current user: public

If you have questions about the server, please let us know.

Query: 5x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHNMELEGPYSKKFEVITLDINLDKYKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNLEDKGKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEVKADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFPVKEIEMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKEIKMSVYGLEWEQVEYVVNAIKEIVESCKLast
1 -120.0005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model  100  1MGSSSSGLVPRGSHNMELEGPYSKKFEVITLDINLDKYKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNLEDKGKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEVKADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFPVKEIEMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKEIKMSVYGLEWEQVEYVVNAIKEIVESCK 411
2 -76.4005vpr_A mol:protein length:414 Cysteine desulfurase  ali model follow..  14  1.........................MAMFDIQEIRSQFPILQEKVNGKDLVYLDNAATSQKPKMVLDAINNYYEHYNANVHRGHTLSQVATEMMEDARKKVQRFINAYEVLFTKGTTEGINLVAYAMIKKDDEIIISYLEHHSNIVPWQMLQRTGAKLRVIPMNEDGTLQIDVLDEWL------SEKTKLVSVNQVSNALGIVNPIDEIIRKVRAKSAFIFIDGAQAAPHFEIDVQTMDCDFFAFSGHK-MYGPTGTGILYGKASVLEQLNPFHGGGEMIPFRFEAGTPNIAGNIAIGTAVDFMVGRSNIAAHEHALLEYAQRKLLEIEGLKVYGEANRAGVVSFNLSGIGDKLGIAVRTGHHCTQPIMEY----FGVAGTVRASFAVYNTF-EEIDILTEGVKKAQKML. 407
3 -75.6005b7s_A mol:protein length:419 Cysteine desulfurase  ali model follow..  19  10......................GHMASMRIPEDVRKDIPLTNE------VIYFDNTATSLTPKPVVEAMDEYYLKYRANVHRGHRLSQMATHKYEESRKIVADFIGAEEIVFTKNTSESLNLVALGLFKRGDKIVTTPYEHHSDLLPWQRLTKLGLKLEFIEGDDEGNLDLSDAEKKIK-------GAKLVAVQHVSNALGVIHEVEELGKIAKDEGAIFVVDAAQSAGHMEVNVKKLHADFLAFSGHKGPMGPTGIGVLYIREEFFDTFEPPLIGGGTIPERFEAGTPNIGGAIGLAAGIRYIIGLGRIERQEHKLVKRTTEGLDELEVPWYGPRKKHAGVVSFNVPGLHDDHSIMVRSGHHCALPVMKK----LGINGTVRASFHVYNSL-EEVETFLGVMEELVKGLK 412
4 -74.8001c0n_A mol:protein length:406 PROTEIN (CSDB PROTEIN)  ali model follow..  17  2...........................IFSVDAVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHAGHTLSAQATEKMENVRKRASLFINAEELVFVRGTTEGINLVANSWVRAGDNIIISQMEHHANIVPWQMLARVGAELRVIPLNPDGTLQLETLPTLF------DAATRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHK-LYGPTGIGILYVKEALLQEMPPWEGGGSMIPWRFEAGTPNTGGIIGLGAALEYVLGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQARLGVIAFNLGAHHDNYGIAVRTGHHCAMPLMAY----YNVPAMCRASLAMYNTH-EEVDRLVTGLQRIHRLL. 405
5 -74.6001jf9_A mol:protein length:408 SELENOCYSTEINE LYASE  ali model follow..  17  4...........................IFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGHTLSAQATEKMENVRKRASLFINAEELVFVRGTTEGINLVANSWVRAGDNIIISQMEHHANIVPWQMLARVGAELRVIPLNPDGTLQLETLPTLF------DEKTRLLAITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHK-LYGPTGIGILYVKEALLQEMPPWEGGGSMIPWRFEAGTPNTGGIIGLGAALEYVLGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQNRLGVIAFNLGKHHDNYGIAVRTGHHCAMPLMAY----YNVPAMCRASLAMYNTH-EEVDRLVTGLQRIHRLL. 407
6 -73.7006c9e_A mol:protein length:422 Cysteine desulfurase  ali model follow..  14  4...................STNPSLMTSFDVNKIRKDFPVLHQKINEYDLVYFDNAATTQKPKAVIDAIAQFYEKDNSNVHRGHALSVRATEMYEAARAKVKRFINARECIFVRGTTEAINLVAQSLILPDEEILITHMEHHSNIVPWQMVKKMGCKLQVAPISLNGEVILEEFERKL------NENTKMVAINYASNSLGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQDLDCDFYAFSGHK-MYGPTGIGVLWGKEELLNSMTPYQGGGEMIPHKFEAGTPNIAGAIGLAAAIDYILDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAAKVPIISFVHGKIHDSEGIAIRSGHHCTMPLMDF----YDVAATSRISMSFYNTF-KEIDYCMEALQRVKEVF. 415
7 -73.5004w91_A mol:protein length:422 Aminotransferase  ali model follow..  16  7......................NPLTMAYDVEAIRRDFPILSRQVHGKTLVYLDNGASAQKPQSVIDAVTHAYANEYANVHRGHFLSNAATDAYEKSRETVRRFLNADEIVFTKNATEAINTVAYGYIGEGDEILLSIMEHHSNIVPWHFIERQGAKLVFTPVDDNGVFHIEEFEKRL------SERTKLVAITHMSNTLGTVVPIKKIVELAHARGIPVLVDGSQGAVHLPVDVQDLGCDWYVFTGHK-VYGPSGIGVLYGRAQMLEKMRPFQGGGEMIPHRFEAGTPPIVQAIGLGAALEYMIGRHAILAHEADLRDYAHERLGRINSLRIFGNPDKGAIISFALEGIHDRAGVAVRAGTHCAQPLLKR----FGVTSTCRASFALYNTR-AEVDALAEALEKARKFF. 415
8 -73.1005xt5_A mol:protein length:419 Cysteine desulfurase SufS  ali model follow..  16  1.........................MGHMNITDIREQFPILHQQVNGHDLVYLDSAATSQKPRAVIETLDKYYNQYNSNVHRGHTLGTRATDGYEGAREKVRKFINAAEIIFTKGTTTSLNMVALSYLKPGDEVVITYMEHHANIIPWQQAKATGATLKYIPLQEDGTISLEDVRETV------TSNTKIVAVSHVSNVLGTVNPIKEMAKIAHDNGAVIVVDGAQSTPHMKIDVQDLDCDFFALSSHK-MCGPTGVGVLYGKKALLENMEPAEFGGEMIPWKFEAGTPIIAGAIGLGAAIDFLIGLDEISRHEHKLAAYALERFRQLDGVTVYGPEERAGLVTFNLDDVHDAEGIAVRAGHHCAQPLMKW----LDVTATARASFYLYNTE-EEIDKLVEALQKTKEYFT 406
9 -73.0004q75_A mol:protein length:429 Cysteine desulfurase 2, chloroplastic  ali model follow..  15  2............AAAASSATISTDSESVSLGHRVRKDFRILHQEVNGSKLVYLDSAATSQKPAAVLDALQNYYEFYNSNVHRGHYLSAKATDEFELARKKVARFINAREIVFTRNATEAINLVAYSWLKPGDEVILTVAEHHSCIVPWQIVQKTGAVLKFVTLNEDEVPDINKLRELI------SPKTKLVAVHHVSNVLASSLPIEEIVVWAHDVGAKVLVDACQSVPHMVVDVQKLNADFLVASSHK-MCGPTGIGFLYGKSDLLHSMPPFLGGGEMIPSRFEAGTPAIGEAIALGAAVDYLIGMPKIHEYEVEIGKYLYEKLSSLPDVRIYGPRHRGALCSFNVEGLDQQHGVAIRSGHHCAQPLHRY----LGVNASARASLYFYNTK-DDVDAFIVALADTVSFFN 426
