current user: public

If you have questions about the server, please let us know.

Query: 6DK6 Entity 1(prereleased), from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MALINENFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELGNRSTFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYLKCTPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQALHPLWSRRHSTKFNGASYIVQKGAEALYTDEGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAALKLast
1 -116.0006DK6 Entity 1(prereleased)  ali  100  1MALINENFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELGNRSTFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYLKCTPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQALHPLWSRRHSTKFNGASYIVQKGAEALYTDEGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAALK 411
2 -103.0003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  47  38..QRNENFGKLRAGYLFPEIARR--RKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLATREGYSGYGAEQGQGALREAVASTFYGHAGRAA--DEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYA----NGEPVHADWNRVMTTCFNGASNIVQAGGLACLQPEGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFP-GKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEA. 436
3 -101.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  45  23KVSRNSNMSKLQAGYLFPEIARR--RSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGI--GDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEMRCTPENGFFPDLTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDD-NPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYS----DGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFP-NQSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQL. 424
4 -96.6004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  40  39..VRNVNLEKLKNNYLFPEINRR--ELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHV--KSNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVMPCGPNNSFFPDLMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDG-SPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELLYS----NGFPIINDFHRIVTTSFNGASNIAQAGGLACLSSGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFK-GSKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDHIVEASKRLQNF. 438
5 -94.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  21  8LVPRGSHMISNKLANIPDSYFGKTMG--RKIEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPEN----QKYGAFHGKEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPH------YLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDA-KNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALK------------KYQTHTNAGMFGALQDAAIYALNH-YDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPGYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTEL. 393
6 -94.1002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  22  2MAESRPARRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDT----HGYSTSRGIPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFF-----NELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALA------------RIKSYHDYGTFTPLQVAAIAALEG-DQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEHLGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALIENRDRLRQAVRGIKAM. 394
7 -94.1003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  38  2..KRNPHFVSLTKNYLFADLQKR--VAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEI----------IALPCLQENAFFPEFEDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYA----DGHFVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ---LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQNISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMA. 389
8 -94.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  23  1.......MLSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKE-----GKTHYTDSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDFTVES-------------LEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEG-KCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAI------------LKLQQNLFISAPTISQYAALKAFEKETEREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGE--DGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEF. 367
9 -93.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  24  2.......ALSDRLELVSASEIRKLFDIAAG----MKDVISLGIGEPDFDTPQHIKEYAKEALDK-----GLTHYGPNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRL-----NVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMV------------KFQMYNATCPVTFIQYAAAKALKDRSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRMERV. 382
10 -92.8002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  22  3.............RVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTT----YGYCLKSCTLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLRED--------LADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGE-APSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLE------------RVKGVIDFNQYAGVLRMGVEALKTP-KEVVRGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPEGVDDLEFGLRLV-ERGVALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREA. 374
11 -90.8001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  22  2......RGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQ-----GKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP-----ERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EHFSPGRV--APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMA------------SVSSQSTTSPDTIAQWATLEALTNASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPGTDFA--AFGHVRLSYATSEENLRKALERFARV. 381
12 -90.7001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  19  2..GSDKIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQK-----GEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQP-----SLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTD-EFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVS------------KIQSHTTSCINTVAQYAALKALEVD----NSYMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRG--DDVKFCERLLEEKKVALVPGSAFL--KPGFVRLSFATSIERLTEALDRIEDF. 379
