current user: public

If you have questions about the server, please let us know.

Query: 5viu_A mol:protein length:419 Acetylornithine aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MAMSETKNSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRAFYNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLARKWSYEVKGIAENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYGPFTPGFIRIPYNDIAALEEVLSKEAGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKLIACHHEDVQPDILILGKALSGGMYPVSAVLANNNIMDVIKPGQHGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLIEKTDLITKVRGKGLLNAILINDTPDSSTAWNLCLALKENGLLAKPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEFLast
1 -112.0005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model  100  1MAMSETKNSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRAFYNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLARKWSYEVKGIAENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYGPFTPGFIRIPYNDIAALEEVLSKEAGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKLIACHHEDVQPDILILGKALSGGMYPVSAVLANNNIMDVIKPGQHGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLIEKTDLITKVRGKGLLNAILINDTPDSSTAWNLCLALKENGLLAKPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF 413
2 -110.0001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  61  32KTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDYENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKL--PSDVVTAVRGKGLLNAIVIKETKDWD-AWKVCLRLRDNGLLAKPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF 439
3 -110.0004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  50  12.DGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREYGKVPWIKEIRGRGLLNAVEVDSD--AIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV 420
4 -108.0004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  50  27.DGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRREYGKVPWIKEIRGRGLLNAVEVDSD--AIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV 435
5 -106.0003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  54  3.FVKELKSSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRAFFSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWGYEVKKIPENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFGPFVPNFLKVPYDDLEALEKELQD--PNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGEHGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVN--VWDICLKFKENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFF 410
6 -106.0003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  53  1.........KDIIELTDTYGANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRAFHSDQLGPWYEKVAKLTNKEMVLPMNTGAEAVETAIKTARRWAYDVKKVEANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGFGPMLPGIIVIPYGDLEALKAAIT---PNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKVFACDWDNVTPDMYILGKALGGGVFPISCAAANRDILGVFEPGSHGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEP-----ARPYCEQLKAAGLLCKETHENVIRIAPPLVISEEDLEWAFQKIKAVLS.. 392
7 -105.0001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  55  16.FVKDLKTPEDYINNELKYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRAFFSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWGYEVKKIPENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFGPFAPQFSKVPYDDLEALEEELKD--PNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKLLCVHHYNVKPDVILLGKALSGGHYPISAVLANDDIMLVIKPGEHGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVN--VLDICLKLKENGLITRDVHDKTIRLTPPLCITKEQLDECTEIIVKTVKFF 423
8 -101.0004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  34  7ASHMATEQTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLARHYACVRHS--PFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMD---DHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGGF-PVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGR-ARDFLYAGAEAGVMVLNAGADVMRFAPSLVVEEADIHEGMQRFAQAVGKV 412
9 -101.0004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  35  2.......SQPITRENFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRLAKKLIDATFADRVFFCNSGAEANEAALKLARKFAHDRYG--SHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPADIRHAAYNDINSASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGF-PVGALLATEECARVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNAD-YAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSEEEVTTGLDRFAAACEHF 400
10 -99.2002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  33  1...........MGSDKIMYLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKKS---EKKYRILSAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMS---EDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAKGLGGGV-PIGAVIVN-ERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVS---NREVATKCFENKLLVVPAGNNTIRFLPPLTVEYGEIDLAVETLKKVLQGI 391