10 -71.8001t3i_A mol:protein length:420 Probable cysteine desulfurase  ali model follow..  15  1.....................MVALQIPSLAATVRQDFPILNQEINGHPLVYLDNAATSQKPRAVLEKLMHYYENDNANVHRGHQLSVRATDAYEAVRNKVAKFINAREIVYTRNATEAINLVAYSWLKAGDEIITTVMEHHSNLVPWQMVAKTGAVLKFVQLDEQESFDLEHFKTLL------SEKTKLVTVVHISNTLGCVNPAEEIAQLAHQAGAKVLVDACQSAPHYPLDVQLIDCDWLVASGHK-MCAPTGIGFLYGKEEILEAMPPFFGGGEMIPHKFEAGTPAIAEAIALGAAVDYLLGMENIHNYEVELTHYLWQGLGQIPQLRLYGPGDRAALASFNVAGLHDQDGIAIRSGHHCTQPLHRL----FDASGSARASLYFYNTK-EEIDLFLQSLQATIRFFS 414
11 -70.4004lw2_A mol:protein length:404 Cysteine sulfinate desulfinase  ali model follow..  13  1......................GSHMNVFNPAQFRAQFPALQDA-----GVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSFAEAQRLTARYEAAREKVAQLLNAKTIVWTRGTTESINMVAQCYLQPGDEIIVSVAEHHANLVPWLMVQQTGAKVVKLPLNAQRLPDVDLLPELI------TPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHK-LYGPTGIGVLYGKSELLEAMSPWLGGGKMVPWKLEAGTPNVAGVIGLSAALEWLYDINQAESWSRSLATLAEDALAKRPGFRSFR-CQDSSLLAFDFAGVHAEYGIALRAGQHCAQPLLAE----LGVTGTLRASFAPYNTK-SDVDALVNAVDRALELLV 403
12 -70.4001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  12  1...........................MTMITPSLHQFPGLAN------KTYFNFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVNTITITDNVTTGCDIVLWGLWHQGDEILLTDCEHPGIIAIVQAIAARGITYRFFPVAANQGDAAAVLANHL------GPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQVRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPTYVGWRSIGKRFEVATSAYPQYAGLLAALQLHQRQEERYQAICQRSEFLWRGLNQLPHVHCLATAPQAGLVSFTVDSPLGHRAIVQKLE-------QRIYLRTIADPDCIRACCHYITDE-EEINHLLARLADFG.... 389
13 -70.3002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  52  1........................................MFKRETKDFINIDPLQTGGKLTEEARQALLEWGDGYSVCDFCTGRLDEIKTPPIDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVP-KTDYPDYAITPENFAQTIEETKKRGE-VVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEIGADFIVGSGHKSMAASGPIGVMGMKEEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYEISKKAKGGRFFLYRELKSRKIHGIKPGLTRYFKLSTYGLSDEEVDYVLNAFKEIIEKY. 370
14 -64.5003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  11  2.........................AGAYDVARVRGLHPSL-----GDGWVHFDAPAGMLIPDSVATTVSTAFRRSGASTVGAHPSARRSAAVLDAAREAVADLVNAGGVVLGADRAVLLSLLAEASAGLGYEVIVSRLDDEANIAPWLRAAHRGAKVKWAEVDETGELPTWQWESLI------SKSTRLVAVNSASGTLGGVTDLRAMTKLVHDVGALVVVDHSAAAPYRLLDIRETDADVVTVNAHA-WGGPPIGAMVFRDPSVMNSFGSVSTNYATGPARLEIGVHQFGLLAGVVASIEYLVSMQSADAYLNRVFDYLMVSLRSLPLVMLIGRPEQIPVVSFAVHKLADNGILAIANTGSRVLDV----LGVNDVGGAVTVGLAHYSTM-AEVDQLVRALASL..... 399
15 -62.0005i90_A mol:protein length:427 PvdN  ali model follow..  11  11.AGILAAGLPLLSAAQSLRAEGVPSDAGNKWKALRQQFDLDPQ------YLHFANFLLTSHPRPVREAIERLRVRFDRNPGEADWHREEIWKYEDEARAWAGRYFAVGQVALTGSTTDGLAAIYGGLVQPGKEILTSSHEHYSTYTTLEYRHKRGTQVREFPLFKDPHVSADEILSSIAAQ--IRPQTRVLGMTWVQSGSGVKLPIREIGKLVRELNIIYVVDGVHGFGVEDVSFADFDCDYFIAGTHKWLFGPRGTGVIIARSEQLQEHLVPSIPTNFGTLMTPGGYHAFEHRLALGTAFELHLGKAEVQARIHQLNAYLKQRLGEHPKVRLVTPTSSSGFTFFRVEGRDCEA---------VAKHLMAHRVVDRDVGPVVRLAPSLLNDE-AEIDRVLEILAPQLA... 427
16 -61.8005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  12  1MGDRGPEFVATTVELPLQQKADAAQTVTGPLNSLLKEFVL------DPAYRNLNHGSFGTIPSAIQQKLRSYQTAAEARP--CPFLRYQTPVLLDESRAAVANLLKVETVVFVANATMGVNTVLRNIADGKDEILYFDTIYGACGKTIDEDKRGIVSSRCIPLIYPAEDDVAAFRDAIKKSREEGKRPRLAVIDVVSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITETDPDFLISNCHKWLFTPRGCAVFYVPVRNQHLIRSTLPTSAFVSNFEFVGTVDNSPFFCVKDAIKWREGEERIMEYMTKLAREGGQKVAEILGTRVLENSTGTAMVNIALPFAFKWMYNVLQDEFNTFVPMTFHR-------FWARLSAQVYL-EMSDFEWAGKTLKELCERVA 472
17 -55.9001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  13  15.............................SLAPLRQQFALPEG------VIYLDGNSLGARPVAALARAQAVIAEEWGNGLIRSWNSAGWRDLSERLGNRLATLIGAGEVVVTDTTSINLFKVLSAALPERRVIVTETSNFPTDLYIAEGL----ADMLQQGYTLRLVDSPEELPQAID------QDTAVVMLTHVNYKTGYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQAGADYAIGCTYKYLNGPGSQAFVWVSPQLCDLVPQPLSGWFGHIARYLCGTQPITSLAMVECGLDVFTDMASLRRKSLALTDLFIELVEQLTLVTPREHAKRGSHVSFEHPEGYAVIQALIDRGV----------IGDYREPRIMRFGFTPLYTTFTEVWDAVQILGEILDR.. 401
18 -55.2002hzp_A mol:protein length:501 Kynureninase  ali model follow..  12  37..ELPADTVQRIAAELKCHPTDERVALHLDLRHFRECFYIPKIQDLDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPITGDESIVGLMKDIVGAKEIALMNALTVNLHLLMLSFTPKRYKILLEAKAFPSDHYAIEQLQLHGLNIEESMRMIKPR-ETLRIEDILEVIEKEGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNGAGGIAGAFIHEKHAHTIKPALVGWFGHVCGFRISNPPILLVCSLHASLEIFATMKALRKKSVLLTGYLEYLIKHNYGKDKAAVEERGCQLTITFSV----------PNKDVFQELEKRGV-DKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAE 492
