current user: public

If you have questions about the server, please let us know.

Query: 5vye_A mol:protein length:346 L-threonine aldolase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MTDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERASEYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMPEHAIEALRAKGWRFYTFIGSGGARFMCSWDTEEERVRELAADIRSIITALast
1 -125.0005vye_A mol:protein length:346 L-threonine aldolase  ali model  100  1MTDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERASEYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMPEHAIEALRAKGWRFYTFIGSGGARFMCSWDTEEERVRELAADIRSIITA 346
2 -111.0001v72_A mol:protein length:356 Aldolase  ali model follow..  44  6.RPPALGFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVDVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEMTWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSAMIDALLKAGFGFYHDRGPNVVRFVTSFATTAEDVDHLLNQVRLAAD. 351
3 -111.0001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  28  12.KPKPYSFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAARLIGELLERPADVHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEATGH--KVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLADIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLFFELGAHSNKMAAILKAGLEAC-GIRLAWPSASNQLFPILENTMIAELNNDFDMYPLKDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS 357
4 -105.0003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  22  5...RYIDLRSDTVTQPTDAMRQCMLHAEVGDD-VYGEDPGVNALEAYGADLLGKEAALF-VPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIA--PDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELV--APFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQ--HVVRLADDHRRARQLAEGLAALPGIRLLAQVQTNMVFLQLTSGESAPLLAFMKARGILFGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA 341
5 -100.0003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  23  1....MIDLRSDTVTRPSRAMLEAMMAAPVGDD-VYGDDPTVNALQDYAAELSGKEAAIF-LPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIK--PDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEIT--QYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDN--AAWMAEQLREAGA--DVMRQDTNMLFVRVGEENAAALGEYMKARNVLIASPIVRLVTHLDVSREQLAEVAAHWRAFLA. 332
6 -98.9004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  22  1....MIDLRSDTVTRPSRAMLEAMMAAPVGDD-VYGDDPTVNALQDYAAELSGKEAAIF-LPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDD--IHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKEIT--QYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQEDHDN--TAWMAEQLREAGA--DVMRQDTNMLFVRVGEENAAALGEYMKARNVLIASPIVRLVTHLDVSRAQLAEVAAHWRAFLA. 332
7 -94.6002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  22  4.DKIMIDLRSDTVTKPTEEMRKAMAQAEVGDD-VYGEDPTINELERLAAETFGKEAALF-VPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGV-MPHPVPGKNGAMDPDDVRKAIRPRNHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE--YAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHEN--ARFLALKLKEIGYSVNPEDVKTNMVILRTDNGFIEALRNSGVLANAV-SDTEIRLVTHKDVSRNDIEEALNIFEKLFRK 347
8 -78.4003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  15  10...QQTTGQISGHGKRNVGVLKTAFAAVADESDQYGTGAIIEPFEQKFADVLGMDDAVF-FPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQDGLKELHPI-ETILVGAADRLMTLDEIKAL-------PDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAE--IAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRM--GQYYEQAKQLAEQFNALPGVHTPEVPVSNMFHLHFDPKLEQVQEETGLGFVGYLVDKDGYCSTEISVGDAYGELDQQTRDAGFAR 351
9 -75.0003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  16  9SYQKTPYKLGGNGPRNVGVLTEALQNIDDNESDIYGNGAVIEDFETKIAKILGKQSAVF-FPSGTMAQQIALRIWAKENRRVAYHPLSHLEIHEQDGLKELQQ-ITPLLLGTANQLLTIDDIKSL------REPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEE--ICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEA--AKGLAERFNSCSGVKTPEVPVSNMFHVYFEGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPALELVFRC 354
10 -50.0001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  12  41.KDIYIDLLTDSGTNAMSDKQWAGMMMG---DEAYAGSENFYHLERTVQELFGFKHIVP-THQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGGDIDLKKLQKLI-DEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQEQGFEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEQVRYLGDKLKAA-GVPIVEPVGGHAVFLDAEHLTQDEFPAQSLAASIYVETGVVRLTIPRRVTYAHMDVVADGIIKLYQH 430
