current user: public

If you have questions about the server, please let us know.

Query: 5v3t_A mol:protein length:132 Globin, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MSKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEILast
1 -73.1005v3t_A mol:protein length:132 Globin  ali model  100  1MSKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGEI 132
2 -67.5002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  37  1MSSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADN... 132
3 -66.9005d1v_A mol:protein length:127 Globin  ali model follow..  40  2...SEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPADLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGED... 127
4 -65.7002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  68  1..EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPDDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHLD.. 128
5 -65.5004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  31  18.PTPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDMPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH...... 145
6 -64.2002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  39  2......TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE..... 123
7 -62.8001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  66  1MGQSFNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDR. 130
8 -61.5004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  36  30.HDDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDAQP. 160
9 -61.1001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  35  2....PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP...... 127
10 -60.3004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  20  4.TAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAGAA. 134
11 -60.3002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  22  9.KREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAPV 136
12 -60.1001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  24  9.KREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAPV 136
13 -57.5006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  17  1.....STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKGK.. 126
14 -57.2003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  23  1MNKPQ-TIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK....... 121
15 -56.1002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  16  1.....ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHDVLNR....... 123
16 -55.6001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  23  39.RKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ.... 164
17 -55.6001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  20  1......SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT........ 115
18 -55.3001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  20  2.....STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ....... 124
19 -54.3004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  23  47.VKFPSKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRTTLEPP 179
20 -53.0004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  26  20FAIDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWFQSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAGNELKNQ. 153
21 -45.6002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  22  1.......MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIV-YNEEMKNVILQRAQMIASHFQNM....... 120
22 -16.1002w31_A mol:protein length:162 GLOBIN  ali model follow..  13  13FTDEDAELLGSLFPETNKERLADQFYDYLLGIPETAEFLKEDLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI.............. 138
23 -15.6001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  14  43LGDAELYVLEQLQPQENIVNIVDAFYKNLDHESSLMDIINDHVDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI.............. 168
24 -15.1001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  11  3MNAADMQSYGRCCAST---GFFDDFYRHFASSPQIRAKFATDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYGS.... 134
25 -15.1003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  12  1MTREEIKMIQKS--IDKMDEAGLLFYRRLDVEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE....... 132
26 -15.0004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  16VEQADPPIRAKAAEVAHAHYLSIEFYRIVRIDPHAEEFLSNEERQLKSAMERWIINVLSAQVDDVERQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSID........ 145
27 -14.7003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  15  2IDQKEKELIKES--EPNKNEIGLLFYANLKEEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNLEGIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE....... 133
28 -14.6004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  58LGQFPAPVVAQIRETTHQSELPGYFYEQMLQDEQAMLFLTHEKSRLHGTLRQWIVSVFSMSQALIAQ--QKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET.............. 187
29 -14.6004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  11VEQADPPIRAKAAEVAHAHYLSIEFYRIVRIDPHAEEFLSNEERQLKSAMERWIINVLSAQVDDVERQIQHTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS.............. 138
30 -14.4005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  11  18WGDGDERALRSLHGAPHFPRLAEEFYDRILGHEGARTALVGGVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV.............. 145
31 -14.3002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  11  1MTKEQIQIIKDC--QKNGEDLTNEFYKIMNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLEN-DKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEKK.... 136
32 -13.9004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  12  16SAHYSPHEWVAARNTANKAALADYFYESMLADPNAAFFLSDQKTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV.............. 145
33 -13.8002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  14  34FTAEDEEYIQKAGEEDQVEEILDTWYGFVGSHPHLLYYFTSPLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA.............. 177
34 -13.1001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  13  2LDQQTINIIKAT--KEHGVTITTTFYKNLAKHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPA-KKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVEAD.... 139
35 -12.7001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  12  3FTEKQDALVSSS--KANIPQYSVVFYTSIEKAPAAKDLFSPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK........ 142
36 -11.7001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  3LTESQAALVKSS--NANIPKHTHRFFILVEIAPAAKDLFSPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMDDAA.. 153