19 -53.3004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  13  1.................................................MAYFDYTSAKPVDERILEAMLPYMTESFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGTVVFTSGATEANNLAIIGYARKGKHILVSAVEHMSVINPAKFLQKQGFEVEYIPVGKYGEVDVSFIDQKLR------DDTILVSVQHANNEIGTIQPVEEISEVLAGKAA-LHIDATASVGQIEVDVEKIGADMLTISSND-IYGPKGVGALWIRKEA--KLQPVILGGG-QENGLRSGSENVPSIVGFGKAAEITAEWREEAERLRRLRDRIIDNVLKIEESYLNGHPEKRNNVNVRFSYIEDMAGIQASTGSACSHVLMACGLKHEEAHGTLLLTLGRYNTD-EDVDRLLEVLPGVIERLR 374
20 -51.8003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  14  4....................................SGSMYGVYRAMKLPIYLDYSATTPVDPRVAEKMMQFMTMFGNPASRSHRFGWQAEEAVDIARNQIADLVGADEIVFTSGATESDNLAIKGAAKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMR------DDTILVSIMHVNNEIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQLKVDLMSFSGHK-IYGPKGIGALYVRRKPRVRIEAQMHGGG-HERGMRSGTLPVHQIVGMGEAYRIAKEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGNILNVSFNYVEALKDLAVSSGSACSYVLRALGLNDELAHSSIRFSLGRFTTE-EEIDYTIELVRKSIGRLR 394
21 -50.7005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  15  5..................................................IYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAEALDKLYKGINADDVIITSCATESNNWVLKGVYKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVREAIT------EKTALVSVMWANNETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANADFLSFSAHK-FHGPKGIGGLYIRSGV--GLTPLFHGGE-HMNGRRSGTLNVPYIVGMGEAMKLAVHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRNTTLVSVRGIENRSNIAASTGSACNPVMVAIGASKELAHTAIRLSLSRFNTE-AEIDKTIEVFSQAAVRLR 381
22 -50.4004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  16  4..................................................IYLDHNATTFIDPRVKEFIISLMDKEL-NPSSAHSSGRFAKNLIETVRAQIATALGIYDITFTSSGTEGNNLIMKNFYDG--DIFISAIEHLSIYNHIN----YAPNIKVISVNTQGLVDLEHLEELLA---QSNTSKKLVSIIMANNESGVLQDIAEIGKITKKYEAKFHSDLVQGFGRIPINIKALGLDFATISGHK-IGGGQGGAALISSSNF--QITPMIIGGG-QEKSVRSGTENVLAIAGFGLASALRTNISENYIKIKKLQENLEKKLKKYPNVNIVSNNVARNTTLITIPNTDDLHNICVSSGSACSHVLTNMGVGEEEAKSSIRISLSHTNTV-RDIEAFIEAFEEIYDVIP 373
23 -50.0005usr_A mol:protein length:426 Cysteine desulfurase, mitochondrial  ali model follow..  15  22..................................................LYMDVQATTPLDPRVLDAMLPYLINYYGNPHSRHAYGWESEAAMERARQQVASLIGAREIIFTSGATESNNIAIKGVASRKKHLITTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQ------PDTSLVSVMTVNNEIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKIPLDVNDMKIDLMSISGHK-IYGPKGVGAIYIRRRPRVRVEALQSGGG-QERGMRSGTVPTPLVVGLGAACEVAQEMEYDHKRISKLSERLIQNIKSLPDVVMNGDPKHHGCINLSFAYVEALKDVALSSGSACSYVLRAIGTDEDLAHSSIRFGIGRFTTE-EEVDYTVEKCIQHVKRLR 397
24 -49.4001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  14  3..................................................VYFDNNATTRVDDRVLEEMIVFYREKYGNPNSAHGMGIEANLHMEKAREKVAKVLGVSEIFFTSCATESINWILKTVAKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVKLEELEKLVD------EDTFLVSIMAANNEVGTIQPVEDVTRIVKKKNTLVHVDAVQTIGKIPFSLEKLEVDYASFSAHK-FHGPKGVGITYIRKGV--PIRPLIHGGG-QERGLRSGTQNVPGIVGAARAMEIAVELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLNTLSVSFPNIRSGYGIYVSTSSACRHVLDAMGVDRRIAQGAIRISLCKYNTE-EEVDYFLKKIEEILSFLD 377
25 -49.4003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  14  16..................................................TYLDAAATTRVDQRVADIVLHWMTAEFGNAGSRHEYGIRAKRGVERAREYLASTVSADELIFTSGATESNNIALLGLATGRRHIITSAIEHKAVLEPLEHLAGRGFEVDFLTPGPSGRISVEGVMERLR------PDTLLVSLMHVNNETGVIQPVAELAQQLRATPTYLHVDAAQGYGKVPGDL-TTPIDMISISGHK-IGAPKGVGALVTRRREEMPLEPIMFGGG-QERKLRPGTLPVPLIMGLAEAAKIFEAEHAQWQVAAQDLRSRLLAGLASTSFQVNGDQDHVHILNLSFEDVDAEALVAVATGSASSHVLRAMGLPEEAASKSLRFSWTPGQATDLDVEELARGVAKLKPSY. 394
26 -48.1004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  13  1............................................MRGSGSAYLDHAATTPMHPAAIEAMAAVQRTIG-NASSLHTSGRSARRRIEEARELIADKLGAREVIFTAGGTESDNLAVKGIYPHRRRIVTTEVEHHAVLDSVNWLEHEGAHVTWLPTAADGSVSATALREALQS----HDDVALVSVMWANNEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLPLDFGASGLSAMSVAGHK-FGGPPGVGALLLRRDV--TCVPLMHGGG-QERDIRSGTPDVASAVGMATAAQIAVGLEENSARLRLLRDRLVEGVAEIDDVCLNGADDPMRLAHFTFRGCEDANGIECSTGSACSHVLIAMGVDAASARGSLRLSLGHTSVE-ADVDAALEVLPGAVARAR 387
27 -47.6003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  14  27..................................................VYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIINAARESLAKMIGGQDIIFTSGGTESNNLVIHSVVKAKPHFITSSVEHDSIRLPLEHLEEQVAAVTFVPVSKSGQTEVDDILAAVR------PTTRLVTIMLANNETGIVMPVPEISQRIKALPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHK-FYGPR-IGALYIRGLGEFTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTNCEAYEAHMRDVRDYLEERLAEFGQKRIHLNSQFPNTCNFSIRGPRQCRVLMASVGAACSPVLLSYGVPFDVARNALRLSVGRSTTR-AEVDLVVQDLKQAVAQLE 437