11 -48.7006MME Entity 1(prereleased)  ali follow..  12  41.KDIYIDLLTDSGTNAMSDKQWAGMMMG---DEAYAGSENFYHLERTVQELFGFKHIVP-THQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGGDIDLKKLQKLI-DEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQEQGFEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEQVRYLGDKLKAA-GVPIVEPVGGHAVFLDAEHLTQDEFPAQSLAASIYVETGVVRLTIPRRVTYAHMDVVADGIIKLYQH 430
12 -48.0001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  13  41.KDIYIDLLTDSGTNAMSDKQWAGMMIG---DEAYAGSENFYHLEKTVKELFGFKHIVP-THQGRGAENLLSQLAIKPGQYVAGNMTTTRFHQEKNGATFVDIVRDEAHDASLNGDIDLNKLATLI-KEKGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQEAGYEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYERVKQVRYLGDKLREA-GVPIVEPTGGHAVFLDARRFCPHQFPAQSLAASIYMETGVVRLTIPRRVTYAHMDVVADGIIKLYQ. 429
13 -47.7002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  14  44.EDVFIDLLTDSGTGAVTQSMQAAMMRG---DEAYSGSRSYYALAESVKNIFGYQYTIP-THQGRGAEQIYIPVLIKKREQEKGLDRSNYFFDTTQGHSQINGCTVRNVYIKEKGNFDLEGLERGIEEVGPNN-VPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQREAEYETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQ--VQYLVDGLEEIG---VCQQAGGHAAFVDAGKLACELYKVAGIRAVE-CPAELLRLTIPRATTQTHMDFIIEAFKHVKE. 444
14 -47.3001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  12  39LPSSAVYIDLLTDSGTNAMSDHQWAAMITGDE-AYAGSRNYYDLKDKAKELFNYDYIIP-AHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFTAAHVELNGCKAINIVTEKKGDFDIKKLKENIAQHGA-DNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARDPKYDMYKYADALTMSAKKDPLLNIGGLVADNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHYRVKYLGDRLREA-GIPIQYPTGGHAVFVDCKK-INALYLESGVRAVE-ADMEFMRLTIARRVTNDHMDYIADALIGLKE. 439
15 -28.9003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  15  33......NIFGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLNKDAYGHIVSGGTEANLMALRCIKNIWREIIVPITAHFSFEKG---REMMDLEYIYAPIKEDYTIDEKFVKDAVEDY-----DVDGIIGIAGTTELGTI---DNIEELSKIAKENNIYIHVDAA-FLDDKYKKKGVNYKFDFSLGVDSITIDPHKMGHCPSGGILFKDIGYKRYLDVDAPYLTETRTRVGFGGACTYAVLRY--QRKIVNECMENTLYLYKKLKENNFKPVIEPILNIVAIEDEDKEVCKKLRDRGIYVSVCNCVKALRIVVMPHIKREHIDNFIEILNSIKR. 396
16 -26.3005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  11  65.......FCQTYMEPEAVELMKDTLEKNAIDKSEY---PRTAEIENRCVNIIAESFTGTSTIGSSEACMLAGLAMKFAWRKIVISAGYQVCWEK--FCVYWDIDMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARL---DAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELKWDFRNNVISINASGHKYGLVYPGVVIWRDQQYLPKELVFKPTMAINFSHSASQLIGQYYNFIR--YREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELTDLSDRLLMKGWQVPTYPLPKNMRIVVRADFGMSMAHDFIDDLTQAIH. 446
17 -26.3004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  11  96.........EEKLTELLVKAYGDFAWSNPLHPDIF---PGLRKIEAEIVRIAGPDSCGCVTSGGTESILMACKAYRDLAFEIVAPQSAHAAFNKA---ASYFGMKIVRVPLTKMMEVDVRAMRRAISRN------TAMLVCSTPQFPHGVI---DPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPKGVTSISADTHKYGYAPKGSVLYSDKKYRNYQIYASPTIAGSRPGGISAACAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDRLSNLMTAKGWNLNQLQFPPSIHFITLLHARKRVAIQFLKDIRESVTQ 453
18 -25.7005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  13  45LTREFINLNPIQRGGILPEAKKAVYEDYCHGRLDEVTCPPIKDFLEDIAKFLNMD-CARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNLEDKG-KNVGLILLTHDGEYGNLND---AKKVGKIAKEKGIPFLLNCAY---TVGRMPVNGKEV----KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEMLGCTSRGLPIVTASFPHVVERV---KKWDEELKKTRYVVDELEKIGFKQLGIKPKHDLIKFETPV-FYDELKKRGIGGIRAGVTKEIKMSV-YGLEWEQVEYVVNAIKEIVE. 408
19 -25.0002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  106.....................IGRSGNLVDPQPKASGASIMYALTNKIFKQLGVHAIATPISTGMSISLCLSAARKKYGSVVIYPYASHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEIELGNR-PCVLSTLTFFPPRNS---DDIVEIAKICENYDIPHIINGA--YAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGVYSTDAEFIKEISLSYPGRASATPVVNTLVS--LLSMGSKNYLELVKNQKNSKKLLDELLNDLSGGKFLDVESPIASCISVNSDGIKKTDHFGNCYLGTYTHDYIVMNAAIGVRTEDIVNSVSKLEKIL.. 449