13 -89.5003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  22  2......SLKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLET-----DALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVP--------ADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKA----VTALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVV------------ERIAQNMFICAPHASQVAALAALDCD--AELQANLDVYKANRKLMLERLPKAFTRIAPPDGAFYVYADVSDTDDSRAFAAEILEKAGVAVTPGLDFDPEGAGTLRFSYARATADIEEGLDRLEAF. 378
14 -89.1004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  21  3..MDLSKRFNKNLNKIEVSMIRQFDQSISD----IPDVLKLTLGEPDFATPKHIKEAAKRAIDA-----DESHYTGMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSALTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT-RSNDFVLTPEMLEEAILKE--GEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY--LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLI------------KSHQYLVTAATTSVQFAAIEALTN-GKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVGQDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEF. 387
15 -89.1003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  15  23.VVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDI----PMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYA------------AKAHTRICFASPSPLQEACANSINDAKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSK--KDFRISHWLINELGVVAIPPTEFYIKAENLLRFAVCKDDAYLENAVERLKLL. 443
16 -87.8001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  20  2.......KLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQ-----GKTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSP-----EQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAAPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAAT------------KIQGHSTSNVCTFAQYGAIAAYEN-SQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAKGRSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDTIKRGMERLEKF. 383
17 -87.7005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  22  2......TDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHL-----NQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLA------EIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA--WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAV------------DCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDTSDSLAFCSKLLADTGVAIAPGIDFDTAGGSFVRISFAGPSGDIEEALRRIGSW. 384
18 -87.4001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  18  2..TNNPLIPQSKLPQLGTTIFTQMSALA-----QQHQAINLSQGFPDFDGPRYLQERLAHHVAQ-----GANQYAPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPH------FRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEI------------RKVHQYLTFSVNTPAQLALADMLRAE-PEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSATLDDVEFCQWLTQEHGVAAIPLSVFCPFPHKLIRLCFAKKESTLLAAAERLRQL. 386
19 -86.9004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  17  19.GAMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPT-------QGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWF-----PDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPL-APDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEG-------LEMLASMRLCANVPAQHAIQTALGGYQSSEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDAK-DDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARF. 418
20 -86.4003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  15  2..MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVDAPTPGAFDLFSAGVQSG-----GVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSA---TRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARM------------EKLQAIVSLRAAGYSQAVLRGWFDE-APGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPKAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTL. 401
21 -86.3001xi9_A mol:protein length:406 putative transaminase  ali model follow..  20  5.......RASKRALSV-EYAIRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKE-----GHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQ-----PDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTK-DVPVIVMNGLSKVYFATGWRLGYMYFVDPE-------NKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTG-PMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIEVWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKF. 393
22 -86.3001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  14  8.TMHNKFDLPKRYQGSTKSVWVEYIQLA-----AQYKPLNLGQGFPDYHAPKYALNALAAAANS--PDPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYAIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGGTISSVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNL------------QMVHQNCVYTCATPIQEAIAVGFETEPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSARKDYRFTKWMTKSVGLQGIPPSAFYSEGEDFVRYCFFKKDENLQKAAEILRKW. 425
23 -86.2004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  14  1...MAKQLQARRLDGIDYNPWVEFVKLA-----SEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML---NQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHL------------RTVHQNSVFHCPTQSQAAVAESFEREPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISD--YDRRFVKWMIKNKGLVAIPVSIFYSVFDHYIRFCFVKDEATLQAMDEKLRKW. 418
24 -86.0005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  21  64LSSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIRE-----GFTRYTLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDP-----KDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACS------------KLQGQVSSGASSIAQKAGVAALGLGGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSA--DSSSLALYFLDKFQVAMVPGDAFG--DDSCIRISYATSLDVLQAAVEKIRKA. 465
25 -85.7003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  19  1............GMTFEPYPFERLRALLKEI-TPKKRGLDLGIGEPQFETPKFIQDALKNHTH------SLNIYPKSAFEESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTP--------SLNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENT-PPPSLLEANEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYK------------AFRAYLGYTSANAIQKASEAAWLDD--RHAEFFRNIYANNLKLARKIFKN----TLIYPYSFYVYLPVQ---NGENFAKTLYQNEGIITLPALYLGRNGADYVRLALVYDTPLLEKPLEIIETY. 371