28 -45.3003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  14  1..............................MDVARNGARGSVESPPNRKVYMDYNATTPLEPE-VIQAVTEAMKEAWGNPSSSYVAGRKAKDIINTARASLAKMIGGQDIIFTSGGTESNNLVIHSTVRTRPHFITCTVEHDSIRLPLEHLVEDVAEVTFVPVSKNGQVEVEDILAAVR------PTTCLVTIMLANNETGVIMPISEISRRIKALNVLVHTDAAQALGKRRVDVEDLGVDFLTIVGHK-FYGPR-IGALYVRGVGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSNCETYEAHMRDIRDYLEERLEAEKRIHLNSRFPGVNTCNFSIQGSQQCQTLLASVGASCSPVLLSCGIPVDVARNAVRLSVGRSTTR-AEVDLIVQDLKQAVNQLE 429
29 -37.3001wyt_A mol:protein length:438 glycine dehydrogenase (decarboxylating) subunit 1  ali model follow..  10  43..........................EPLPEWKVLEELRRLAAQNLPAHKAFLGGGVRSHHVPPVVQALAARGEFLTAYTPYQPEVSQGVLQATFEYQTMIAELAGLENASMYDGATALAEGVLLALETGRMGVLVSQGVHPEYRAVLRALEAVGAKLLTLPLEGG------------RTPLPEVGEEVGAVVVQNPNFLGALEDLGPFAEAAHGAGALFVAVADPLSLGVLKPPGAYGADIAVGDGQSL-FGGPHFGFLATKKAFVRQLPGRLVSETVAKAKSNITTNAQLTALMGAMYLAALEGLREVALKSVEMAHKLHALLLEVPGVRPFTPKPFFNEFALALPKPEAVRRALAERGFHGATPVPR-----EYGENLALFAATELH-EEEDLLALREALKEVLA... 438
30 -31.3003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  92..................................................................................GSSLLNKITNSLVLNVIKLAGVHSVASCFVPMATGMSLTLCFLTLRHKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGP--EHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNEFIQDIS-----------KMYPGRASASPSLDVLITLLSLRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTPHNPISLAMTLKTIDGHHDKAVTSGARAVPLGNVQTVSGHGFMSHADNYPCAYGMKMQDVDLFIKRLDKCLNIVR 444
31 -30.2003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  13  117.........................................................................................ITNSLVLDIIKLAGVHTVANCFVVPMATGMCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGP--DCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGNDSFIQEIS-----------KMYPGRASASPSLDVLITLLSLGSNKKLLKERKEMFSYLSNQIKKLSNERLLHTPHNPISLAMTLKTLDEHRDKAVTSGARVVPLGSMQTVSGYGFMSHTNNYPCAYGMKMQDVDLFIKRLDRCLKAVR 462
32 -30.1005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  14  35.............................................................PSNLPPRIMAAGGLQMI-----GSMSKDMYQIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAV-DIGERIGARVHPMTKDPGGHYTLQEVEEGLAQ-----HKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKW-TIPVISLYSLRESLALIAELENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHC. 392
33 -30.0003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  14  31.............................................................PSNLAPRVLAAGSLRMI-----GHMQKEMLQIMEEIKQGIQYVFQTRNLVVSGSGHCAMETALFNLLEPGDSFLTGTNGIWGMRAA-EIADRIGARVHQMIKKPGEHYTLQEVEEGLAQ-----HKPVLLFLVHGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKPVSFYTDITY-TTPVTSLYCLRESLALIAELENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVTVPAGYNWRDIVSYVLDHFSIEISGGLGPTEERVLRIGLLGYNATTENVDRVAEALREALQHC. 388
34 -29.8001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  13  12.............................................................PLTTSRTVKEAMLFDSCT-----WDDDYNIGVVEQIRQQLTALATASEVLLQGSGSYAVEAVLGSALGPQDKVLIVSNGAYGARMV-EMAGLMGIAHHAYDCGEVARPDVQAIDAILNA----DPTISHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGIPMDIAALHIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDLYAQWRCTSPTHTVLAFAQALKELAKVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIIT----RFSEFYRRLKEQGFVIYP-------GKVSQSDCFRIG-NIGEVYAADITALLTAIRTAMYWTK 366
35 -29.7002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  13  30.............................................................PSNLPPRIMAAGGLQMI-----GSMSKDMYQIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAV-DIGERIGARVHPMTKDPGGHYTLQEVEEGLAQ-----HKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKW-TIPVISLYSLRESLALIAELENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVMDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALVAQ. 387
36 -29.6002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  14  26.............................................................PSNCSKRVLTAMTNTVL-----SNFHAELFRTMDEVKDGLRYIFQTENMCVSGSAHAGMEAMLSNLLEEGDRVLIAVNGIWAERAV-EMSERYGADVRTIEGPPDRPFSLETLARAIEL-----HQPKCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLCGVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSKVFYWDLLL-TVASNLIFALREALAQIAELENQIKRRIECAQILYEGLGKMGLDIFVKDPRHRLPTVTGIMIPKGVDWWKVSQYAMNNFSLEVQGGLGPTFGKAWRVGIMGECSTVQKIQFYLYGFKESLKAT. 383
37 -29.5004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  14  32.............................................................PSNLPPRIMAAGGLQMI-----GSMSKDMYQIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAV-DIGERIGARVHPMTKDPGGHYTLQEVEEGLAQ-----HKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVAFLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKW-TIPVISLYSLRESLALIAELENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHC. 389