11 -98.9001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  33  1METRTLEDWRALLEAEKTLDSGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEFYRTLTAILELNRVFPVNSGTEANEAALKFARAHT--------GRKKFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVD---EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGV-PLGVAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPK--IREVRGMGLMVGLELKEK----AAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKEDLERVVEAVRAVLA.. 395
12 -98.7003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  30  2..........KMDYKEQSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSNLYYNENIAAAAKNLAKASALERVFFTNSGTESIEGAMKTARKYAFNKG---VKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFKPLISGVKFAKYNDISSVEKLVN---EKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHAQILPDIMTSAKALGCGL-SVGAFVINQKVANSLEAGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKS---VKVAKVIQKCQENALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF 395
13 -93.4004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  32  28.HEEMKALNREVIEYFKEHVNPGGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLAKAYQS-----PRGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNETGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPLVQEARGKGMLMAIEFVDN---EIGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAM 452
14 -92.9002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  39  1.................TYLMNNYARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSNLYENPWQEELAHKLVKHFWTEKVFFANSGTESVEAAIKLARKYWRDKG---KNKWKFISFENSFHGRTYGSLSATGQPKFHKGFEPLVPGFSYAKLNDIDSVYKLLD---EETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIGRTGEFYAYQHFNLKPDVIALAKGLGGGV-PIGAILAREEVAQSFTPGSHGSTFGGNPLACRAGTVVVDEV--EKLLPHVREVGNYFKEKLKELG-----KGKVKGRGLMLGLELERE-----CKDYVLKALEKGLLINCTAGKVLRFLPPLIIQKEHIDRAISVLREIL... 375
15 -92.7005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  32  26.HEEMKALNREVIEYFKEHVNPGFLEYAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLAKAYQS-----PRGKFTFIATSGAFHGKSLGALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNETGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPLVQEARGKGMLMAIEFVDN---EIGYNFASEMFRQRVLVAGTLAKTIRIEPPLTLTIEQCELVIKAARKALAAM 450
16 -89.2004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  26  383AVIAQTPAREDTLDRYHQYINPKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPIQYISIPEQTAKLAEVLCRLANMGRVFFSNSGTEAVEAAMKIAKAS--------TGKPGIAYLRNSYHGKTLGALSITGRDKHRRYFTPLLDAMVEVPFGDLAALREALNR--EDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCRADLWQKARFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQFDQA----FTGAVNASAREFATRLPGDWHTTWKFLPDPVQ--AHLRAAMDRMEQALGEM 794
17 -88.9002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  23  10.LAGRPTTPDRVHEVLGRSMLVDGLDIVLDLTRSGGSYLVDITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKVYSVAMARFVETFARVLALPHLFFVEGGALAVENALKAAFDWKSRHNQAPALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPFDWPRIDAPYEALRQARAAFETRPHDIACFVAEPIQGEGGDRHFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGKKTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFPVVLDPRGRGLMCAFSLPTT---ADRDELIRQLWQRAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVV 448
18 -87.9001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  30  2......NSNKELMQRRSQAIPRGVGQHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCQVLAYEPYLELCEIMNQKVPGDKTLLVTTGSEAVENAVKIARAA--------TKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYREDDAIASIHRIFKNDPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGF-PLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDPDAKLTAEIVARARDKGLILLSCGYNVLRILVPLTIEDAQIRQGLEIISQCFDEA 424
19 -86.9004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  31  20.GAFPGPKSQALAERRSAVVAAGVASVPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCFMVTYEGYVAVTEQLNRLTPGDRTVLFNSGAEAVENAVKVARLA--------TGRDAVVAFDHAYHGRTNLTMALTAKAPYKTNFGPFAPEVYRMPMSYAKRAITMIEKGGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEWFAVDHEGVVPDIITMAKGIAGGL-PLSAITGRADLLDAVHPGGLGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAELSVVGDIRGRGAMLAIELVQPPNAELTKAVAAACLKEGVIILTCGGNVIRLLPPLVISDELLIDGLEVLAAAIKAH 455
20 -85.8002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  33  2.......LSRKIIEESDIYLATSTRDFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAANDFYNIPQLELAKKLVTYSPGNKVFFSNSGTEAIEASIKVVKNTG---------RKYIIAFLGGFHGRTFGSISLTASKAQRSIVGPFMPGVIHVPYPNIEFIEDYIFVNPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKLFAIENFNTVPDVITLAKALGGGIMPIGATIFRKDLD--FKPGMHSNTFGGNALACAIGSKVIDIV--KDLLPHVNEIGKIFAEELQGL------ADDVRGIGLAWGLEYNEK---KVRDRIIGESFKRGLLLLPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVV 418