37 -11.3001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  3LSEDQEHYIKGVWKDVDHKQITAKALERVVVYPWTTRLFSKGVQQHADKVQRALGEAIDDLKKVEIN---QNLSGKHQEIGVDTQNFKLLGQTFMVELALHTFRPKEHAAAYKFFRLVAEALSSN....... 139
38 -10.9001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  12  2LSAAQRQVWKDIAGADNGAGVGKECLSKFSAHPEMAAVFGPGVAELGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQS.... 147
39 -10.6001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  11  2LSAAQRQVWKDIAGSDNGAGVGKECFTKFSAHHDMAAVFGPGVADLGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS.... 147
40 -10.2001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  11  2LSAAQRQVWKDIAGADNGAGVGKKCLIKFSAHPQMAAVFGPGVAALGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAQYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS.... 147
41 -10.1003mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  3WTQEERDEIVKTFFSANSSAIGTKALERMVVFPWTNAYFAKSASIHAAIVVGALQDAVKHEDDVKAE---VNISKAHAKLHIDPGSFHLLTDSFIVELAHLAFTPFVFAVWIKFFQVVIDAISSQ....... 134
42 -10.1001gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  3WTQEERDEISKTFQGTDMKTVVTQALDRMKVYPWTNRYFQKRSSIHAGIVVGALQDAVKHMDDVKTL---KDLSKKHADLHVDPGSFHLLTDCIIVELAYLCFTPHIQGIWDKFFEVVIDAISKQ....... 134
43 -10.1001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  10  13LTPAEKDLIRST--MTHRTGFVADVFIRIHNDPTAQRKFPQQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEGFTKQVHDAWAKTFAIVQGVLITKHAS.... 159
44 -10.1002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  13  13FGEEQEALVLKS--KKDAANLGLRFFLKVEIAPSAKQMFSPKLKTHAMSVFVMTCEAAAQGKVTVRETTLKRLGATHLRYGVADGHFEALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPDA.. 165
45 -9.9301eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  11  1LSADQISTVQAS---DKVKGDPVGILYAVKADPSIMAKFTAPFETHANRIVGFFSKIIGELPNIEAD---NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK....... 135
46 -9.9203qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  10FTEEQEALVVKS--KKNSAELGLKFFLKIEIAPSAKNLFSPKLKPHAMTVFVMTCESAVQLRKAGK----KRLGAIHFKNGVVNEHFEVTRFALLETIKEAMWSPEMKNAWGEAYDQLVAAIKSEMKPSS.. 161
47 -9.8203zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  9FTEEQEALVVKS--KKNSAELGLKLFIKIEIAPTTKKMFSPKLKPHAMSVFVMCCESAVQLRKTGK----KRLGASHSKYGVVDEHFEVAKYALLETIKEAMWSPEMKVAWGQAYDHLVAAIKAEMNLSN.. 160
48 -9.7601oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  10  1MERPEPELIRQS--SRSPLEHGTVLFARLALEPDLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKSAFTPATRAAWSQLYGAVVQAMSRGWDGE... 151
49 -9.7402bk9_A mol:protein length:153 CG9734-PA  ali model follow..  1MNSDEVQLIKKT--VATPTDSGAAILTQFNRFPSNLEKFPARFRAHAGRIIRVFDESIQVLGQDGDLE--TKIAVSHIPRTVSKESYNQLKGVILDVLTASSLDESQAATWAKLVDHVYAIIFKAIDDDGN. 151
50 -9.7301d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  11  14FSEEQEALVLKS--KKDSANIALRFFLKIEVAPSASQMFSPKLKTHAMSVFVMTCEAAAQLRKAGK----KRLGATHLKYGVGDAHFEALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE.. 166
51 -9.7304mpm_A mol:protein length:151 Neuroglobin  ali model follow..  10  1MERPEPELIRQS--SRSPLEHGTVLFARLALEPDLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCAFTPATRAAWSQLYGAVVQAMSRGWDGE... 151
52 -9.5902r4x_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGVSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
53 -9.5802oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  13  10FSEEKEALVLKS--KKDSANLGLRFFLKIEIAPSARQMFPPKLKTHAVSVFVMTCEAAAQGKITVRETTLKRLGGTHLKYGVADGHFEALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE.. 162
54 -9.5702c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  1MNSEEVNDIKRT--AAKMTEAGVEMLKRYKKYPHNLNHFPARFKTHGTRILRQVDEGVKALSVDFGDKK-KKLAQTHHEKKVERRSYNELKDIIIEVVCSVKLNEKQVHAYHKFFDRAYDIAFAEMAKMG.. 151
55 -9.5002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  4MERPESELIRQS--SRSPLEHGTVLFARLALEPSLLPLFQPEFLDHIRKVMLVIDAAVTNVEDLSS----TSLGRKHRAVGVRLSSFSTVGESLLYMLEKSDFTPATRTAWSRLYGAVVQAMSRGWDGE... 154
56 -9.5003uhc_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQAFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
57 -9.4704b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  11  9VSEEQQSLIMED--LPNYDDFVEDVLQQFEENPETFQIFPPRFKSHAKSIGKVISDCLVDLNGVKK----SSLGAMHTKKKVPTELFGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE........ 154
58 -9.4703uhb_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
59 -9.4501hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  13LTLAQKKIVRKT--MRNKTSFVTDVFIRIAYDPSAQNKFPRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAEDFNEKTRDAWAKAFSVVQAVLLVKHG..... 158
60 -9.4503uhd_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
61 -9.4503ugz_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVAAMTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
62 -9.4303ugy_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQNYIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
63 -9.4003at5_B mol:protein length:146 Beta-globin  ali model follow..  3FTQEERQFIVNLWGRVDVEQIGAEALARLIVYPWTQRFFSAKVHAHGKKVLTSFGEAVKNLDQIKQ---AQLSELHSDKLHVDPENFKLLGNILIIVLAAHDFTPASQAAWQKLVSAVAHALALR....... 144
64 -9.3902auo_A mol:protein length:146 Globin I  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----EKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
65 -9.3903uhi_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----ERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
66 -9.3903uh6_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSIALMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
67 -9.3702grf_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALVTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
68 -9.3602r4z_A mol:protein length:146 Globin-1  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
69 -9.3501hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  10LTADVKKDLRDS--GSDKKGNGVALMTTLADNQETIGYFKDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.......... 146
70 -9.2904g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  14  2LAEKTRSIIKAT--EQQGTVITRTFYKNMTEHTELLNIFNRTNQKVGAQPNALATTVLAAAKNIDDLSV-KQIGHKHRALQIKPEHYPIVGEYLLKAIKEVAATPEIINAWGEAYQAIADIFITVEKK.... 139
71 -9.2001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  13  2LDAQTIATVKAT--VETGPKLTAHFYDRMTHNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPA-EKIAQKHTSFQIKPEQYNIVGEHLLATLDEFSPGQEVLDAWGKAYGVLANVFINREAE.... 137
72 -9.0703qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  10FTEEQEALVVKA--KKNSAELGLQFFLKIEIAPSAKNLFSPKLKPHATTVFVMTCESAVQLRKAGK----KRIGAIHFKTGVVNEHFEVTRFALLETIKEAMWSPEMKNAWGVAYDQLVAAIKFEMKPS... 160

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.