20 -24.0003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  15  113.........DEHHIAFLNEVYALQSQSNPLHPDLW---PSTAKFEAEVVAMTGGTVCGTVTSGGTESLLLAMKTYRDWARAAVVPVSAHAAFDKA---AQYFGIKLVRTPLDADYRADVAAMREAITPN------TVVVAGSAPGYPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFDFREGVTSVSADTHKYGYGATSVILYRRPDLLHYQLYFSPTFAGSRPGALSATAAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDEYQVMEEMAGRGWRLNGLHRPPAFHVLTLRHTEPGVVDRFLADLQDAVAQ 472
21 -23.9002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  13  117...................AAEAMIAALNQSMDSWDQASSATYVEQKVVN-LSEKADGIFTSGGTQSNQMGLMLARDW--RIVCSKKSHFTVQKSASWMGLGEKAVMTVDANADGTMDITKLDEVIAQAKAEGLIPFAIVGTAGTTDHGAI---DDLDFIADMAVKHDMWMHVDGA--YGGALILSSHKSRLKGVERAHSISVDFHKLFYQTCGALLVNDKSNFKFLLHHADYLNRALKVFMTMQNVGPKALGDMY-----DHLLAQTLEVADMIRTNDQFELLAEPSLSTVLFELNKALRLEALTRGIAVLGETGKTALKFILNPCLTTSDFESLLSKINML... 492
22 -23.6004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  15  104...................LGDLVAAAVNNNMLSLEMSPSFSRLETLLLR-LGEQAGGVLTSGGSLANLQALAVARNV--VIFASEAAHTSLQKAAMLLGLGTAAVIPVRATADSRMDPEDLRARIDQARGAGQHPFCVVATAGTTTTGNI---DPLAEIGAIAREHGLWFHVDAA-YGGALVFSERHRWRLAGIEQADSITFNPQKWLYVACAMVLFRDAGVLERAFRIPARHADVVKLWLTLQHIGQQGYARLI-----DDGYRLAERVVEGVRQRPFLRLAGEIDTNIVCFDWNAALQALLLREGKIFLSLPGGRWLRALLNPYTTDAVIDAMFKQIDRFAGR 480
23 -23.6001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  14  13GLANKTYFNFGGQGILPTVALEAITAGPFSIAANQHIQQLIAQLRQALAETFNVDPTITITDNVTTGDIVLWGLDWHQGDEILLTDCEHIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGP-------KTRLVILSHLWNTGQVLP---LAEIMAVCRRHQVRVLVDGAQ---SAGSLPLDFSRL----EVDYYAFTGHKWFAGPAGGGLYIHGDCLGEIN--KRFEVATSAYPQYLLAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTRAIVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADF... 388
24 -23.5005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  15  109.........DEHHIAFLNEVYALQSQSNPLHPDLW---PSTAKFEAEVVAMTGGTVCGTVTSGGTESLLLAMKTYRDWARAAVVPVSAHAAFDKA---AQYFGIKLVRTPLDADYRADVAAMREAITPN------TVVVAGSAPGFPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFDFREGVTSVSADTHKYGYGAKGTILYRRPDLLHYQYFIAASPTFAGSRPGALSATAWAAMLS--YLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDEYQVMEEMAGRGWRLNGLHRPPAFHVLTLRHTEPGVVDRFLADLQDAVAQ 468
25 -23.3005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  13  61.........DHEHYAFLNEAYGLFSHVNALQRDLC---PSMNRMESEIVAMTAHRACGALSLGGTESILNATLAYREKARAMIWPASAHPAFRK--AAHLFGFDVTVAPIDPVTMQVDADFVRDAVDAN------TVMLVGSACNYPYGTI---DPIGALSAIAVEKDVWLHVDGC-LPWGEALGYPDIPAFDFRPGVTSISADTHKFGYGPKGGLAWRDASFRRHQVYGSPGLTGSRSGGLIAATAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGKPTFCFAFTS-IYHVNDFMRQRGWRFNGLQHPDALHMVTGPQTQPGVAERFRQDLGEAVEH 427
26 -23.2004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  13  109...................LGDIMTSAYNIHAGGSKLAPMVNCIEQEVLK-FTENPGGVFVSGGSMANITALTAARDN--TAYISDQTHSSVAKGLRIIGITDSRIRRIPTNSHFQMDTTKLEEAIETDKKSGYIPFVVIGTAGTTNTGSI---DPLTEISALCKKHDMWFHIDGA-YGASVLLSPKYKSLLTGTGLADSISWDAHKWLFQTCAMVLVKDIRNLFHSFHVNPRPARGLKLWLTLQVLGSDLIGSAI-----EHGFQLAVWAEEALNPKKDWEIVSPAQMAMINFILNEKISHRILESGYAAIFTTGKTVLRIAIHPEATQEDMQHTIDLLDQYGRE 482
27 -23.1004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  12  114.................TELLKEVYGATALTNPLHDKWPRINAMQAEVIRWCSKEGYGLLTHGGTTSIIEAMAAYVIRARAIVVPETAHAAFKK--AAELTGAILITVPVDKKTGAVNPNVMSSYITRN------TAVMVGSAPSFMNGIH---DPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMDFRPGVTSISADLHKYGCCPKGTCLFSEDSPALSVYAALNWSGGLYSGARVAEVATLSYYGKNKYQEIAKSIIRLRNAIQKELTALEDIYVYGNPQWSILGFRSNTFIADELEKRGWKLNLLQNPDGFHLCLVHTLVGSFETQFIKDLREAVID 473
28 -23.1003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  12  64...........VTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAETAVGVGTVGSSEAIMLAGLAFKRKW-NIVTGANVQVCWEK--FARYFEVELKEVKLSEGYYVMDPQQAVDMVDEN------TICVAAILGSTLNGEF---EDVKLLNDLLVEKNKEIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIVIWRNKELPEELIFHINYLGADQPTFTLNFSKQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPLVAFSLKEISDMLRRYGWIVPAYTMPPNLRVVIREDFSRTLAERLVIDIEKVMR. 442
29 -23.1001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  13  60....LATFCQTWDDENVHKLMDLSINKNWIDKEEY---PQSAAIDLRCVNMVPAPKNGQAVGTNTIGSSEACMLGGMAMKPNLVCGPVQICWHK--FARYWDVELREIPMRPGQLFMDPKRMIEACDEN------TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA-SGGFLAPFVAPDIVWDFRPRVKSISASGHKFGLAPLGCVIWRDEEALPELVFNVDYLGGFSRPAGQVIAQYYEFLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVC-DLSERLRLRGWQVPAFTLGGVMRIMCRRGFEMDFAELLLEDYKASLKY 447