38 -29.5004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  30.............................................................PSNLPPRIMAAGGLQMI-----GHMSKEMYQIMDEIKEGIQYVFQTRNLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQRAV-DIGERIGARVHPMTKDPGGHYTLQEVEEGLAQ-----HKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSFYLDIKW-TIPVISLYSLRESLALIAELENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGYDWRDIVSYVMDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVTEALRAALQHC. 387
39 -29.2002z9u_A mol:protein length:392 Aspartate aminotransferase  ali model follow..  12  17.............................................................PVNAYPEVLRGLGRTVL-----YDYDPAFQLLYEKVVDKAQKAMRLSNVILHGEPVLGLEAAAASLISPDDVVLNLASGVYGKGFG-YWAKRYSPHLLEIEVPYNEAIDPQAVADMLKA----HPEITVVSVCHHDTPSGTINPIDAIGALVSAHGAYLIVDAVSSFGGMKTHPEDCKADIYVTGPNKCLGAPPGLTMMGVSERAWAKMKANPLAPRASMLSIVD-TPSVSEINGLDVALDLYLNPEAVWARHALTAKAMRAGVTAMGLSVWAASDSIASPTTTAVRTPDGVDEKALRQAARARYGVVFSSGRGETLGKLTRIGHMGPTAQPIYAIAALTALGGAMNAA. 371
40 -28.9001vjo_A mol:protein length:393 alanine--glyoxylate aminotransferase  ali model follow..  13  36.............................................................PSNAHPSVLQAMNVSPVG-----HLDPAFLALMDEIQSLLRYVWQTENIAVSGTGTAAMEATIANAVEPGDVVLIGVAGYFGNRLV-DMAGRYGADVRTISKPWGEVFSLEELRTALET-----HRPAILALVHAETSTGARQPLEGVGELCREFGTLLLVDTVTSLGGVPIFLDAWGVDLAYSCSQKGLGCSPGASPFTMSSRAIEKLQRRRTKVANWYLDMNL-TAPINLYYALREALRLIAQLANCWQRHQKNVEYLWERLEDIGLSLHVEKEYRLPTLT-GVDGKAVARRLLNEHNIEVGGGLGE-------AGKVWRVGLMGFNSRKESVDQLIPALEQVLR... 387
41 -28.8002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  14  27.............................................................PSNAPQRVLDAMSRPIL-----GHLHPETLKIMDDIKEGVRYLFQTNNFCLSASGHGGMEATLCNLLEDGDVILIGHTGHWGDRSA-DMATRYGADVRVVKSKVGQSLSLDEIRDALLI-----HKPSVLFLTQGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLGGAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKVKVYYWDMSL-TISSTLLYGLREAIAMACELPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVT--AQYAMKTYLVEISGGL------------GPTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVK 384
42 -28.8001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  14  171.........................................................................................HEGPAVAAEKHAARVYNADKTYFLGGSSNANNTVTSALVSNGDLVLFDRNNHKSVYNSALAMAGGRPVYLQTNRNPYGFIGRELAAKVDPERAKWKRPFRLAVIQL-GTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVG-LIDDLGPEDPGIIVVQSVHKQQAGFSQTSQIHKKDSHIKGQLRYCDHKHFN--NSFNLFMSTSPFYPMYAALDVNAAMQKLWHDLLITTIEARKKLIKAGSMFRPFVPPVVN-FMLTTPGINPETGDYEDPATIVANYLRDHGIIPEKSDLNSILFLMTPAETPAKMNNLITQLLQLQRLIE 567
43 -28.5002x3l_A mol:protein length:446 ORN/LYS/ARG DECARBOXYLASE FAMILY PROTEIN  ali model follow..  15  55.........................................................................................PEEVILKSMKQVEKHSDYDGYFLVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQEGHFIETHQSPLTN------HYNKVNLSRLNNDGHKLVVLTY-PNYYGETFNVEEVIKSLHQLNIPVLIDEAHGAQGFPDSTLNYQADYVVQSFHKTLPALTMGSVLYIHKNAPYR---------ENIIEYLSYFQTSSPSYLIMASLESAAQFYKTYDST--LFFAKRAQLIECLENKGFEMLQVDDPLKLLIKYEG--------TGHDIQNWFMNAHIYLELADDYQALAILPLWHHDDTYLFDSLLRKIEDMILP 355
44 -28.1003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  14  19.............................................................PVEVDPRVLRVMSTPVV-----GQFDPAFTGIMNETMEMLRELFQTKNYPIDGTSRAGIEAVLASVIEPEDDVLIPIYGRFGYLLT-EIAERYGANVHMLECEWGTVFDPEDIIREIKK-----VKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVEYWSERRLNHHTEATTMLYALREGVRLVLELETRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVT--RDMLLAQFGIEIASSF------------GPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRH. 390
45 -27.9003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  15  5...............................................RYIDLRSDTVTQPTD-AMRQCMLHAEVGDDV-----------EDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLE--NTHNGKVLPLREMRELVDEHGLQLHLDGARAVVASGHTVRELPFDSVSICLSKGLGAPVG-SLLVGSHAFIARARRLR--------KMVGGGMRQAGILA-QAGLFALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTSGESAP---------LLAFMKARGILFSGYGELRLVT---LQIHDDDIEEVIDAFTEYLGA.. 341
46 -27.9003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  11  21.............................................................PINADPRVLRAMSSQLI-----GQYDPAMTHYMNEVMALYRGVFRTENMLVDGTSRAGIEAILVSAIRPGDKVLVPVFGRFGHLLC-EIARRCRAEVHTIEVPWGEVFTPDQVEDAVKR-----IRPRLLLTVQGDTSTTMLQPLAELGEICRRYDALFYTDATASLGGNPLETDVWGLDAVSAGMQKCLGGPSGTSPITLSARMEEAIRRRKCVEEGIRTDAHR-TEATTALFGARECARLILQLDYGIARHKLHGDALVKGIQAMGLETFGDLKHKMNNVL-GINGDQARKLMLEDFGIEIGTSFGP-------HGKVWRIGTMGYNARKDCVMTTLSALEAVLNYL. 390
47 -27.9003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  10  21.............................................................PVMSSEEVRAIGAEQVP-----YFRTTEFSSTMLENEKFMLEYAKAPEVFMTCSSTGSMEAVVMNCFTKKDKVLVIDGGSFGHRFV-QLCEIHEIPYVALKLEHGKKLTKEKLYEYDN------QNFTGLLVNVDETSTAVLYDTMMIGEFCKKNNMFFVCDCVSAFLADPFNMNECGADVMITGSQKVLACPPGISVIVLAPRGVERVEKSKVRTKNQERGQTPFTPAVGILLQINERLKEIKKADAEVARIASQAADFRAKIKDLP-FELVSESPANGVTSVHPTAYDIFLKLKDEYGIWIC--------PNGGEMKDTIFRVGHIGLTHEDNTTLVNAFKDLQKRN. 368