21 -85.5003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  32  16ATAIPGPRSQALIDRKGTAVARGVGTMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDFTHTCFMVTYEGYVAVCEQLNRLTPDKRSALFNSGSEAVENAVKIARSH--------THKPAVVAFDHAYHGRTNLTMALTAKVPYKDGFGPFAPEIYRAPLSYAKRAITVIDKGADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAMFACEHEGIDPDLIVTAKGIAGGL-PLSAVTGRAEIMDSPHVSGLGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLQAEDDRIGDVRGRGAMIAMELVKAPDADLTKALCAGAHAAGVIVLSCGGNVVRFLPPLSIGDDLLNEGLDVLEEVLRG. 450
22 -84.8005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  24  3.LTVQKINWEQVKEWDRKYLMRTFSTQPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDRYGFVWDTYATDYKAKAAKIIIEDILGDKVRFVSTGSEAVETALNIARLY--------TNRPLVVTREHDYHGWTGGAATVTRLRSYRSGLSSYNSAVLMAPSPNVKYTRRMIEYGPEQVAAVITEVSQGAGSA-MPPYEYIPQIRKMTKELGVLWINDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVLVSKEIAAFMDKHRSVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKTPTQIIMKKALEKGVLIGGVMPNTMRIGASLNVSRGDIDKAMDALDYALDYL 468
23 -84.8003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  31  23VTAIPGPISQELQARKQSAVAAGVGVLPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTYEGYVKVAEHLNRLTPGDRTALFNSGAEAVENAVKIARAY--------TRRQAVVVFDHAYHGRTNLTMAMTAKNQYKHGFGPFANEVYRVPTSYAHALDLINKQGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGALFACEHENVVPDLIVTAKGIAGGL-PLSAVTGRAEIMDGPQSGGLGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVKPPDADLTKRVAAAAHAQGLVVLTCGGNVLRFLPPLSMPDHLLDEGLDILAAVFAEV 452
24 -84.7005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  24  15MTKQTSAQTQHWQALSREHHLAPFTDYARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLELPYYNLFTAHPPALELAKAIADIAPMNHVFFTGSGSESNDTVLRMVRHYWSIKG--KPQKKVVIGRWNGYHGSTVAGVSLGGMKALHSQGDLPIPGIVHIAQPYAEQLEKKIEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVIVRDEIVDTLNEGGHGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQELADHPLVGEARGVGMVGALELVKNKKTREGMLCREHCFRNGLIMRAVG-DTMIISPPLVITKPEIDELITLARKCLDQT 462
25 -84.7005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  24  3.LTVQKINWEQVKEWDRKYLMRTFSTQPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDRYGFVWDTYATDYKAKAAKIIIEDILGDKVRFVSTGSEAVETALNIARLY--------TNRPLVVTREHDYHGWTGGAATVTRLRSFRSGLVGENSAVLMAPSSNVKYTRRMIEYGPEQVAAVITEVSQGVGST-MPPYEYVPQIRKMTKELGVLWISDEVLTGFGRTGKWFGYQHYGVQPDIITMGKGLSSSSLPAGAVVVSKEIAAFMDKHESVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKTPTQIIMEKALEKGVLIGGAMPNTMRIGASLNVSRGDIDKAMDALDYALDYL 468
26 -84.2003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  25  3......LKNDQLDQWDRDNFFHPSTHLNRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQARELAYYHSYHGTEASITLAKMILDRAPMSKVYFGLGGSDANETNVKLIWYYNNILG--RPEKKKIISRWRGYHGSGLVTGSLTGLELFHKKFDLPVEQVIHTEAPYVAELEALIREGADTIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTMFGSDHYGLEPDIITIAKGLTSAYAPLSGSIVSDKVWKVLEQGTHGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEALSQHANVGDVRGEGLLCAVEFVKDRDSRTGPQISAKLLEQDKIIARAMGDILGFAPPFCLTRAEADQVVEGTLRAVKAV 456
27 -83.9003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  25  22.AATGGLTPEQIIAVDGAHLWHPYSSIPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGLTHEPAARLAKLLVDITGLDTVFFSDSGSVSVEVAAKMALQYWRGRG--LPGKRRLMTWRGGYHGDTFLAMSICDPHGMHSLWTDVLAAQVFAPQAYSAAFEAQLAQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGARGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTA-RALPAVTDVRVCGAIGVIECDRPVD---LAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLV 452
28 -83.8004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  25  15MNQQVNVAPSAAADLNLKAHWMPFSANPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGTLDYSPGFYGHPLSFQLAEKIAQMTPLDHVFFTGSGSECADTSIKMARAYWRIKG--QAQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGPLMDVDHLPH---ANELLKLILHDASNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFGRMGKATGAEYFGVTPDIMNVAKQVTNGAVPMGAVIASSEIYDTFMNQNHGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHGL-KGTKNVIDIRNCGLAGAIQIAARDGDAIPFEASMKLWKEGFYVRFGG-DTLQFGPTFNAKPEDLDRLFDAVGEALNGV 461
29 -83.7004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  32  19VTPLPGPRSGALAERRRAAVSAGGSTAPVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHFTHTCFMVTYEQYVQVAELLNALTPGDRTALFNSGAEAVENAIKVARLA--------TGRPAVVAFDNAYHGRTNLTMALTAKSPYKSQFGPFAPEVYRMPASYISRIETQIG--AQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFARTGAWFASEHEGIVPDIVTMAKGIAGGM-PLSAVTGRAELMDAVYAGGLGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVKPPDAALTKSIAAEALSQGVLILTCGGNVIRLLPPLVIGDDLLDEGITALSDIIRAK 449
