTADRDELIRQLWQRAVIVLPAGDTVRFRPPLTVSTAEIDAAIAAVRSALPVVT.... 449
53 -78.3001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  25  21.KTPEDYINNELKYGAHNYDPI-----PVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRA-FFSVPLGICERYLTNLLG--YDKVLMMNTGAEANETAYKLCRKWGYEVKENMAKIVVCKNNFSGRTLGCISASTTKK-CTSNFGPFAPQFSKVPY-----------DDLEALEEELK--DPNVCAFIVEP-IQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGHYPISAVLANDDIMLVIKPGE-----HGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKREKDSKIVRDVRGKGLLCAIEFKNELNVLDICLKLKENGLITRDVHKTIRLTPPLCITKEQLDECTEIIVKTVKFFDER.. 426
54 -78.2001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  31  7.EDWRALLEAEKTLDSGVYNKH-----DLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQT-LPTPMRGEFYRTLTAILPPELNRVFPVNSGTEANEAALKFARAH-----TGRKKFVAAMRGFSGRTMGSLSVTW-EPKYREPFLPLVEPVEFIPY--------------NDVEALKRAVDEETAAVILEP-VQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGG-VPLGVAVMREEVARSMPKGG-----HGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPS-PKIREVRGMGLMVGLELKEK-AAPYIARLEKEHRVLALQAGTVIRFLPPLVIEKEDLERVVEAVRAVLA....... 395
55 -77.9004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  26  26..RSGALAERRRAAVSAGVGSTA----PVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHFTHTCFMVTPYEQYVQVAELLNALTPGDHDRTALFNSGAEAVENAIKVARLA-----TGRPAVVAFDNAYHGRTNLTMALTAKSMPYKSQFGPFAPEVYRMPASYPLRDEEAARRAISRIETQI--GAQSLAAIIIEP-IQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFARTGAWFASEHEGIVPDIVTMAKGIAGG-MPLSAVTGRAELMDAVYAGG-----LGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEVDIIGEVRGRGAMLAIEIVKPGTTKSIAAEALSQGVLILTCGNVIRLLPPLVIGDDLLDEGITALSDIIRAKASHQ. 453
56 -77.4005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  19  16...ANDLLARRYATIGPHSPLF--YRQPLELVSGSGVWLTDAQGKVYLDGYNN--VPHVGHANPAVADAIYQQLLTVNLHT--RYLNSRVVEYAEALLSKFDGALERLFLTNSGSEANELALRIARQH-----TGNTGVLVSDFSYHGNTTSLAEITT----GLTVHEPLGAHVRALRIPDVSGIAEVDVADVDAAIASLQAAGHGVSVFLFDP-LFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSMWGYQMFNVEPELVTMGKPMGNGH-PIGAVVTTAELLDEFGRHNM----FFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIAQSGNVGSVRGRGLFFGIDIIESDGSRNLIEDMRERGVLISRVGNVLKMRPPLVFGREHADILLGQLELSLASLPQP.. 441
57 -77.1004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  25  391...REDTLDRYHQYINPMMVDFLKLQRDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPNFIQYSIPEQTAKLAEVLCRLAPGNMGRVFFSNSGTEAVEAAMKIAKAS-----TGKPGIAYLRNSYHGKTLGALSITG-RDKHRRYFTPLLDAMVEVPF-----------GDLAALREALN--REDVGALMIEP-IQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCRADLWQKAYGTADRFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIARYPFVSEVRGRGLMLGIQFDQAFTGAFVTKLCQDHKILTFITATVIRIQPPLIISKAEIDRFVGAFATVCEELST... 850
58 -77.0002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  25  1......MGSDKIMYLMNTYSRF-----PATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNL-FWNRPQMELAELLSKNTF--GGKVFFANTGTEANEAAIKIARKYGKKKSEKKYRILSAHNSFHGRTLGSLTATGQPK-YQKPFEPLVPGFEYFEF--------------NNVEDLRRKMSEDVCAVFLEP-IQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGG-VPIGAVIVNE-RANVLEPGD-----HGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMEEYDVVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNTIRFLPPLTVEYGEIDLAVETLKKVLQGI..... 391
59 -77.0003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  27  2.....KMDYKEQSHIIPTYKRF-----DIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSNL-YYNENIAAAAKNLAKASA--LERVFFTNSGTESIEGAMKTARKYAFNKGVKGGQFIAFKHSFHGRTLGALSLTANEK-YQKPFKPLISGVKFAKY--------------NDISSVEKLVNEKTCAIILES-VQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCG-LSVGAFVINQKVASNSLEAGD----HGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELNEFDFCKKRKGLGFMQGLSLDKSVKVAKVIQKCQENALLLISCGNDLRFLPPLILQKEHIDEMSEKLRKALKSF..... 395
60 -76.4004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  27  12TEQTAITRATFDEVILPVYAPA-----DFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNV-FTNEPALRLGRKLIDATF--AERVLFMNSGTEANETAFKLARHYACVRSPFKTKIIAFHNAFHGRSLFTVSVGG-QPKYSDGFGPKPADIIHVPF--------------NDLHAVKAVMDDHTCAVVVEP-IQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG-FPVSAMLTTQEIASAFHVGS-----HGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIEQFDIFSDIRGMGLLIGAELKPKYKARDFLYAGAEAGVMVLNAGDVMRFAPSLVVEEADIHEGMQRFAQAVGKVVALE. 416