26 -85.7002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  17  7.....MDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYEN------KPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAI------PQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRG-EFASALSIES--DKVVVIDSVSKKFSACGARVGCLITRNEELISHA------------MKLAQGRLAPPLLEQIGSVGLLNLD-DSFFDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELP-VEDAEEFARWMLTDFNTMVAPLRGFYLTGKKEIRIACVLEKDLLSRAIDVLMEG. 392
27 -85.6005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  15  2........NAKRIEGLDSNVWVEFTKLA-----ADPSVVNLGQGFPDISPPSYVKEELSKAAFI----DNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHL------------QTVQQNSFYTCATPLQAALAEAFWIDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSS--YDYKFVKWMTKHKKLTAIPVSAFCDSFEKLVRFCFIKKDSTLDAAEEIFRAWN 411
28 -85.1003jtx_A mol:protein length:396 aminotransferase  ali model follow..  19  2........MNTLLKQLKPYPFARLHEAMQGISPEGMEAVPLHIGEPKHPTPKVITDALTASLHE------LEKYPLTAGLPELRQACANWLKRRYGLTVDADEILPVLGSREALFSFQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPAPS------FNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFL------------LYRTYHGSAMSIPVQRASIAAWDDE--QHVIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPDG-DDLAFARNLWQKAAIQVLPGRFLGNPGEGYVRIALVADVATCVKAAEDIVSL. 394
29 -84.8002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  16  2.......ATVSRLRPYATTVFAEMSALA-----TRIGAVNLGQGFPDEDGPPKMLQAAQDAIAG-----GVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGR----GFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGV------------RAAKQYLSYVGGAPFQPAVALALDTE-DAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRP--DSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFCKRDDTLDEAIRRLSVL. 392
30 -82.4003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  17  9.KLIREKQNELHIKDLGMASIRDLVALVTNLEKAGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVA----SIYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVANREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKL-----REKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESFGRLSSSALYALSSGATHSAQWGMAAMLKADGEYNFRDSVIEYGRKARIMKKMFLDNGFDGNEPLADGFYFTVGYKGMDSSKLIEKFVRYGMCAITLKT-TGSKRNEAMRICTSLLPESFPDLEKRLQML. 433
31 -82.3001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  19  2.......RLHPRTEAAKESIFPRMSGLA-----QRLGAVNLGQGFPSNPPPPFLLEAVRRALG------RQDQYAPPAGLPALREALAEEF------AVEPESVVVTSGATEALYVLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPE----GFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGER---PRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLA------------GMRQWTSFSAPTPLQAGVAEALKARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG-----WDAFRLVEEARVALIPASAFYDPPKDLFRFAFCKTEEELHLALERLGRV. 367
32 -81.9001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  17  1..MSSWDVSMSNHAGLVFNPIRTVSDNA-KPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFKSTIVKDNVVLCSGGSHGILMAIAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEA-----DLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPTSVADFET-TVPRVILGGTAKNLVVPGWRLGWLLYVDP------HGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNT-PQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDLEKTDVEFFEKLLEEENVQVLPGTIFH--APGFTRLTTTRPVEVYREAVERIKAF. 409
33 -81.6003ele_A mol:protein length:398 Amino Transferase  ali model follow..  17  3.......VVNESMYQLVRSAIRELFEYGKAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTD-YDSVALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALDAYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEH------FQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFV---TKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAG-----RALGYVCAPSLFQKMIVKCQGAT------GDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKAL-EDDSNAFCEKAK-EEDVLIVAADGFG--CPGWVRISYCVDREMIKHSMPAFEKI. 392
34 -77.9003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  17  19......SVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDS----GKYNGYAPSIGFLSSREEIASYYHCP-EAPLEAKDVILTSGCSQAIDLCLVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEI-----DLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATL-STDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVK------LSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIPEFENDVEFTERLVAEQSVHCLPATCFE--YPNFIRVVITVPEVMMLEACSRIQEF. 414
35 -77.4003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  18  2......NVRPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDS----GKYNGYAPSIGYLSSREEVASYYHCP-EAPLEAKDVILTSGCSQAIELCLVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEI-----DLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATL-STNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGL------VKLSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIPEFENDVEFTERLIAEQSVHCLPATCFE--YPNFFRVVITVPEVMMLEACSRIQEF. 397
36 -76.7004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  15  32......RRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRS----GKFNGYPPTVGADNLRQVVSTYWRRFCQTKLKWENVIITSGVSQAIVLALALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWEC-----DLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDT-NVPRLILGGTAKYQVCPGWRVGWSILIDPMNVAGDWAVG-------MERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNLSYSDMEFYEKLLDEENVQVLPGEIFG--MSGFLRATVSRPSAVLNEAVDRIIEF. 432
37 -74.7006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  12  13......SHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA------EEGLQATYEKRFTEAFFQLHRQPTAL--VKNKTMLSYAASISTMVAMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVF-------YDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETV------------YNLHTSVLLNVSPFVLNMLTQYVRDSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVWFRVDHPELTATDVHRLLSADGVYVLPGRYFPSKGDAYVRMALAREPEMFADAMALTRQV. 401