30 -83.7003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  25  17.AATGGLTPEQIIAVDGAHLWHPYSSIPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGLTHEPAARLAKLLVDITGLDTVFFSDSGSVSVEVAAKMALQYWRGRG--LPGKRRLMTWRGGYHGDTFLAMSICDPHGMHSLWTDVLAAQVFAPQAYSAAFEAQLAQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTADVAHTISAGAHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTA-RALPAVTDVRVCGAIGVIECDRPVD---LAVATPAALDRGVWLRPFR-NLVYAMPPYICTPAEITQITSAMVEVARLV 447
31 -83.7003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  23  5.TITNHMPTAELQALDAAHHLHPFSANTRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRELPYYNTFTTHVPAIALAQKLAELAPLNHVFFAGGGSEANDTNIRMVRTYWQNKG--QPEKTVIISRKNAYHGSTVASSALGGMAGMHAQS-GLIPDVHHINQPNARELEEAIELGENRVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNWFGTQTMGIRPHIMTIAKGLSSGYAPIGGSIVCDEVAHVIGKDEHGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASRAGYICRERCFANNLIMRHVG-DRMIISPPLVITPAEIDEMFVRIRKSLDEA 452
32 -83.6003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  29  2.NAMKTKQTDELLAKDEQYVWHGMRPFTTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQTLSYFPMSQSHEPAIKLAEKLNEWLGEYVIFFSNSGSEANETAFKIARQYYAQKG--EPHRYKFMSRYRGYHGNTMATMAATGQAQRRYQYEPFASGFLHVTPPDVKEVDRVMWELSETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKAFGFMNYDVKPDIITMAKGITSAYLPLSATAVKREIYEAFKGKGHINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGIELVNDKETKEIASVVNACKEKGLIIGRNGNNILTLAPPLVISSEEIAFVIGTLKTAMERI 452
33 -83.4006erk_A mol:protein length:451 Aminotransferase  ali model follow..  28  9LYFQGHMTTVSTNDFDQQHLWHPYASLNIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGKMAHVMFGLTHQPAIDLGKKLLSIVGLDAIFYADSGSIAVEVALKMALQYQIAAKR--PSKCQFASTHSGYYGDTWHAMSVCDPNGMHSLYGKQLPMQHFVAAPPREALTEFFVKNSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFGRSGKLFACEHAAISPDIMTIGKALTGGYMTFAATLSTREIADTISQSDHGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPA-VSLEGVKEVRCLGAVAVIELNEAVD---MPIFQTLLINNGIWVRPFG-KLVYIMPPYVITDDELTTLCQALLKVVSSY 440
34 -83.3003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  26  10MGRGSMNKPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFRMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFVHLTCPHARELEETIREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHI-AERPNIGEYRGIGFMWALEAVKDKASKTSERIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKV 462
35 -83.3003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  30  27VTEIPGPASLELNKRRAAAVSGGVGVLPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQFTHTCFMVTYEQYVAVAEQLNRITPEKRTVLFNSGAEAVENSIKVARAH--------TRKQAVVAFDYAYHGRTNLTMALTAKSPYKSGFGPFAPEIYRAPVSYAERAINLIDKGAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGF-PLSAVTGRAEIMDAPHTSGLGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQAADDRLGDVRGRGAMIAMELVKSPDAALTQKLAAAAHAAGVIVLTCGGNVIRLLPPLTISDELLSEGLDILCQILAD. 461
36 -83.3004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  29  12.LMGKLDKASKLIDEENKYYARSINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAFHHVPGMELSEKLAKIAPGNMVSFGNSGSDANDAIIKFARAY--------TGRQYIVSYMGSYHGSTYGSQTLSGSSNMTRKIGPMLPSVVHVPYPDFNEFKKPFESPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKDPKTKEATKVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAV 446
37 -83.2003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  26  1.NMPEHAGASLASQLKLDAHWMPYTANPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLSTLDYSPGFYGHPLSFQLAEKITDLTPLNHVFFTDSGSECALTAVKMVRAYWRLKG--QATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQPMQDVDHLPHTLADELLKLILHDASNIAAVFVEPLAGSAGVLVPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAVIASTEIYQTFMNQPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHGI-KGAKNVIDIRNFGLAGAIQIAPRDGDAIPFEAGMALWKAGFYVRFGG-DTLQFGPTFNSKPQDLDRLFDAVGEVLNKL 447
38 -83.2003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  26  1...GMLNQSNELNAWDRDHFFHPSTHMTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNLAYYHAYHGTEASITLAKMIIDRAPMSRVYFGLSGSDANETNIKLIWYYNNVLG--RPEKKKIISRWRGYHGSGVMTGSLTGLDLFHNAFDLPRAPVLHTEAPYADKLEEMIAEGPETIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAKGLTSAYAPLSGVIVADRVWQVLVQGSHGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVADKDDRVGPQVATALAASGVIGRAMPGDILGFAPPLCLTREQADIVVSKTADAVKSV 456