61 -76.3003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  25  10.HMTKALYDRDGAAI----NLQKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANPAGATILSASNAPAVTLAERLLASFPGETHKIWFGHSGSDANEAAYRAIVKA-----TGRSGVIAFAGAYHGCTVGSMAFSGHS---VQADAAKADGLILLPYPDPYRPYRNDPTGDAILEKLAAVPAGSIGAAFIEP-IQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCASAF------AMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKHPLIGDIRGRGLACGMELVCDRQSRELIYRAYQLGLVVYYVGNVLEFTPPLTITETDIHKALDLLDRAFSELSA... 434
62 -76.2005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  25  4.AMAGNLYGRDGAAI----SLQKLRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANPAGASILSASNAPAVALAERLTASFPGRTHKVWFGHSGSDANEAAYRAITRA-----TGRTGVIAFIGAYHGCTVGSMAFSGHS---VQADAAKADGLILLPYPDPYRPYQDDPTGDAVLERLAAVPAGSIAAAFIEP-IQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCASAF------AMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLAEHELIGDIRGRGLACGVELVRNRQSRELIYRAYELGLVLYYVGNVLEMTPPLTMTEDEVRHAVNLLDQAFTELST... 428
63 -76.2004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  27  2..SQPITRENFDEWMIPVYAPA-----PFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNG-YTNEPVLRLAKKLIDATF--ADRVFFCNSGAEANEAALKLARKFAHDRGSHKSGIVAFKNAFHGRTLFTVSAGGQPA-YSQDFAPLPADIRHAAY--------------NDINSASALIDDSTCAVIVEP-IQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGG-FPVGALLATEECARVMTVGT-----HGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTIHRYGLFSEVRGLGLLIGCVLNADYAAKQISQEAAKAGVMVLIAGNVVRFAPALNVSEEEVTTGLDRFAAACEHFVSRG. 404
64 -76.0001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  17  26..RSRELMKQLNIIQNAEAVHF-----FCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALGILPVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYRSKGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPSFDWPIAPFPRLKYPLEEQEEARCLEEVEDLIRKKKKTVAGIIVEP-IQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKMMTGG-FFHKEEFRPN----------APYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARQFISRVRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGCGKSIRFRPTLVFRDHHAHLFLNIFSDILADFK.... 472
65 -72.4005dds_A mol:protein length:523 CrmG  ali model follow..  23  25...........................GVEYVRAEGVYYLDDEGREVLDHACGFGSLIFGHNHPEIIAHAKAALDAGTVVHAQLSRQPRANQISRILNDIMRRDRYNAIFANSGAEANEICMKHAERHNDERRAERPLFLTLDGSFHGKLVGSIQLTQNEP-WRTPFTALSSPARFLPADEPELIGKIVEDEDKDTVRVVERDFPVVAAIFVEP-VRGGSGMKTVTPELAEELHRLRDTLGCPLVVDEVQTGIGRTGAFFGSALLGIRGDYYTLAKAIGGGIVKNSVALIRQDRFLPAMEVI-----HSSTFAKDGLSASIALKVLEMVEADRVYQRVRERGQRLEAMLESVRADDVVSAVWGTGLMLALELRDQSNATSAGFLLREHHIRVLPAGGFLRFSPSLYITDEEIDRTETALRSLFTALRDQ.. 515
66 -72.4002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  28  11...........................PVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSNL-YENPWQEELAHKLVKHFWTE-GKVFFANSGTESVEAAIKLARKYWRDKGKNKWKFISFENSFHGRTYGSLSATGQPK-FHKGFEPLVPGFSYAK--------------LNDIDSVYKLLDEETAGIIIEV-IQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGG-VPIGAILAREEVAQSFTPGS-----HGSTFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELG----KGKVKGRGLMLGLELERE--CKDYVLKALEKGLLINCTAKVLRFLPPLIIQKEHIDRAISVLREIL........ 375
67 -51.6006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  17  4.SSSENLYFQGGGHM-FPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATG----DGTATGWSRRVDAVLERLHALC-GGEVVGLFRSGTAAVRAAVLAVREA-----TGRPLLLS--AGYHGYDPMWYPSEAPLEPNADGVVDFFFDLGLL--------------------RELLRAPERVAAVVVSPD------HMHLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV-------SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGV---SAAFDEAVLGEAERRFARVCERLAP... 389
68 -51.1006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  19  40...........................GLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSH----VQYAASHPLEVRWAERIVAAFP-SIRKLRFTGSGTETTLLALRVARAF-----TGRRMILRIATHYHGWHDFSASGYNSHFD--------GQPAPGVLPEIAKNTLLIRPDDIEGMREVFAQHGSDIAAFIAEP-VGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGG-LPGGILGGREDVMGVLSRGSDRKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNLAYGRFSGFHLMPGLPPNTAAMRMALILEGVDIGGRGSVFLSAQ----EREHVEHLVTTFDRVLDRLADENL 440