48 -27.4002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  12  203.........................................................................................HTGAFGESEKYAARVFGADRSWSVVGTSGSNRTIMQACMTDNDVVVVDRNCHKSIEQGLMLTGAKPVYMV-IGPIYPQEMQPETLQKKISESPLTGQKPSYCVVTN-CTYDGVCYNAKEAQDLLEKTSDRLHFDEAWYGPIYADHYAMRGTVFATHSTHKLLNALSQASYIHVREGRGAINFSRFN-------QAYMMHATTSPLYAICASNDVAVSMMDLTQEVIDEAVDFRQAMARLYKEFTADGSWFFKSILAPGMGEDGELEETGVPAALVTAWLGRHGIVPTRTTDFQIMFLFSMGVTRGKWGTLVNTLCSFKRHYD 606
49 -27.2002dr1_A mol:protein length:386 386aa long hypothetical serine aminotransferase  ali model follow..  15  1............................MEIMEFEEAFKEVYEMVKPKYKLFTAGPVA--CFPEVLEIMKV------------SHRSKEYRKVHMDTVERLREFLEVEKLLVPSSGTGIMEASIRNGVSKGGKVLVTIIGAFGKRYK-EVVESNGRKAVVLEYEPGKAVKPEDLDDALRK----NPDVEAVTITYNETSTGVLNPLPELAKVAKEHDKLVFVDAVSAMGGADIKFDKWGLDVVFSSSQKAFGVPPGLAIGAFSERFLEIAEKMPERG-LKEKESTPSTPPMPQVFGINVALRIIEKKEKWLEMYEKRAKMVREGVREIGLDILAEPGHESPTIT----KGDEVYEAMRKRGFELA--------KGYGSVKEKTFRIGHMGMKFEDIQEMLDNLREVINELK 380
50 -27.2002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  16  1MGSSSSGLVPRGSHMLD---FNIEGLIPKNMEKRGELVLNEYLKEIEDVFNHRKIPENGIDDEKIKLFLKFLSMMDTDKDPKSVRIGEREARTYNKILESFFKQLGLNVTPISTGMSISLCLSAARKKYGSNVVIYPYASHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKK-EIELGNRPCVLSTLTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNYYLEKKYRVDAVVSSSDKNLLTPIGGGLVYSTDEFIKEISLS-----------YPGRASATPVVNTLVSLLSM-NYLELVKNQKNSKKLLDELLNDLSGGKFLDVESPIASC--DPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDYIVMNAIGVRTEDIVNSVSKLEKIL.... 449
51 -27.0005xx1_A mol:protein length:756 Arginine decarboxylase  ali model follow..  12  204.........................................................................................HTGAFGESEKNAARVFGADRSWSVVGTSGSNRTIMQACMTDNDVVVLDRNCHKSIEQGLILTGAKPVYMVPSRNRYGIEMQPETLQKKISAKTKAGQKPSYSVVTN-CTYDGVCYNAKEAQDLLAKTSDRIHFDEAWYAMRGEPGDHNGPTVFATHSTHKLLNALSQASYIHVREGRGAVNFSRFN-------QAYMMHATTSPLYAICASNDVAVSMMDLTQEVIDEAVDFRQAMARLYKEFTDEGDWFFKSILAPGMGDDGELEASGVPAALVTAWLGRHGIVPTRTTDFQIMFLFSMGVTRGKWGTLINTLCSFKHHYD 607
52 -26.9004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  12  43....SKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVR-----ACSLFNGGP-CVTSGGTESILMACKAYRDL--EIVAPQSAHAAFNKAASYF---GMKIVRVPLTKMMEVDVRAMRRAIS------RNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKA-GVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTGGIYASPTIAGSRPGGISAACWAALMHF-GYVEATKQIIKTARFLKSELENIKGIFVFGNPQ-LSVIALGSRDIYRLSNLMTAKGWN---------LNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIM 455
53 -26.9002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  16  8.............................................................PTPIPERVQKALLRPMRG-----HLDPEVLRVNRAIQERLAALFDPGEAALAGSGSLGMEAGLANL--DRGPVLVLVNGAFSQRVA-EMAALHGLDPEVLDFPPGEPVDPEAVARALKR-----RRYRMVALVHGETSTGVLNPAEAIGALAKEAGALFFLDAVTTLGMLPFSMRAMGVDYAFTGSQKCLSAPPGLAPIAASLEARKAFTGKRGWYEHWERGGYHHTTPVLLHYALLEALDLVLEVAARERRAREVYAWVLEELKARGFRPYPKASPLPTVLVVRPPDADRLVRALYAEGVAVAGGIGP-------RGQVLRLGLMGEGARREAYQAFLKALDRALAL.. 352
54 -26.8003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  14  13...................................KEILEELKKYRSLDLKYEDGNIFGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLNNKDAHIVSGGTEANLMALRCIKNEHPKIIVPITAHFSFEKGREMMDLEYIYA---PIKEDYTIDEKFVKDAVED-----YDVDGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKLGVDSITIDPHKMGHCPIPSGGILFKDGYKRYLDVDAPYLTETRQATILGTRVGFGGACTYAVLRYL-GQRKIVNECMENTLYLYKKLKENNFKPVIEP--ILNIVAIEDEDYKEVCKKLRDRGIY---------VSVCNCVKALRIVVM--HIKREHIDNFIEILNSIKRD.. 397
55 -26.3001iug_A mol:protein length:352 putative aspartate aminotransferase  ali model follow..  12  9.............................................................PVRLHPKALEALARPQL-----HHRTEAAREVFLKARGLLREAFRTEGLILTGSGTLAMEALVKNLFAPGERVLVPVYGKFSE---YEIALEAGLVVERLDYPYGDTPRPEDVAK---------EGYAGLLLVHSETSTGALADLPALARAFKEKNGLVGADMVTSLLVGEVALEAMGVDAAASGSQKGLMCPPGLGFVALSPRALERLKPLARELKAQKEGESAWTPAINLVLAVAAVLEEVLPREEHLALKAWQNALLYGVGEEGG-LRPVPKRFSPAVAAFYLPPYARVKEAFAQRGAVIA--------GGQGPLKGKVFRLSLMGYDRYEALGVAGMFREVLEEIL 349
56 -26.3002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  17  4.............................................DKIMIDLRSDTVTKPTE-EMRKAMAQAEVGDDV-----------EDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVP-GKNGAMDPDDVRKAIRPRNIHFPRTSLIAIENTHNR-GRVVPIKEICTIAKEHGINVHIDGARASIASGVPVKEYYADSVMFCLSKGLCAPVG-SVVVGDRDFIERARKAR--------KMLGGGMRQAGVLA-AAGIIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVK-TNMVILRTDN-------LKVNAHGFIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS 349