38 -73.8003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  19  76..........................REVLALCDHPDLLQREEIKTLFSAISRAKQILAMIPGR-----ATGAYSHSQGIHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLNEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGL-----ETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKHSFKKIEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKASDESYASY-KAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQICNKAPDAFYALRLLESTGIVVVPGSGFGQPGTWHFRCTILPQEDKIPAVISRFTVF. 480
39 -73.6003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  15  49..QRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYLLDSPSFPEDAKKR---ARRILQACGGNSLGSYSASQGVNCIREDVAAYIRRDGGVPADPDNIYLTTGASDGISTILILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRYEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLL-----------SVRLCPPVSGQAAMDIVVNPPVREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFQMAPDMFYCMKLLEETGICVVPGSGFGREGTYHFRMTILPPVEKLKTVLQKVKDF. 483
40 -71.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  15  8LVPRGSHMSSLRPRREDPPVLEEWYRRHLG--PDIHDISSSGVHPYSFAEIRDVCRIPAADLDA-----VVMDDSVSQGGEGVRRAIADRYAG-----GDADRVLVTHGSSEAIALTLALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEI-----DPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADP---GADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATF------------PLRDRTTLFLSPLVELVAERAVRHA-DELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFREPQEVERFCLELLERHRTLLVPGTAFG--APHGARLGFGGPQEDFRAGLDGLSRF. 392
41 -70.6003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  17  1.........GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQG-----TKLNYGWIEGSPAFKKSVSQLYTG-----VKPEQILQTNGATGANLLVLSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLP-----DLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSEL-----DVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILR------------DYRDYTMICAGVFDDLVAQLALAHY-QEILERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIAVDMPMEDFCLQLLQEHGVLLVPGNRFE--RDGYVRLGFACEQETLIKGLEKLSQF. 367
42 -70.5003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  13  77.........YINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVAN-------NYPVPDRCLVNTEKIINYFLQEKDANLAEQTDLFPTEGGTAAIVYAFHLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHSYEK----DWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVV-----PYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDN------------IAHLDKVELRQLHKRYSSVVLDPDKDSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYRNFEQVDFLLKLAEKNGVVLVDGVGFG-AKPGELRVSQANLPTEYALIGKQVLEL. 521
43 -70.4005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  16  6.........................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLAESEQRPVQQIESEAHQAYFTLL-GQHGYPAEPGRVLSCYSSSVSMEILASLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGAD----------LSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAH-YDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPV------------EKIYSDILLGVSPLILALIREFSRDAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVERVAFAGRTGTEVWE-ELQRHHVFALPCRQFHSDGDHMVRIALSRSTEPLEKSVQVLRTV. 372
44 -69.0001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  2......RMLSRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENAKNPEAAAFKKNGESIFA-----ELALFQDYHGLPAFKKAMVDFMAEIRGVTFDPNHLVLTAGATSANETFICLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCTSSNGFQITETALEEAYQEEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSS-------------FGLVSSQTQHLLSAMLSDKKKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERLDLAMQRLKAF. 428
45 -67.3001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  13  1ILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFK------AIANFQDYHGLPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIICLADPGDAFLVPSPYYPAFNRDLRWTGVQLIPIHCESSNNFKITSKAVKEAYENQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEKDLVHIVYSLSKDMGLPGFRVGIIYSFND-----------DVVNCARKMSSFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPLLSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGVDIALARIRRF. 423
46 -67.3003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  15  3.......TFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKAADALCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFADGSTKKVLFPLAPEYIGYADSGLEDDLFVSARPNIELLPEGFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVP-FPGIIFSEARPL--WNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIA------------NMNGIISLAPGGMGPAMMCEMIKRNDRLSETVIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDLPITTELLYQRLKARGVLMVPGHYFFPGTHQCMRMNYVPEPDKIEAGVKILAEE. 409
47 -67.2003if2_A mol:protein length:444 Aminotransferase  ali model follow..  15  3......KFSKFGQKFTQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDAELFLETYKALGNDSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFVDKSILLPLTPEYIGYSDVHVEGQHFAAVLPHDGEEGFFKYRVDFEAENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLNWD---NNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVS------------AMNAVVNLAPTRFGAAIATPLVANDKQLSDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKDLPISTLDLYERLKAKGTLIVPSEYFFPGAHECIRMSIAADEQTLIDGIKVIGEV. 436
48 -66.4002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  13  89....................RYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-------GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPS---LNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAIC-----PENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLSTPQQVQMALFSLFAMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQKQSSTGDMLFRIADETGIVLLPGRGFGS-NRPSGRASLANLNEYEYAAIGRALR.. 516
49 -66.2002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  12  88....................RFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG--------CNYPVPPRMLTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMAYIFGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPD----GWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVC-----PRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPEVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNQSSTGDMLFRVADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRALRR. 516