30 -22.9001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  13  63.......FCQTWDDENVHKLMDLSINKNWIDKEEY---PQSAAIDLRCVNMVPAPKNGQAVGTNTIGSSEACMLGGMAMKWNLVCGPVQICWHK--FARYWDVELREIPMRPGQLFMDPKRMIEACDEN------TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA-SGGFLAPFVAPDIVWDFRPRVKSISASGHKFGLAPLGCVIWRDEEALQELVFNVDYLGGFSRPAGQVIAQYYEFLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVC-DLSERLRLRGWQVPAFTLGGVMRIMCRRGFEMDFAELLLEDYKASLK. 446
31 -22.8005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  13  120...................LAEQIMAAVNSSVDTWDQSAGGTLIEQKVID-LPAGADGIFTSGGTQSNLMAMLLARDSW-RVFTSKLSHFSIQKSMAILGLGYDAVIPVDYDERYRMDVDCLKQEVQRCLQQGLIPVAVVATSGTTDFGSI---DPLGAISELCKHHGMWMHVDAA-YGCGLLVSESHRPRLAGIEKADSVTVDYHKSFFQTCGAFFVRDKHHLSHVTHHADYLNPLSAQQETLRVSGPMALGNAF-----DDILALTQIAHQLLNAHPAIEVLHVPELTTQIFEINTNIRKAVFRSGNAVIAGTGRQYLKFLLNPNTTAADIEDVIALIVHY... 504
32 -22.2003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  12  90...................LADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELVIQGSASEATLVALLAARTK--VAYSSDQAHSSVERA---GLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSF---DNLLEVGPICNKEDIWLHVDAA-YAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNCSAMWVKKRTDLTGAFRLDPPLGRRFRSLKMFRMYGVKGLQAYI-----RKHVQLSHEFESLVRQDPRFEICVEVILGLVCFKVNEALLQRINSAKKIHLVPCDKFVLRFICSRTVESAHVQRAWEHIKELAAD 473
33 -22.1002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  14  23.................EEARQALLECTTGRLDEIKTPPIHDFIHNQLPKFLGCD-VARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYVAAERAGLNI----ALVPKTDYPDYAITPENFAQTIEETKKRGEVVLALI-TYPDGNYGNL---PDVKKIAKVCSEYDVPLLVNGA---YAIGRMPVSLKEI----GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVEGCTARGATIITLMASFPHVREDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEELKSRKIHGIKPGLTRYFK-LSTYGLSDEEVDYVLNAFKEIIE. 368
34 -22.1001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  13  90...................LADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLVIQGSASEATLVALLAARTK--VAYASDQAHSSVERA---GLIGGVKLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSF---DNLLEVGPICHEEDIWLHVDAA-YAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNCSAMWVKRRTDLTGAFKLDPPLGRRFRSLKMFRMYGVKGLQAYI-----RKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFGLNEALLERINSARKIHLVPCGQFVLRFICSRKVESGHVRLAWEHIRGLAAE 473
35 -22.0003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  13  77.........GDDLIHLQTIAYEKYCVANQLHPDVF---PAVRKMESEVVSMVLRTGCGTTTSGGTESLLLACLSAKMYA-EIIAPVTAHAGFDK--AAYYFGMKLRHVELDPTTYQVDLGKVKKFINKN------TVLLVGSAPNFPHGIA---DDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYK---VPGVTSISCDTHKYGFAPKGSIMYRNSDLRMHQLYGSPTLAGSRPGAIVVGCATMVNMGENGYIESCQEIVGAAMKFKKYIQENPDLDIMGNPRYSVISFSSKTELSDRLSKKGWHFNALQKPVALHMALSAHVVDEICDILRTTVQELKS. 439
36 -22.0004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  13  95...................LGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLVLQSTVSESTLIALLAARKN--VAYASDQAHSSVEKA---GLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAF---DCLSELGPICAREGLWLHIDAA-YAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHCTGFWVKDKYKLQQTFSVNPPLSRRFRSVKLIRSFGVKNLQAHV-----RHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFSLTENVLKEIAKAGRLFLIPADKLIIRFVTSQFTTRDDILRDWNLIRDAATL 477
37 -21.5002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  15  119...................AGRIITESLNTSQYTYEIAPVFVLMEEEVRALVGSSGDGIFCPGGSISNMYAVNLARYQ--ALFTSKECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAF---DPLEAIADVCQRHGLWLHVDAA-WGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDMWKAQGDQGLERRI-----DQAFVLARYLVEEMKKREGFELVMEPEFVNVCFKVAPVLKERMVKEGSMMIGYQRGNFFRVVANSALTCADMDFLLNELERL... 505
38 -21.5006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  14  106...................LGELLCSGLSVIGFTWSSSPAATELENVVVDWMAKMLNLVLQANTCEAVLCTLAAARDK--VLYCSDQTHFTIHKGAKLIGIRSKNIKSITTKKENKLCPNDLRDAIRSDLEAGLVPFYVCGTIGTTALGVV---DPIKELGKVAREFDLWLHVDGA-YGGSACICPEFQHYLDGVDLVDSISMNAHKWLLSNCCFLWLQSPNALIESLAAEASLSRRFRAIKMIRRYGVSNLIEHI-----RSDVSMAVRFEEMVAADDRFEIVFPRKFALVCFELTRELMERVNSSGKAYLSGVRIFFIRCIGSSLTEERHVDNLWRLIQETAQS 487