39 -83.2004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  26  11.RGSHMNKPQSWEARAETYSLYGWTDMTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERFPGYHAAKMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGATAVSASMTGFP-YNSVFGLPLPGFVHLTCPHARELEETIREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHI-AERPNIGEYRGIGFMWALEAVKDKASKTSERIANTCTDLGLICFPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKV 462
40 -83.1003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  27  2.................SNVFYRSSKPYPVAVRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARLPFVHGSFSSDVLEEYAGRLARFVGTFRFWAVSGGSEATESAVKLARQYHVERG--EPGRFKVITRVPSYHGASLGSLAASGMGARRELYTPLMRPEAWPKLEDAEGLRALLREGPETVAAFMAEPVVGADAALAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGSPLALSRWGVTPDIAVLGKGLAAGYAPLAGLLAAPQVYETVMGGSHGFTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALQARFPQMMQVRGTGLLLGVVLGDLATGQAASRIGAAALKRGLITYPGSGDHLLLGPPLSITAAEVDGLLALLAGALEDV 428
41 -83.0004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  26  11.RGSHMNKPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERFPGYHAFRMSDQTVMLSEKLVEVSPSGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFVHLTCPHARELEETIREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNTWGCVTYDFTPDAIISSKNLTAGFFPMGAVILGPELSKRLETAIHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKHI-AERPNIGEYRGIGFMWALEAVKDKASKTSERIANTCTDLGLICRPLG-QSVVLCPPFILTEAQMDEMFDKLEKALDKV 462
42 -82.9005ghf_A mol:protein length:456 Aminotransferase class-III  ali model follow..  28  1....MTAQPNSLEARDIRYHLHSYTDAPLVIERGDGIYVEDVSGKRYIEAMSGLWSVGVGFSEPRLAEAAARQMKKLPFYHTFRSHGPVIDLAEKLVSMAPMSKAYFTNSGSEANDTVVKLIWYRSNALG--EPERKKIISRKRGYHGVTIASASLTGLPNNHRSFDLPIDRILHTGCPHADELEQLIAEGPHTIAAFIGEPVMGAGGVVVPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNLFGSQTFDMKPDILVMSKQLSSSYLPISAFLINERVYAPIAEESTGFTASGHPVAAAVALENLAIIEERDLVANARDRGTYMQKRLREL-QDHPLVGEVRGVGLIAGVELVTDKQAKTGAKANAVLQERGVISRAMG-DTLAFCPPLIINDQQVDTMVSALEATLNDV 450
43 -82.8004grx_A mol:protein length:465 Aminotransferase  ali model follow..  26  9.FEKGANQPQSWEARAETYSLYGFTDMTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRFPGYHAFRMSDQTVMLSEKLVEVSPNGRVFYTNSGSEANDTMVKMLWFLHAAEG--KPQKRKILTRWNAYHGVTAVSASMTGKP-YNSVFGLPLPGFIHLTCPHARELEDTIREGADTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFGRTGNTWGCLTYDFMPDAIISSKNLTAGFFPMGAVILGPDLAKRVEAAVHGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKRI-ADRPNIGEYRGIGFMWALEAVKDKPTKTSERIANTCTDLGLICRPLG-QSIVLCPPFILTEAQMDEMFEKLEKALDKV 460
44 -82.7003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  23  3LRNDATNAAGAVGAAMRDHILLPAQEMQPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVLPYASPWMATSPAARLAEKIATLTPLNRIFFTTGGSTAVDSALRFSEFYNNVLG--RPQKKRIIVRYDGYHGSTALTAACTGRTGNWPNFDIAQDRISFLSSPNVQEFEDRISLGPDTIAAFLAEPILASGGVIIPPAGYHARFKAICEKHDILYISDEVVTGFGRCGEWFASEKFGVVPDIITFAKGVTSGYVPLGGLAISEAVLARISGENNGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALASL-RDLPGVAETRSVGLVGCVQCLLDPTRADTLKIDERCFELGLIVRPLG-DLCVISPPLIISRAQIDEMVAIMRQAITEV 454
45 -82.7004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  25  1MNQPLNVAPPVSSELNLRAHWMPFSANPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFYGHPLSFQLAEKIAGLLPLNHVFFTGSGSECADTSIKMARAYWRLKG--QPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLM-DVDHLPHTLANELLKLILHDASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQAHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGL-QGAKNVIDIRNCGLAGAIQIAPRDGDPTPFEAGMKLWQQGFYVRFGG-DTLQFGPTFNARPEELDRLFDAVGEALNGI 447
46 -82.6001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  20  19KTEVPGPRSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIGYSHPALVKLVQQPQNVSTFINRPALENFVEKLRESLLSVAGMSQLITMACGSCSNENAFKTIFMWYRSKERGQCPDYSILSFMGAFHGRTMGCLATTHSKAIHKDIPSFDWPIAPFPREEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGKFWAHEHWGLDADVMTFSKKMMTGG-FFHKEEFRPN-----APYRIFNTWLGDPSKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPFISRVRGRGTFCSFDTPDE---SIRNKLISIARNKGVMLGGCGDKSIRFRPTLVFRDHHAHLFLNIFSDILADF 471
47 -82.4001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  25  2........TTDDLAFDQRHILHPYTSMVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMFGITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWQAKG---EARQRFLTFRNGYHGDTFGAMSVCDPDNMHSLWKGYLPENLFAPARDMVGFARLMAAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPA-RDAEMVADVRVLGAIGVVETTHPVN---MAALQKFFVEQGVWIAPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDE 424
48 -82.4005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  30  2......GSSYEKYKNAEKKFWHPMGSSTLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDELAYYQTFIAHPRVFDLAERLTGMFRMARVLFSSGGSDAVETALKMARQYWIASG--EPGRTRFLSLRNGYHGVHMGGTSVGGNGVYHYNHGQLLAGCHLLDTPWIRQLEEQILLGAQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFGRSGCMLGSRGWGVAPDILCLAKGITAGYIPLGATLFNQRIADAIENGQHGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLVERYAVVGEVRGKGLMIALDLVSDKRTRQPSRIADEARRAGVLVRPIG-NKIILSPPLTLTRDEAGLMVSALEAAFARC 451