57 -26.1002bkw_A mol:protein length:385 ALANINE-GLYOXYLATE AMINOTRANSFERASE 1  ali model follow..  15  13.............................................................PIILSGAVQKALDVPSL-----GHTSPEFVSIFQRVLKNTRAVFKSAAFVLAGSGTLGWDIFASNFIAPNKNVLVVSTGTFSDRFA-DCLRSYGAQVDVVRPLKIGESVPLELITEKLS----QNSYGAVTVTHVDTSTAVLSDLKAISQAIKQTSTFFVVDAVCSIGCEEFEFDEWGVDFALTASQKAIGAPAGLSISLCSSRFMDYALNDSKNGHVHGYFSS--TPPVQLINSLDVALKEILELHKRWDLHREMSDWFKDSLVNGLQLTSVSRYPSNGLTAVYVADPPDVIAFLKSHGVVIAG-----GIHKDIGPKYIRIGHMGVTACNKNMKNCFDLIKLALQRKK 385
58 -26.1003n75_A mol:protein length:715 Lysine decarboxylase, inducible  ali model follow..  13  193.........................................................................................HSGPHKEAEQYIARVFNADRSYMTNGTSTANKIVGMYSAPAGSTILIDRNCHKSLTHLMMMSDVTPIYFR-LGGIPQSEFQHATIAKRVKETPN-ATWPVHAVITN-STYDGLLYNTDFIKKTLDVKSI--HFDSAWVPCGMSGGRVEGKVIYETQSTHKLLAAFSQASMIHVKGDVNEETFN----------EAYMMHTTTSPHYGIVASTETAAAMMKGNAGKIERAIKFRKEIKRLRTESDGWFFDVWQTLLTPGMEKDGTMSDFGIPASIVAKYLDEHGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAFD 561
59 -25.8003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  13  1................................................MIDLRSDTVTRPSR-AMLEAMMAAPVGDDV-----------DDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLE--NTHNGKVLPLKEAWEFTRERNLALHVDGARAVVAYGCELKEIYCDSFTICLSKGLGTPVG-SLLVGNRDYIKRAIRWR--------KMTGGGMRQSGILA-AAGIYALKNNVARLQEDHDNAAWMAEQLREAG-ADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINASPIVRLVTH-------------LDVSREQLAEVAAHWRAFLAR.. 333
60 -25.7005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  13  1............................................MTDKSQQFASDNYSGICP-EAWAAMEK--------ANHGHDRAYGDDQWTERASEYFRNLFETDEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRQDIHPKPRVVTITQ-ATEVGTVYRLKAISATCKELGLNLHMDGARACAFLGCSPAELGVDVLCFGGTKNGMAVGE-AILFFNRQLAEDFDYRC--------KQAGQLASKMRFLS--APWVGLLEDGRHGNHANHCAQLLALLVSDLPGVELMFPVE-ANGVFLQMPE--------------AIEALRAKGWRFYTFIGSGGARFMCWDTEEERVRELAADIRSIIT... 345
61 -25.7004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  12  1................................................MIDLRSDTVTRPSR-AMLEAMMAAPVGDDV-----------DDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLE--NTHNGKVLPLKEAWEFTRKRNLALHVDGARAVVAYGCELKEIYCDSFTICLSKGLGTPVG-SLLVGNRDYIKRAIRWR--------KMTGGGMRQSGILA-AAGMYALKNNVARLQEDHDNTAWMAEQLREAGAD-VMRQDTNMLFVRVGEENAAALGEYMKARNVLINASPIVRLVTH-------------LDVSRAQLAEVAAHWRAFLAR.. 333
62 -25.5005fkz_E mol:protein length:710 LYSINE DECARBOXYLASE, CONSTITUTIVE  ali model follow..  13  193.........................................................................................HTGPHLEAEEYIARTFGAEQSYITNGTSTSNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGGIPRREFTRDSIEEKVAQAQWPVHAVITN-STYDGLLYNTDWIKQTLDVPSI--HFDSAWVPSGMSGERVAGKVIFETQSTHKMLAALSQASLIHIKGEYDEEAFN----------EAFMMHTTTSPSYPIVASVETAAAMLRLINRSVERALHFRKEVQRLREESDGWFFDIWQTILTPGMDEQGNMSEEGIPAALVAKFLDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYD 561
63 -25.2001v72_A mol:protein length:356 Aldolase  ali model follow..  3..........................................ETSRPPALGFSSDNIAGASP-EVAQALVK--------HSSGQAGPYGTDELTAQVKRKFCEIFERDEVFLVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVGDVHTTQPACVSITQATVGSIYTIEAIGDVCKSSSLGLHMDGSRALVSLGCSPAEMGVDALSFGATKNGVLAAE-AIVLFNTSLATEMSYRR--------KRAGHLSSKMRFLSAQIDAYLTDDLLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILCRLDSAMIDALLKAGFGFYHDRWGPNVVRFVTS-------------FATTAEDVDHLLNQVRLAADRTQ 354
64 -25.1003wco_A mol:protein length:392 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  12  9........................................IKRVINATGVVINTNLGRAPLSKDVINFISEIANGYSNLEY-----EGKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKEVIISRGELVEIGGSFRIPDIMKKSGAILREVGYYNKTKVSRYEGAI------NQNTALLMKVHKSNFP-EEVKLEDLVKLGHKYGIPTYYDAGSGL---LINLKSLGIDLVSGSGDKLLGGPQA-GIIVGKKNLIEKIKKNPIARALRIDKLT--------LSGLEMTLKLYFELTQDEKALRQKAKRLEKLLKDIPGLKISVIKDGGSLPELELPTYCVAIRHDRLSSQELSRRLRLAEPPIVCRIREDQLLFDMRTVFHEDLKTIKKTLQELLSI.. 392
65 -25.1001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  10  12.............................................KPKPYSFVNDYSVGMHP-KILDLMAR--------DNMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEATGHKVVTAPC--PDGKLRVADIESALHENRSEHVIPKLVYISNTTE-VGTQYTLEDISASCKEHGLYLFLDGARALSSPVNDLTLADTDMFYIGATKAGGMFGE-ALIILNDALKPNARHLI--------KQRGALMAKGWLLG--IQFEVLMKDNELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEPLKD-----------TCIMRLCTS-WATEEKECHRFVEVLKRLVAS.. 357
66 -25.1003ffr_A mol:protein length:362 Phosphoserine aminotransferase SerC  ali model follow..  10  12.............................................................PSELYPTVRQHMITLDEKIGVISHRSKKFEEVYKTASDNLKTLLELPSVLFLASATEIWERIIQNCVEKKSFHCVNGS------------SKRFYEFAGELGREAYKEEAAFGKGFYPADITVPADAEIICLTHNETSSGVSMPVEDINTFRDKNDALIFVDAVSSLPYPKFDWTKI--DSVFFSVQKCFGLPAGLGVWILNDRVIEKSKALLAKRKSIGTYHT--TPNAMNIFLLGKVTGDMLQADGIRKQTEEKAALINTYIESSKVFSFGVEDAKLR----SMTTIVANTTMLPGEINKILEPFDMAVGAGYGSKKETQIRIANFPHSLEQVHKLVQTLKEKIG... 362