39 -21.2003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  12  90...................VADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELVIQGTASESTLVALLGAKAK--VGYCSDQAHSSVERAGLLG----GVKLRSVQSENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAF---DYLDECGPVGNKHNLWIHVDAA-YAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNCSAMWLKDPSWVVNAFNVDPPLGRRFRALKLLRLYGVENLQAHI-----RRHCNFAKQFGDLCVADSRFELAAEINMGLVCFERNEALLKRINGRGHIHLVPADVYFLRMICSRFTQSEDMEYSWKEVSAAADE 470
40 -21.2006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  15  134...................AARIITEALNPSIYTYEVSPVFLLVEEAVIECVGKEGDGIFNPGGSVSNMCAMNLARYR--ILFTSAECHYSMKKAASFLGIGTQNVYFVETDGRGKMIPEDLEKQIWQARQEGAVPFLVCATSGTTVLGAF---DPLDEIAEVCERHGLWLHVDAS-WGGSALVSRKHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKSDLLKKCYSAKATYLFQQDTWKALGTSGLEERV-----NRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFLVAPAIKEKMMKKGSLMLGYQKVNFFRQVISPQVSREDMDFLLDEIDSL... 520
41 -21.1006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  14  101...................LGEMLSAGLGIVGFSWVTSPAATELEMIVLDWVAKLLNLKGNGGGVIQGSASEAVLVVLIAAVYSSDQTHSALQKACQIAGIHNCRVLTTDSSTNYALRPESLQEAVSRDLEAGLIPFFLCANVGTTSSTAV---DPLAALGKIANSNGIWFHVDAA-YAGSACICPEYRQYIDGVETADSFNMNAHKWFLTNCSLLWVKDQDSLTLALSTNPPLGRRFRSLKLLRLYGSETLKSYI-----RNHIKLAKEFEQLVSQDPNFEIVTPRIFALVCFNRNRELLDAVNSSGKLFMSHTGKIVLRCIGAPLTEEKHVKEAWKIIQEEASY 486
42 -21.0002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  13  105...................AADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWIFSPGGAISNMYAMMIARFK--IAFTSEHSHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAF---DPLLAVADICKKYKIWMHVDAA-WGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPCSALLVREEGLMQNCNQMHARHVDVFKLWLMWRAKGTTGFEAHV-----DKCLELAEYLYNIIKNREGYEMVFDGKPQHTNVKVAPVIKARMMEYGTTMVSYQKVNFFRMISNPAATHQDIDFLIEEIERL... 494
43 -20.9005i90_A mol:protein length:427 PvdN  ali model follow..  13  49LDPQYLHFANFLLTSHPRPVREAIERLRVRFDRNPGEWKYEDEARAWAGRYFAVQPQVALTGSTTDGAAIYGGLLVQPGKEILTSSHEHYSTYTTLEYRHKRMGTQVREFPKDPHRVSADEILSSIAAQ----RPQTRVLGMTWQSGSGVKLPIREIGKLVR-DEQDRIIYVVDGVH---GFGVEDVSFADF----DCDYFIAGTHKWLFGPRGGVIIARSEQLQEH---LMTPGGYHAFEHRLALGTAFELHLQLGKEVQARIHQLNAYLKQRLGEHPKVRLVTPTSSGFTFFRVCEAVAKHLMAHRVISDAVDVGPVVRLAPSLLNDEAEIDRVLEILAPQLA. 427
44 -20.6006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  14  111...................LGEMLSTALNSVGFTWVSSPAATELEMIVMDWLAQILKLSGTGGGVIQNTTSESILCTGKLVCYGSDQTHTMFPKTCKLAGIYPNNIRLIPTTVETGISPQVLRKMVEDDVAAGYVPLFLCATLGTTSTTAT---DPVDSLSEIANEFGIWIHVDAA-YAGSACICPEFRHYLDGIERVDSLSLSPHKWLLAYCTCLWVKQPHLLLRALTTNPATGRKFRSLKLLRSYGVVNLQSHI-----RSDVAMAKMFEEWVRSDSRFEIVVPRNFSLVCFEVNKKLLDMLNSTGRVYMTHTGIYMLRLVGSSLTEEHHVRRVWDLIQKLTDD 495
45 -20.6003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  13  112...................AGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWIFSPGGAISNMYSIMAARYK--VLFTSEQSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAF---DPIQEIADICEKYNLWLHVDAA-WGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLCSAILVKEKGILQGCNQMHARHVDIFKFWLMWKAKGTVGFENQI-----NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVKVAPKIKALMMESGTTMVGYQKANFFRMISNPAATQSDIDFLIEEIERL... 501
46 -20.6004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  11  2...AMIYLDHNATTFIDPRVKEFIISLNPSSAHSSGRFNLIETVRAQIATALGREYDITFTSSGTEGNNLIMKNFYD--GDIFISAIEHLSIYN----HINYAPNIKVISVNTQGLVDLEHLEELLAQSN----TSKKLVSIIMNNESGVLQD---IAEIGKITKKYEAKFHSDLVQ---GFGRIPINIKAL----GLDFATISGHKIGGGQGGAALISSSNMIIGGGQEKSVRSGTENVLAIAGFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSNNVANTTLITIPQAKLIGFDLHNICVSSGSAKSSIRISLSHTNTVRDIEAFIEAFEEIYD. 370
47 -20.5004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  14  1....MAYFDYTSAKPVDERILEAMLPGNPSSVHSYGFKEAVQEAREKVAKLVNGGGTVVFTSGATEANNLAIIGYARKGKHILVSAVEHMSVINPAKFLQKQGFEVEYIPVGKYGEVDVSFIDQKLRDD-------TILVSVQHNNEIGTIQP---VEEISEVLAGKAA-LHIDATA---SVGQIEVDVEKI----GADMLTISSNDIYGPKGVGALWIRKEVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESYLNGHPEVNVRFSYIEESIVLSLDMAGIQASTGSAHGTLLLTLGRYNTDEDVDRLLEVLPGVIE. 371