49 -82.3001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  26  2........TTDDLAFDERHIWHPYTSMVYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDAMSHVMGEITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWDAKG---EARDRFLTFRNGYHGDTFGAMSVCDDNSMHSLWKGYLPENLFAPARDMVGFARLMAAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKLFACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISDGEHGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAPA-RDAEMVADVRVLGAIGVVETTHPVN---MAALQKFFVEQGVWIRPFG-KLIYLMPPYIILPQQLQRLTAAVNRAVQDE 424
50 -82.1005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  26  1.....QGMTTDDLAFDRRHIWHPYTSMVFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDAMSHVMFGITHAPAIELCRKLVAMTPLECVFLADSGSVAVEVAMKMALQYWQAKG---ESRQRFLTFRNGYHGDTFGAMSVCDPHNMHSLWKGYLAENLFAPARDMVAFARLMAAHRHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRLFACEHAGIAPDILCLGKALTGGTMTLSATLTSRQVAETISNGEHGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPA-ADSPQVADVRVLGAIGVVETTRPVN---IAALQQFFVRQGVWVRPFG-KLIYLMPPYIIQPEQLRRLTQAVNEAVREE 426
51 -81.7005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  28  11.RGSHMTSLEQLLEMDRAHFMHPSTHAGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQLAYYHTYHSNDPVIELSSRIIEDWGMKKVFYGMSGSDANETQIKLVWYYNNVLG--RPNKKKIIARERSYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVCPHVEELEKLIREGADTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKTGSEHYGIKPDLITVAKGLTSAYAPLSAVIVSEKVWDVIEKGSHGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMADKGARTSQKVAAAALEDGLIVRALPGDILGFAPPLVTTRAEVDEIVAIAKEAFDEV 468
52 -81.4001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  27  2....SLNDDATFWRNARQHLVRYGGTFPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSGMLSRPVVDLATRLANITPLDRALLLSTGAESNEAAIRMAKLV--------TGKYEIVGFAQSWHGMTGAAASATYS-AGRKGVGPAAVGSFAIPAPFLDYAFDLIDQSSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTMFACQRDGVTPDILTLSKTLGAGL-PLAAIVTSAAIEERAHELGFYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDRRTKEGAKITRECMNLGLSMNIVQGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA 432
53 -81.4005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  26  11.RGSHMTDFDQLFEQDRAHFMHPSTHAGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKELAYYHTYHSTEAIIELSSRIIRDWGMKKVYYGLSGSDANETQIKLVRYYNNVLG--RPQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFDLPVEGIKHTVCPHADELEKLIAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFGRLGSKMGSQRYGMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIEKASHGWTYSGHPICAAAALANLDILERENLTANAADVGAYLNQRLRETFEGHPLVGEVRGDGMLAALEFMADREARTGPKVSAACLEDGMIARAMPGDILGFAPPLVLTRAEADEIVGIAKAAVDEV 468
54 -81.3005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  29  24.LMGKLDKASKLIDEENKYYARSINYYNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAFHHVPGMELSEKLAKIAPGNMVSFGNSGSDANDAIIKFARAY--------TGRQYIVSYMGSYHGSTYGSQTLSGSSNMTRKIGPMLPSVVHVPYPDFNEFKKPFESPADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGKMWAIQQFDIEPDLMSVGKSLASGM-PLSAVIGKKEVMQSLDAPAHLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKDPKTKEATKVIYYAFAHGVVIITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAV 458
55 -81.1005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  27  11.RGSHMTDLDQLFEMDRAHFMHPSTHAGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKELAYYHTYHSTEAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKLVWYYNNVLG--RPQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFDLPIERIKHTVCPHADELEKLIAEGPDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFGRLGSKMGSQHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLRETFGGHPLVGEVRGVGMLAALEFMADKDARTGPKVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVGIAKQAVDEV 468
56 -81.1003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  29  2........THDLIEKSKKHLWLPFTQMPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGKIAHSTLLMTNVPATQLAETLIDISPLTRVFYSDSGAEAMEIALKMAFQYWKNIG--KPEKQKFIAMKNGYHGDTIGAVSVGSIELFHHVYGPLMFESYKAPIPYLRELAQLLEEHHEEIAALSIESVQGASGMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKMFACEHENVQPDLMAAGKGITGGYLPIAVTFATEDIYKAFYDDYHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQDL-HALPHVGDIRQLGFMCGAELVRSKETKEGYKVSLKMRELGMLTRPLG-DVIAFLPPLASTAEELSEMVAIMKQAIHEV 443