50 -66.0003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  13  89....................RYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-------GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAYIFGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPA---LNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQS------FAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLA------------LGRLPESEKTALDDRYRSLLPDVRDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDQSSTGDMLFRIADETGIVLLPGRGFGS-DRPSGRASLANLNEYEYAAIGRALR.. 516
51 -60.4003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  16  2...............VKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGC--DLMSYFSDMTEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWG----------------FDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYT--------PITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKK-----------MVEYIIVNSIGVSKESQVRTAKILNSESENFFKYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYFGKSLGTKEETDLVSELRRHKVMSRAGERCGS-DKKHVRVSMLSREDVFNVFLERLANM. 383
52 -60.1002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  12  3MNPLAQS-LNEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDLTP-DEIFPYAPPQGIEELRDLWQQKMLRDNELSIDNSRPIVTNALTHGLSLVGLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYT--TDSLVEALQSYNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTS-----DQTTKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHD-VDPEALRKHLIDKYSIGVIALNATD------IRIAFSCEKDDIPHVFDSIAKA. 425
53 -58.6001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  10  30.........GIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVLSPWHRMSYFFNPVSNFIFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKG----YVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT--------PIKYKADEDILLFTMSKFTGHSGSRFGWALIKDE-----------SVYNNLLNYMTKNTEGTPRETQLRSLKVLKGTMRDLNTFGFKKLRERWVNITALLDQSDFSYQELPQSEYCYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFEA-SSRYVRLSLIKTQDDFDQLMYYLKDM. 421
54 -56.9003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  11  2.NAMTSVAAKHAKGKKLKDVIFVTAGQAQAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDS-----EHVGYAPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLINYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVNELAAKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNKSTSRATWSNICRPAMRTMANIVADPAKFKEYEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD---SANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL. 418
55 -56.4003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  1........MFENITAAPADPILGLADLFRADERP--GKINLGQGVYKDETGKTVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTL---FDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQ-----MKAAIYANYSNPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL-TKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAV. 395
56 -55.4004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  14  1.SNAMPMTIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDDKGKIIALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAISYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDF---FNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGISSSKEIIEEFE-ASLAHSARCNWSNGTHAAQNILIELERAENKKIYEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPT----DKAFDIVKDLEKENIFTIPSAKGI-------RVAICGGEEKIPKLVQRLAFY. 409
57 -54.5004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  15  3........MFEHIDAYPGDPILTLNENFQKDPRD--QKVNLSIGIYDAEGRIPVMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGL---FDAMLAAIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDAAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQ-----LAGAVRSNYSNPQTYGAKVVAAVLGTP-ALRKQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKQRGMFTTESQVDALREVHGVYILRSGRMCVAGLNDSNVGIVA--DAIGKVLKSGA... 402
58 -53.8002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1........MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTL----DALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDR-----AFSQMKAAIRVNYSSPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFIIKQNGMFSTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL....... 396
59 -53.8004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  2.....AVGTFENITAAPADPILGLADLFRADERPGK--INLGIGVKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAAFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTL---FDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQM-----KAAIRANYSNPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKG-RDFSFIIKQNGMFSFSG--LTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL....... 400
60 -53.7003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  20  4................FPSIEDLRARNTMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQR-----EAFGYQPDG--SLLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDATGGINL---------HDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSNP-----------SDAEHWQQLSPVIKDGASTLGLIAAEAAYR-YGTDFLNQEVAYLKNNHDFLLHEIPK-GAKITPMQATYLMWIDFRDTTIEGSPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAK.. 371
61 -53.5005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1......SSWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDNGKPVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGQTISGTGALRIGASFLRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGF---FTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQ-----LKILIRPMYSNPPLNGARIAAAILNT-PDLRKQWLQEVKGMADRIIGMRTQLVNLKKEGSTHNWQHITDQIGMFCKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLA--HAIHQVTK...... 401
62 -53.4001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1........MFENITATTADPILGLADLFRADERPGK--IDLGIGYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGSGALRVAAFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSL--NEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQ-----MKAAIRDNYSSPPAHGASVVATILSND-ALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL....... 396