48 -20.1003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  15  13AMKLPIYLDYSATTPVDPRVAEKMMQF-MTMDGTFGNEEAVDIARNQIADLVGADPEIVFTSGATESDNLAIKGAAKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDD-------TILVSIMHNNEIGVVQD---IAAIGEMCRARGIIYHVDATQ---SVGKLPIDLSQL----KVDLMSFSGHKIYGPKGIGALYVRRKQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDVEGESLIMALKDLAVSSGSARALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIG. 391
49 -19.8005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  12  3...QRIYLDNNATTRIDPKVKEIMDPGNPSSLHQFGTEPAIAEALDKLYKGINARDDVIITSCATESNNWVLKGVYKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVREAITEK-------TALVSVMWNNETGLIFP---IEEIGAICKEKGVLFHTDAVQ---AIGKIPVDVLKA----NADFLSFSAHKFHGPKGIGGLYIRSGLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRITLVSVRGIEEAMLWDLNRSNIAASTGSAHTAIRLSLSRFNTEAEIDKTIEVFSQAAV. 378
50 -19.7006eem_A mol:protein length:512 Tyrosine/dopa decarboxylase  ali model follow..  13  109...................LGEMLSTGFNVVGFNWMSSPAATELESIVMNWLGQMLTLSSGGGGVLQGTTCEAILCTLTAAVYASDQTHCALQKAAQIAGINPKNVRAIKTSKATNLSPNSLQSAILADIESGLVPLFLCATVGTTSSTAV---DPIGPLCAVAKLYGIWVHIDAA-YAGSACICPEFRHFIDGVEDADSFSLNAHKWFFTTCCCLWVKDSDSLVKALSTSPALSRRFRSMKLLRSYGVANLRTFL-----RSHVKMAKHFQGLIGMDNRFEIVVPRTFAMVCFEVNVKLLESVNASGKIYMTHAGVYMIRFVGATLTEERHVTGAWKVVQEHTDA 508
51 -19.6002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  12  38...RIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRRENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAF--AKIAGVKLIPVTRRMEEGFAIPQNLESFINER------TKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVD--EVYSEIVFRGEFASALSIESDKVVVIDSVSKKFSACGARVLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPGETTMVAPLRGFYLTPGLGKKEIRI--ACVLEKDLLSRAIDVLMEGLKM 395
52 -19.6003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  14  49......NFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVEDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEF------RPKVIIAGWS----AYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHP----SPVPHADVVSTTVHKTLGGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIADRQRRTLSGARIIADRLMAPDVAKAGVSVVS-TDVHLVLVDLRDAAEDLLHEVGITVNRNAVTSGLRILATRGFGDTEFTEVADIIATALAT 407
53 -19.5001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  11  46...HVINFCANNYLG-HPDLIAAAKAGMASVRFICGTQDSHKELEQKLAAFLGMEDAILY-SSCFDANGGLFETLLGAEDAIISDALNHASIIDG---VRLCKAKRYRYANN-----DMQELEARLKEAREAGARHVLIATDGVFSMDGVIAN---LKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHECDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLE-----ELRDRLWANARQFREQMSAAG----LAGADHAIIPVMLGDAFARELQKEGIYVTG-KGQARIRTQMSAAHTPEQITRAVEAFTRIGK. 395
54 -19.3003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  79........RSGDISAVQPKA--------AGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGP---EHILCLHSTTACFAPRV--PDRLEELAVICANYDIPHVVNNAY-GLQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLIT--LLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAH-LLQTPHNPISLAMTTQLGSMLFTRQVSHADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLN. 441
55 -19.2003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  11  44...EVLNFCANNYLG-HPALIKTAQTVMASVRFICGTQTIHKELEKDISEFLGTDDTILY-SSCFDANGGLFETLLGPEDAIISDELNH--------ASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDGIIAD---LKSICDLADKYNALVMVDDSHAVGFIGENGRGTPECGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLEKTEGPQLRKQLQENSRYFRAGMEKLG----LVPGNHPIIPVMLGDAMADHLLQEGIYVVG-MGKARIRVQMSAVHTQQQLDRAIEAFGQVGK. 394
56 -19.2003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  12  50..........DAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRK---LVEFFEGEMVPVADETRAGLDLTGLEEAFKAG------ARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIAD--QLYSRLRYAGTHLRAEAAVDAENVVTIGPSKTESLSGYRLAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPRLQAGVVVTPGTTADSVRL--NFSQDHEAAVAAARRIVTLVER 404
57 -19.2004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  12  32......NITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVEELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEE------KPKLILFGGS----LFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAG---KQFQDPLREGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAELEFGEAYAKQVIKNAKALAQALYE-RGFNVLCETESHQVIIDIESELAKMYEEANIILNNSDNPSGIRLCTRLGMKEKEMEEIAEFMKRIAID 392
