current user: public

If you have questions about the server, please let us know.

Query: 5x41_Q mol:protein length:256 Uncharacterized protein CbiQ, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MGSSGSMSIASIDRVAAQGHWRSRPLAEKSLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARVPLRFWASVAVLPLGFLTTGAAVLLIQIGPEGIGLAPDGPAKAAALVMRATAATCCLLFLATTTPAADLLSGLRRWRVPAELIEIALLTYRFVFILAEEAAAMTTAQRARLGHATRRRWLRSTAQVIAALLPRALTRARRLETGLGARNWQGEMRVLSTRPPASARVLGLILTLQAAILAAGVLLLast
1 -91.9005x41_Q mol:protein length:256 Uncharacterized protein CbiQ  ali model  100  1MGSSGSMSIASIDRVAAQGHWRSRPLAEKSLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARVPLRFWASVAVLPLGFLTTGAAVLLIQIGPEGIGLAPDGPAKAAALVMRATAATCCLLFLATTTPAADLLSGLRRWRVPAELIEIALLTYRFVFILAEEAAAMTTAQRARLGHATRRRWLRSTAQVIAALLPRALTRARRLETGLGARNWQGEMRVLSTRPPASARVLGLILTLQAAILAAGVLL 250
2 -60.1004huq_T mol:protein length:280 Energy-coupling factor transporter transmembrane protein EcfT  ali model follow..  21  1MGSSDPMSNFIFGRYLPLDSVVHRLDPRAKLMLSFCYIIVVFLANNIWSYAILIAFTVGAILSSKISLGFFLKGIRPLLWLIVFTVVLQLLFFHWAFINVTQDGLINAGYIFVRFLLIIMMSTLLTLSTQPLDIATGLASLMKPDTLAMMLSIALRFVPTLMDEATKIMNAQRARGVDGGLFKQAKSLIPLMVPLFMSAFNRAEDLSTAMEARGYQDSEHRSQYRILTWQRRDTVTWLLFLLGFVAILIF 271
3 -59.4005d3m_D mol:protein length:265 Energy-coupling factor transporter transmembrane protein EcfT  ali model follow..  13  1......MSKIIIGRYLPGTTFVYRVDPRAKLLTTFYFIIMIFLANNWVSYLVISIFGLAYVFATGLKARVFWDGVKPMIWMIVFTSLLQTFFMAGWIFTLSSEGLINGLYVFIRFAMIILVSTVMTVTTKPLEIADAMEWMLTPGMISLVISIALRFVPTLFDQTVKIMNAQRSRGADGGLVKRAKSVVPMLVPLFIDSLEVALDLSTAMESRGYKGSEGRYRILEWSKVDLIPVAYCLLLTILMITTRK 264
4 -6.4402dit_A mol:protein length:112 HIV TAT specific factor 1 variant  ali model follow..  10  10...............................................................................................................................SRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLLFDRHPD----------GVASVSDPEEADYCIQTLDGRWFGGR................................ 92
5 -6.3702ijl_A mol:protein length:135 Molybdenum-binding transcriptional repressor  ali model follow..  10  1.......................................................................................................GHMSEKRLPLKPVLRIDFPPGERLGHGKVELMQLIAETGSISAAGRAMDMSYRRAWLLVDALNHMFVICSQRGGKQGGGAALTVFGAELLERYRGMEERMNEALREDIDW..................................... 113
6 -6.2503t6g_B mol:protein length:229 Breast cancer anti-estrogen resistance protein 1  ali model follow..  100...............................................................................................................LLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATT-KAAALQYPSPSA...................................... 199
7 -6.2402dny_A mol:protein length:119 Fuse-binding protein-interacting repressor, isoform b  ali model follow..  11  8.............................................................................................................................KLLRKQESTVMVLRNMVDPKDIDDDLE--------VTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGR................................ 94
8 -6.2105oql_B mol:protein length:907 Utp2  ali model follow..  12  615........MLAIARYLGQKVPAALSDFAVGIYLSILALQYQDFAKRYVPEMMNFLLNTLCALAPEFPVHEPPAGIRIKDATNTPIRQLNCGDCLRKDELSPAETSSLQIAILSTATAILKSAADTWHKLPFQPALSVAQHLHLPSSLTSKLNDLASHLSRLLQLSRLSRRKAEHKRERKGALRELRKDAQFIRREQLRI-KKFKRIIAEIQNE--EGRAANEYAREKAARK................... 904
9 -6.2105kz9_A mol:protein length:163 Virus Matrix Protein  ali model follow..  15  1............................................................................................................MEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLY--------GSWDPITAALSQRAMILGKSGELKTWGLVLGAL--AAREEQVTSEQAKFWLGLGGG................................ 103
10 -6.1504iyp_A mol:protein length:222 Immunoglobulin-binding protein 1  ali model follow..  12  41.....................................................................................................QEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEEISTDLKYLLVPAFQGALTM--------QVNPSKRLDHLQRAREHFINYLTQCHCYHVA-PSLVAMASQRQAKIQRYKQKKELEHRLSAMKSA......................... 166

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.