57 -81.0005dds_A mol:protein length:523 CrmG  ali model follow..  20  2....THPSGEPVYADAVLNGWLTSMGLGVEYVRAEGNTVYDDEGREVLDHACGFGSLIFGHNHPEIIAHAKAALDAGTVVHAQLSQPRANQISRILNDIMDRYNAIFANSGAEANEICMKHAELERQERDERRAERPLFLTLDGSFHGKLVGSIQLTQNEPWRTPFTALSSPARFLPADEPELIGKIVEDERPVVAAIFVEPVRGGSGMKTVTPELAEELHRLRDTLGCPLVVDEVQTGIGRTGAFFGSALLGIRGDYYTLAKAIGGGIVKNSVALIRQDRFLPAMEVIHSSTFAKDGLSASIALKVLEMVEADRVYQRVRERGQRLEAMLESVRADHSVVSAVWGTGLMLALELRDQSNATSYVLAGFLLREHHIRVLPAGSGFLRFSPSLYITDEEIDRTETALRSLFTAL 512
58 -81.0005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  27  11.RGSHMTSLDQLFEEDRAHFMHPSTHAGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYHSTDAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKIVWYYNNVLG--RPNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVCPHVEELEKLIREGADTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFGRLGSKMGAQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMADKDARTGPKVSAAALEDGVIARAMPGDILGFAPPLVTTRAEVDEIVGIVKQAVDEV 468
59 -80.8005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  28  11.RGSHMQSLDQLFEMDRAHFMHPSTHAGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQLAYYHTYHSTDAIIELSSRIIRDWGMKKVYYGMSGSDANETQIKLVWYYNNVLG--RPNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFDLPIDRVKHTVCPHVEELEKLIREGADTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSKMGSQHYGIKPDLITVAKGLTSAYAPLSGVIVGEKVWDVIEKGSHGWTYSGHPICAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMADKDARTGPKVSAAALEDGMIARAMPGDILGFAPPLVTTRAEVDEIVGIAKQAVDEV 468
60 -80.8005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  26  11.RGSHMTDYAKLFEQDRAHFMHPSTHAGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQLAYYHTYHASEAIIELSARIIRDWGMKKVYYGLSGSDANETQVKLVRYYNNVLG--RPQKKKIISRQRGYHGSGIVTGSLTGLASFHQHFDLPVEGVKHTLCPHAQELENLIAEGPDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFGRLGDKMGSQRHAMRPDLITTAKGLTSAYAPLSAVIVGEKVWDVIDSASHGWTYSGHPICAAAALANLDILERENITANAADVGGYLNQQLRQAFEGHPLVGEVRGDGMLAALEFMADREARTGPKVSAACLERGMIARAMHGDILGFAPPLVLSRAEADEVVGIAKAAVDAV 468
61 -80.8005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  27  11.RGSHMTDTDDLLEMDRAHFFHPSTHLGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKELAYYHTYHSNEPIIELSERIIREWGMSKVYYGMSGSDANETQIKLVWYYNNVLG--RPQKKKIISRQRGYHGSGIMTGSLTGLPAFHNHFDLPLEPIRHTTCPHADELEKMIAEGPDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFGRTGSMFGSHHYGMKPDLITVAKGLTSAYAPLSGVIVGEKVWKVLEQGSHGWTYSGHPICAAAALANLDIIERENLTGNAADTGAYFQQRMRETFGDHPLVGEVRGVGLMAALEFVADKDKRTGPRVSAACLEDGMIARAMPGDILGFAPPLVITRAEVDEIVDIAKQAVDAV 468
62 -80.2005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  24  9.PSRVPQTANDLLARRYATIGPHFYRQPLELVSGSGVWLTDAQGKVYLDGYNN--VPHVGHANPAVADAIYQQLLTVNLHTR-YLNSRVVEYAEALLSKFDLERLFLTNSGSEANELALRIARQH--------TGNTGVLVSDFSYHGNTTSLAEITTGLTVHEPLGAHVPVLLEQSLADVDAAIASLQAAGHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSMWGYQMFNVEPELVTMGKPMGNGH-PIGAVVTTAELLDEFRHNMFFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIAQRSGNVGSVRGRGLFFGIDIIESPAPALTKILIEDMRERGVLISRVGDNVLKMRPPLVFGREHADILLGQLELSLASL 438
63 -79.8004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  27  1..MQKQRTTSQWRELDAAHHLHPFTDTARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFTTHPAVVELSSLLAEVTPFDRVFYTNSGSESVDTMIRMVRRYWDVQG--KPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEQPWARWLEEKIEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKREGTLCRDIFFRNNLIMRACG-DHIVSAPPLVMTRAEVDEMLAVAERCLEEF 449
64 -77.7003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  27  4LVPRGSHMTKALYDRDGAAIGNKLRFFPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANPAGATILASNAPAVTLAERLLASFPGEKIWFGHSGSDANEAAYRAIVKA--------TGRSGVIAFAGAYHGCTVGSMAFSGHS--VQADAAKADGLILLPYPDLTLLTEKLAAPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCA-SAFAMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDRQSRETAKLIYRAYQLGLVVYYVGGNVLEFTPPLTITETDIHKALDLLDRAFSEL 432
65 -76.9005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  29  4......AMAGNLYGRDGAAIGSKLRFFPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANPAGASILASNAPAVALAERLTASFPGRKVWFGHSGSDANEAAYRAITRA--------TGRTGVIAFIGAYHGCTVGSMAFSGHS--VQADAAKADGLILLPYPDLALLKERLAAPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRLHCFEHEGFVPDILVLGKGLGGGL-PLSAVIAPAEILDCA-SAFAMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLAERHELIGDIRGRGLACGVELVRNRQSRETAKLIYRAYELGLVLYYVGGNVLEMTPPLTMTEDEVRHAVNLLDQAFTEL 426
66 -76.1004a0f_A mol:protein length:831 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  19  323......ERLNGMAKLAGEVFWWPYTQHKIDSRCGENFSIYKASLSQQFDACASWWTQGPDPTFAELAREMGYTAARFGHVMFPNVYEPALKCAELLLDGVGASRVYFSDNGSTAIEIALKMAFRKFCVDHNFKHIVVKVIALRGSYHGDTLGAMEAQAPSPYTGFLQPWYTGRGLFLDPPSKHLQEHSVRQSAHVGALIIEPVHGAGGMHMVDPLFQRVLVNECRNRKIPVIFDEVFTGFWRLGVETTTELLGCKPDIACFAKLLTGGMVPLAVTLATDAVFDSFSGDSHGHSYSAHAMGCATAAKAIQWFKDPETNHNITSQGKTLREELVQQISSHSAVQRVVVIGTLFALELKADASNSGAKSLLIMLREDGIFTRPLG-NVIYLMCGPCTSPEICRRLLTKLYKRLGEF 822