58 -19.1001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  14  23.PDQLLDFSANINPLGMPVSVKRALIDNLDCIERY--DADYFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAMIVTPG--FAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTP-------NNPTGLLPERPLLQAIADRCKSLNINLILDEAFI------IPHETGFIPALKDNPHIWVSLTKFYAIPGGYLVNSDDAAMARMRRQQM-----WSVNALAALAGEVALQDSAWQQATWHWLREEGAFYQALCQLPLLTV-YPGRANYLLLRCEIDLQRRLLTQRILIYPGLDSRYYRVAIR---SAAQNERLLAALRNVLTG 359
59 -18.9003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  14  23.PERKVYMDYNATTPLEPEVIQAMTKGNPSSPYSAGRKDIINAARESLAKMIGKPQDIIFTSGGTESNNLVIHSVVKHFHAFITSSVEHDSIRLPLEHLVEEQVAAVTFVPKVSGQTEVDDILAAVRPT-------TRLVTIMLNNETGIVMPVPEISQRIKALNQEPILVHTDAAQ---ALGKQRVDVEDL----GVDFLTIVGHKFYGPRIGALYIRGLGMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLAEFGQKRI-LPNTCNFSIRGPRQGHVVLAQCRVLMASVGAARNALRLSVGRSTTRAEVDLVVQDLKQAVA. 434
60 -18.9003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  10  24KGRELLDYSSNINPLGIPKSFLNNIDEGIKNLGVY-PDVNYRRLNKSIENYLKLKDIGIVLGNGASE---IIELSISLFEKILIIVPSYA---EYEINAKKHGVSVVFSYLDENMCIDYEDIISKIDDVDSVIIGNP-------NNPNGGLINKEKFIHVLKLAEEKKKTIIIDEA-FIEFTGDPSSSFVGEIKNYSCLFIIRAMTKFFAMPGGYGITNNKEIAAKIKAKQN-----WNINCFAEMAAINCLKDTNYIEESLLWIKKERKFIEELNKIGFIKRVFSPHANFVLCRLEEKLYDSLLKEDIVIFIGLDDSFVRFAIK---DEKKNTKFLRALKGVENN 360
61 -18.8002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  13  39..PDDIILQSNDYLA-HPLIKARLAKSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLS-QSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHN-----NCDHLRMLIQRHGPGIIVVDSIYSTL-----GTIAP---LAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALGLTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLE--IIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDEVRDYLESNGVFGSV-KNKNIIRLSLNSDVNDEQIAKIIEVCSDAVN. 382
62 -18.8001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  13  33......NFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARLH------RPKLIVAAASA----YPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHP----NPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLGKTAEKVLDEVGITVNKNTVTSGIRIVTTRGFGLEEMDEIAAIIGLVLKN 386
63 -18.7003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  13  36......NFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTEDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGSHGGHLTHGAPVNFSGKFYNFVEYGVDKDTERINYDEVRKLALEH------KPKLIVAGAS----AYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHP----NPVEYADFVTTTTHKTLRGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVGKEAEETLDSVGITCNKNTVTSGIRLATTRGFDEKAFEEVAKIISLALKN 390
64 -18.7001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  13  26...GAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFAVEPESVVVTSGTEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPEGFRLDLSALEKALTPR------TRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISD--EVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVIVGPKEFMPRLAGMRQWT--SFSAPTPLQAGVAEALKEGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAELPGWDAFRLVEESAFYLEDPPKDLFRF--AFCKTEEELHLALERLGRVVNS 370
65 -18.6003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  14  17LGDGWVHFDAPAGMLIPDSVATTVSTAFRRSGASTVSAAVLDAAREAVADLVNADPGGVVLGADRAVSLLASSSRAGLGYEVIVSRLDD-------AAHRYGAKVKWAEVDIETGELPTWQWESLISK-------STRLVAVNSASGTGGVTD---LRAMTKLVHDVGALVVVDHSA---AAPYRLLDIRET----DADVVTVNAHAWGGPPIGAMVFRDPSVMNSFGSVSRLEIGVHQFGLLAGVVASIEYLAALMQSADAYLNRVFDYLMVSLRSLPLVMLIGRPEAQIPVVSFADRVVQRLADNGIVLGVNDVGGAVTVGLAHYSTMAEVDQLVRALASL... 399
66 -18.5003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  13  53..PDDIILQSNDYLA-HPLIKARLAKSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLS-QSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHN-----NCDHLRMLIQRHGPGIIVVDSIYSTL-----GTIAP---LAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALGLTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLE--IIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDEVRDYLESNGVFGSV-KNKNIIRLSLNSDVNDEQIAKIIEVCSDAVN. 396