69 -51.1002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  19  40...........................GLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSH----VQYAASHPLEVRWAERIVAAFP-SIRKLRFTGSGTETTLLALRVARAF-----TGRRMILRFEGHYHGWHDFSASGYNSHFD--------GQPAPGVLPETTANTLLIRPDDIEGMREVFANHGSDIAAFIAEP-VGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGG-LPGGILGGREDVMGVLSRGSDRKVLHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNLAYGRFSGFHLMPGLPPNTAAMRMALILEGVDIGGRGSVFLSAQ----EREHVEHLVTTFDRVLDRLADENL 440
70 -51.1006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  18  22...........................PRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATG----DGTATGWSRRVDAVLERLHALC-GGEVVGLFRSGTAAVRAAVLAVREA-----TGRPLLLS--AGYHGYDPMWYPSEAPLEPNADGVVDFFFDLGLL--------------------RELLRAPERVAAVVVSPD------HMHLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV-------SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGV---SAAFDEAVLGEAERRFARVCERLAP... 373
71 -50.9005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  22  45...........................PPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLAD----VAFAMPTEHEIALAELLTERVP-SLQQVRFTNSGTEAVMMAIKAARAY-----TGRPRIAKFDGCYHGSYDFAESTQSSGKPGEDGFPVATPYTGGTPQAVLDSVVVLPFNDIDGTERLIEQHRDELAAVLIDP-NPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVIS---RSDYGGMQSVLGVTPDLTAMGKIIGGG-FPVGAVGGSAEVMSVFDPGGPPRAPHGGTFNANPVTMVAGLTAMRKLTPA-EFDRLATLGQQLRAGVEEVLREAGVPQVTGYGSLFHIHLHQRPLAGRVHEALMGRGIFITPALFGCLSTP----GVPEVEAFVDAFAAALQDARG... 446
72 -50.5006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  14  4.SSSENLYFQGGGHMTIDIGAGKLLAQPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARG----SGVGTAWSPVLDSLLGQLQEVC-GGDVVGLYRTGTAALRSVTCAVRDA-------RDRSIVLSSGYHG------------------DPMWHCDEPFTPNQHGIVEFLFDLDVLAEW----LSRPEQVAAVVISPDHMHLG------ERWYTEFTRLTKEADVPVIADEVKVGL-RYRA--GLSTPLLDPAVWIVAKCLANGS-PVAAVGGDAHLLAALEDV-------SFTSYFEPTAMAAATTTLRRMATGEPQQAIRAAGDRFIAHTRAAFANAGVPDLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFEGDNQTP---SAAFTDEVVEDACGRIDRVSAALTG... 390
73 -50.5002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  23  77...........................PLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAV----LNLSTQTENEALFAEAVCDRFP-SIDLVRFTNSGTEANLMALATATAI-----TGRKTVLAFDGGYHGGLLNFASGHAPTNAPYHVV--------------------GVYNDVEGTADLLKRHGHDCAAILVEP-MLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS--RLSGGGAQEMLGISADLTTLGKYIGGG-MSFGAFGGRRDLMERFDPARDGAFAHAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIAVENQAPQFTGLGSLGTIHFSRAQLKELFFFHMLRKGIYLAPRGMYAL---SLEIADAGRDAFAEALADFIGEQRALLM 459
74 -50.0005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  23  35...........................PLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDH----LSYGAPTALEVEMADLVCSMVP-SMEMVRMVSSGTEATMSAIRLARGY-----TGRDSIIKFEGCYHGHSDSLLVKAGSGALTFG-----VPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACIIVEP-VAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGF-RVALGGAQAYYGVTPDLSTFGKIIGGG-MPVGAFGGKREIMQQI--SPLGPVYQAGTLSGNPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAAGIPVTTQAGGMFGLYFSGADAIKRFFHLMLDGGVYLAPSAFEAGFT-SIAHGDKELEITLNAAEKAFAALK.... 429
75 -49.9002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  22  19...........................PIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEK----TSFGAPCLLENILAEMVIAAVP-SVEMVRFVNSGTEACMAVLRLMRAY-----TQREKVIKFEGCYHGHADMFLVKAGSGVATLG-----LPDSPGVPKATTAATLTAPYNDLEAVSRLFEQYPNDIAGVILEP-VVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGF-RIAYGGAQEKFGVTPDLTTLGKVIGGG-LPVGAYGGRAEIMKMV--APAGPVYQAGTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHECGGHISGMFGLFFTAGKKFAAFHRGMLEQGIYLAPSQFEAGFT-SLAHTEADIERTIAAARTVLSQL..... 411

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.