67 -24.7002fyf_A mol:protein length:398 phosphoserine aminotransferase  ali model follow..  42.............................................................PSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGEPIII------------TSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRP---EGSDDALVVIDATSGAGGLPVDIAET--DAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLS--TPAIATLALLAEQIDWLVGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGT-----VAKILRANGIEPYRKLGRNQLRVAMFPVEPDDVSALTECVDWVVERL. 392
68 -24.6003zrp_A mol:protein length:384 SERINE-PYRUVATE AMINOTRANSFERASE (AGXT)  ali model follow..  12  10.............................................................PTTIKEDVLVAGLENNV-----GFTSKEFVEALAYSLKGLRYVMGASKLIIPGGGTSAMESVT-SLLKPNDKILVVSNGVFGDRWE-QIFKRYPVNVKVLRPSPGDYVKPGEVEEEVRK-----SEYKLVALTHVETSTGVREPVKDVINKIRKYVELIVVDGVSSVGAEEVKAEEWNVDVYLTASQKALGSAAGLGLLLLSPKALSILDSQNSRGAEEGKAAYFATPPVHVILQLAEAFRLIEKIENRIKRHTMVASAIRAGLEALGLEIVARRPESYSGVILKVADPQKVLAGTVNEGVEFAPGVHPA-------FKYFRIG-HMGWVTPNDAIIAISVIERTLRKL. 363
69 -24.5003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  11  113.............................................................DEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDA-TVTSGGTESLLLAMKTYRDTAPEAVVPVSAHAAFDKAAQYF---GIKLVRTPLDADYRADVAAMREAIT------PNTVVVAGSAPGYPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPFDFRLEGVTSVSADTHKYGYGAKGTSVILYRRPDLLHYQYFIAAGGLYFSPTFAGSRPGALSATAWAAMLSL-GYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVASDELNIYQVMEEMAGRGWRLNGLHRPPAF---------HVALTLRHTEPGVVDRFLADLQDAVAQVR 474
70 -24.5005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  12  66........................................................CQTYMEPEAVELMKDTLEKNAIDKSEYPRTAEIENRCVN-----IANLWHAPE-TSTIGSSEACMLAGLAMKFA--NIVISAGYQVCWEKFCVYWDIDMHVVPMDD--DHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARLDAVVERYNRTTKFPVYIHVDAASGGFYTPFDFRLNNVISINASGHKYGLVYPGVGWVIWRDQQYLPVFKVSYLGGELPTMAINFSHSASQLIGQYYNFIRF-GYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELTALYDLSDRLLMKGWQVPTYPLPKNMTDR---VIQRIVVR--DFGMSMAHDFIDDLTQAIHDLD 449
71 -24.4003ke3_A mol:protein length:379 Putative serine-pyruvate aminotransferase  ali model follow..  6.............................................................RQDIDPNGLLEYSVVYTDRALNHM-SKAFQEVMNDLLSNLKTVYNAEAAVIIPGSGTYGMEAVARQLTIDEDCLIIRNYRWTQILEKGKFAKSSTVLTAERTEDT-PFAPVDIETAVAKIKE--DKSAIVYAPHVETSSGIILSEEYIKALVHSVGGLLVIDCI-ASGCVWLDMKELGIDVLISAPQKGWSSTPCAGLVMLSAAAIKKVESTESNC-ENGGHAYHATMPTDSLRQFRDAILEAKEFDILRDAQWELGNRVRKVLTDKGIESVAAEGFEAPGVVYTERDDMHKGSAFAEAGLQIAAGVPLKV----EPDNFKTFRLGLFGDKLTDIDGTVERFEKALDEV. 376
72 -24.4003w1h_A mol:protein length:452 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  12  69........................................IKRVINATGVVINTNLGRAPLSKDVINFISEIANGYSNLEY-----EGKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKEVIISRGELVEIGGSFRIPDIMKKSGAILREVGTTNKTKVSDYEGAIN------QNTALLMKVHKSNGFVEEVKLEDLVKLGHKYGIPTYYDAGSGLLINL-DCISLGIDLVSGSGDKLLGGPQA-GIIVGKKNLIEKIKKNPIARALRIDK--------LTLSGLEMTLKLYFELTQDEKALRQKAKRLEKLLKDIPGLKISVIKDGGSLPELELPTYCVAIRHDRLSSQELSRRLRLAEPPIVCRIREDQLLFDMRTVFHEDLKTIKKTLQELLSI.. 452
73 -24.3003qbo_A mol:protein length:364 Phosphoserine aminotransferase  ali model follow..  11  5..............................................TQVYNFSAGPAM--LPVEVLRRAQQ-WHGLGTSVMEVSHRSKEFMQVAEESEKDLRDLLNVPALFCHGGARAQFAAVPLNLLGDRNSADYVDGGYWAH---IKEAQKYCTPNVIDVTTHDNGLTGIQPMKQWK----LSDNAAYVHYCPNETIDGIAIDE-----QPDFGNKVVVADFSSSILSRPIDVSRY--GVIYAGAQKNI-GPAGLTLVIVREDLLGKAHTALPSILDYKILADNDTPPTFAWYLSGLVFKWLKELGEMEKRNQAKAELLYGAIDRTGFYRNDVAITNRSWMNVPFQMADASLDKL------FLSEAEAQGLQLKGHRVAGGMRASIYNMPIEGVKALTDFMADFERRH. 363
74 -24.3005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  12  55.......................................................GTMYCGDHEHYAFLNEAYGLFSHVNALQRDLCPSMNRMESEIVAMTVALLHGEAVALSLGGTESILNATLAYREKA-RMIWPASAHPAFRKAAHLF---GFDVTVAPIDPVTMQVDADFVRDA-----VDANTVMLVGSACNYPYGTIDPIGALSAIAVEKDVWLHVDGCLGGWMLPWGEALGGVTSISADTHKFGYGPKGGSVLAWRDASFRRHQYFLMTGGVYGSPGLTGSRSGGLIAATWAALRSLEGYLARAKAIFETAFDMQAAVRAIPELRVLGKPTFCFAFTSDAFDIYHVNDFMRQRGWR---------FNGLQHPDALHMCVTGPQTQPGVAERFRQDLGEAVEHAR 429
75 -24.2001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  14  55...................................................YLGLANHPDLIAAAKAGMDSHGFGMASV-----RFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANN--------DMQELEARLKEAREAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSRVDIITGTLGKALGGASG-GYTAARKEVVEWLRQRSRPY------LFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYV-TGFFYPVV----PKGQARIRTQMSAATPEQITRAVEAFTRIGKQLG 398

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.