67 -18.5004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  16  3.GSGSAYLDHAATTPMHPAAIEAMAAGNASSLHTSGRSARIEEARELIADKLGARSEVIFTAGGTESDNLAVKGIYWARRDIVTTEVEHAVLDSVNWLVEHEGAHVTWLPTAADGSVSATALREALQSHDD-----VALVSVMWNNEVGTILP---IAEMSVVAMEFGVPMHSDAIQ---AVGQLPLDFGAS----GLSAMSVAGHKFGGPPGVGALLLRRDLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVLAEADDPMRLAGNAHFTFRGCEDALLMLLDANGIECSTGSARGSLRLSLGHTSVEADVDAALEVLPGAVA. 384
68 -18.5002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  14  45...KTILLGTYNYMG-DPDVIAAGKQATTGSRVLNGTYQGHKACEDALKEFYGTEHAIVF-STGYQANLGMISTLAGKGDYIILDADSHASIYDG---CWLGDAEIVRFRHN-----SVEDLDKRLGRLPA--EAGKLVVLEGVYSMMGDIAP---LQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEAGVEADVDFVVGTFSKSVGT-VGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIR-----DKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTDMLWQGLLEAGLYVNT-AGMFLLRCSLCAEHSDEQVEQILGMFESAGR. 393
69 -18.4003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  12  51..AAELDLASNDYLG-HPDVLDGGVEAAGGSRLVTGNTELHEAFEHQLASFLGAESALVF-SSGYTANLGALVALSGPGSLIVSDALSHASLVDA---CRLSRARVVVSPHR-----DVDAVDAALAARTE---ERAVVVTESVFSADGDLAP---LRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHVGLAGAPDIVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALR------VLDAEPQRARAVLDRAAELATIAGVTEAPVSAVVSVIAVGAAAACLDRGVRVGC-AGTSRLRLAARASLTDDEMALARQVLTDVLAT 395
70 -18.4001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  14  39..RQYLNFSSNDYLG-HPQIIRAWQQGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLF-ISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLS-----------PSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAP---LAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWL-QKVKPELLVVTFGKGFGV-SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLASDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVSRALQLAEKLRQQGCWVTA-AGTARLRLTLTAAHEMQDIDRLLEVLHGN... 383
71 -18.4004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  12  37......NFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAEERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLH------KPKLLIAGFS----AYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQ----SPIPYAHAVTSTTHKTLRGPRGGLILSNDHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPE-YKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLGKLAANSLDRAGITCNKNAITSGIRLCTTRGFKEKDFVLVGHMVADILDG 391
72 -18.4003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  13  15PPNRKVYMDYNATTPLEPEVIQAVTEGNPSSSYVAGRKDIINTARASLAKMIGKPQDIIFTSGGTESNNLVIHSTVRCFHEFITCTVEHDSIRLPLEHLVEDQVAEVTFVPKVNGQVEVEDILAAVRPT-------TCLVTIMLNNETGVIMPISEISRRRAASGLPRVLVHTDAAQ---ALGKRRVDVEDL----GVDFLTIVGHKFYGPRIGALYVRGVGMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLEERLEAEFGKRIHLPNTCNFSIQGSQRGYMVLAQCQTLLASVGASRNAVRLSVGRSTTRAEVDLIVQDLKQAVN. 426
73 -18.3001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  15  3.....VYFDNNATTRVDDRVLEEMIVGNPNSAHGMGIELHMEKAREKVAKVLGSPSEIFFTSCATESINWILKTVAKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVKLEELEKLVDED-------TFLVSIMANNEVGTIQPVEDVTRIVK-KKNKETLVHVDAVQ---TIGKIPFSLEKL----EVDYASFSAHKFHGPKGVGITYIRKGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTSSACTSKDERDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILS. 374
74 -18.3002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  13  33......NFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVEERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEH------RPKVIVAGAS----AYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHP----NPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVAKRLAEELARRGYRIVTGGTDNHLFLVDLGKEAEERLDAVGITVNKNAVTSGIRIITTRGFTPEEMPLVAELIDRALLE 387
75 -18.2004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  12  43......NVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVEERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEV------RPKLIVAGAS----AYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHP----SPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVAAAMADVFNQHPDFRVISGTNNHLFLVDVTKVAQNVLEEVNITLNKNSKTSGIRVITSRGMGEAESRQIAEWMVEALEN 398

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.