67 -55.9005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  21  13..REPGSAAADLFERARRVLPGGSAPYPPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLADGVAFAMP--TEHEIALAELLTEVPSLQQVRFTNSGTEAVMMAIKAARAY--------TGRPRIAKFDGCYHGSYDFAEVSTQSSGKPGE-QAVLDSVVVLPFNDIDGTERLIEQHRDELAAVLIDPNPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVIS---RSDYGGMQSVLGVTPDLTAMGKIIGGGF-PVGAVGGSAEVMSVFDPTGHGGTFNANPVTMVAGLTAMRKL-TPAEFDRLATLGQQLRAGVEEVLREAGVPGQVTGYGSLFHIHLHQRPERAFVGRVHEALMGRGIFITPALFGCLSTP-----GVPEVEAFVDAFAAALQDA 444
68 -55.3002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  21  51.SAGHHERARRSMPGGNTRSILFHRPFPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQ--TENEALFAEAVCDFPSIDLVRFTNSGTEANLMALATATAI--------TGRKTVLAFDGGYHGGLLNFASGHAPTN-------APYHVVLGVYNDVEGTADLLKRHGHDCAAILVEPMLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS--RLSGGGAQEMLGISADLTTLGKYIGGGM-SFGAFGGRRDLMERFDPARHAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIAVENQAPLQFTGLGSLGTIHFSRAPDQQLKELFFFHMLRKGIYLAPRGMYAL----SLEIADAGRDAFAEALADFIGEQ 454
69 -55.2002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  23  14.SVFWAQRARSVMPDGVTADTRAFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAAS--HPLEVRWAERIVAFPSIRKLRFTGSGTETTLLALRVARAF--------TGRRMILRFEGHYHGWHDFSASGYNSHFDGQPAPGVLPETLLIRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGL-PGGILGGREDVMGVLSRGSHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPPDVKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRL 435
70 -55.1006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  23  14.SVFWAQRARSVMPDGVTADTRVFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAAS--HPLEVRWAERIVAFPSIRKLRFTGSGTETTLLALRVARAF--------TGRRMILRIATHYHGWHDFSASGYNSHFDGQPAPGVLPETLLIRPDDIEGMREVFAQHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGF-RVGNHGMQALLDVQPDLTCLAKASAGGL-PGGILGGREDVMGVLSRGSHQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPPDVKMIAAMRMALILEGVDIGGRGSVFLSAQ-----EREHVEHLVTTFDRVLDRL 435
71 -54.4006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  21  3.....SSSSENLYFQGGGHMTKNSSDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDA-VLERLHALCGGEVVGLFRSGTAAVRAAVLAVREA--------TGRPLLL--SAGYHGYDPMWYPSEAPLEPNA-------DGVVDFFFDLGLLRELLRA-PERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV--SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEE---LEEALYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERL 387
72 -54.1006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  20  3.....SSSSENLYFQGGGHMTRDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTA-WSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVR----------DARDRSIVLSSGYHGYDPMWHCDEPFTPNQHGI--------VEFLFDLDVLAEWLSR-PEQVAAVVISPDHMHLG-----ERWYTEFTRLTKEADVPVIADEVKVGL-RYRA--GLSTPLLDPAVWIVAKCLANGS-PVAAVGGDAHLLAALEDV--SFTSYFEPTAMAAATTTLRRMATGEPQQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDE---VADAFHAAAAAEGLLFFEGDNQTPSAA-----TDEVVEDACGRIDRVSAAL 388
73 -54.1002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  23  5..PFKTIKSDEIFAAAQKLMFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAP--CALENVLAEMVNDAVSIEMVRFVNSGTEACMAVLRLMRAY--------TGRDKIIKFEGCYHGHADMFLVKAGSGVATLGL-PSSPGVLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGF-RIAYGGVQEKFGVTPDLTTLGKIIGGGL-PVGAYGGKREIMQLVAPAGQAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGPDLQKFSRFHRGMLEQGIYLAPSQFEAGFTS--LAHTEEDIDATLAAARTVMSAL 432
74 -54.1006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  21  2.......TKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDA-VLERLHALCGGEVVGLFRSGTAAVRAAVLAVREA--------TGRPLLL--SAGYHGYDPMWYPSEAPLEPNA-------DGVVDFFFDLGLLRELLRA-PERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPG--LSTAELLAPDVWVVAKGMANGH-AVSAVGGSRRLLKPLKEV--SFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEE---LEEALYGAANAEGLLFYAGDNQGVSAA-----DEAVLGEAERRFARVCERL 371
75 -54.0004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  22  38.SQRQFEAQARYMPGANSRSVLFYAPFPLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGH--NLLEGRLARLICEFPQIEQLRFTNSGTEANLMALTAALHF--------TGRRKIVVFSGGYHGGVLGFGARPSPTT-------VPFDFLVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS--RLAPHGLANKLGIRSDLTTLGKYIGGGM-SFGAFGGRADVMALFDPRTHSGTFNNNVMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDDGRLRQLLFFHLLNEDIYSSPRGFVVL----SLPLTDADIDRYVAAIGSFIGGH 440

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.