63 -52.9003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1......SSWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDNGKPVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGQTISGTGALRVGASFLRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDI--SKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQ-----LKILIRPLYSNPPLNGARIAATILTSP-DLRKQWLQEVKGMADRIISMRTQLVNLKKEGSSHNWQHITDQIGMFCKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLA--HAIHQVTK...... 401
64 -52.8002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1........MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYNDETGKTVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTL----DALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQ-----MKAAIRVNYSSPPAHGASVVATILSN-DALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGMFFTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLC--EAIVAVL....... 396
65 -52.8001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  13  1........MLGNLKPQAPDKILALMGEFRADPRQGK--IDLGVGVYDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADL--AAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAM-----AFLNRQTYSFPPFHGAKIVSTVLTT-PELRADWMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEHRGMFSTPEQVKRIKEEFGIYMVGDS----------RINIAGNDNTIPILARAIIEV. 392
66 -52.6001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  1........MFENITAAPADPILGLADLFRADERP--GKINLGIGLYYDETGKIPVLTSVKKAEQLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTASGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTL---FDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQ-----MKAAIRANYSSPPAHGASVVATILSND-ALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL....... 396
67 -52.5003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  16  1........MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGIIPQLQAVAEAEARLNAQPH-----GASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVIQTLGGSGALADFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATL--KTLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQ-----LKATVRRNYSSPPNFGAQVVAAVLNDE-ALKASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNQRGMFSSAAQVDRLREEFGVYLIASG----------RMCVAGNTANVQRVAKAFAAV. 396
68 -51.8004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  13  10TQGPGSMSLFSAVELAPRDPILGLNEAFNA--DTRPTKVNLGVGVYTNEDGKILLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTATGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGV-----NFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQ-----LKRVIRTNYSNPPTHGGAIVAAVLAS-PELRASWVQELGEMRDRIRAMRNGLVRLKAAGIERDFSFINAQRGMFSTSAQVDRLREEFGIYAVSTG----------RICVAANTRNLDVVANAIAAV. 412
69 -51.7002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  17  4.....TKYLAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPELPRAVLGEIAKEV--LEKEPKSVMYTPANGIPELREELAAFLKKYDHLEVSPENIVITIGGTGALDLLGVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG--MRVDLLEEKIKELKAKGQKVKLIYT-IPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDN-EGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVL------------MQKQPIDFCAPAISQYIALEYLKRGEKYHLEGALLGYKEKRDIMLKALEN-NAEFTKPIAGMFVMFFLPEGADGISFANELMEREGVVVVPGKPFDESGKNAIRLNFSPSKEEIPIGIKKLAKL. 400
70 -51.4003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  17  8...................VNRRGTHSIKWDTYKNEELIHAWIADMDFEVPQPIQTALKKRIEH-----PIFGYTLPP--ENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDTYAI----DFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQ----------AFTSIQYRQGFHGLNIFAYTAMQSAYT-ECNDWLNEIRFYIEDNAKFACEYIKD-TLSVMKPEGSFLLWIDCSANLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRH.. 380
71 -51.0003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  1...............MQPVLVFKLTADFREDPDPRKVNLGVGACHPWVLPVVKKVEQKIANDNS-----LNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGALRIGADFLARWYGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENA-PEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNRDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQ-----MEKIVRITWSNPPAQGARIVASTLSN-PELFEEWTGNVKTMADRILTMRSELRRLEALKTPGTWNHITDQIGMFSNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSTKIAENLYFQSDY. 410
72 -50.4004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  14  1MAMGTEAQTQGPGSMGKPDPILGLGQDFRMDPAK--RKVNLSIGVYDDADQPFVLECVKQATLG-----TNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGL---LAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQYDAFVPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQ-----LALLIRPMYNNPPLYGAWVVSSILKD-PQLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMMATREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVS--QAIHNVTK...... 403
73 -50.0004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1............MAMGKPDPILGLGQDFRM--DPAKRKVNLSIGVYDDADQPFVLECVKQATLG-----TNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGL---LAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQYDAFVPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQL-----ALLIRPMYSNPPLYGAWVVSSILKDP-QLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMMATREQVELLRSEYHIYMTLNGRAAVSG---------LNSTNVEYVSQAIHNV. 388
74 -49.9001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  17  16.....DSFFSEKAMLMKASEVRELLKLVET-----SDVISLAGGLPAPET-ETIKKIAVEVLEEHADKA---QYGTTKGFTPLRLALARWMEKRYDIPMSKVEIMTVAGSQQALDLIGVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDK-GMRVDLLEEKLEELRKQGKRVKIVYTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHFDD-YGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKME------------IAKQSIDLCTNTFGQAIAWKYVENGYDEHIPKIIEFYKPRRDAMLEALEE-GVEWTKPEGGMFVRVTLPEGIDTKLMMERAVAK-GVAYVPGEAFHRDKKNTMRLNFTVPEETIREGVRRLAET. 407
75 -49.8003b1c_A mol:protein length:392 BetaC-S lyase  ali model follow..  20  17.....................LSHHTYKWKETETDPQLLPAWIADMDFEVMPEVKQAIHDYAEQ-----LVYGYTYAS--DELLQAVLDWEKSEHQYSFDKEDIVFVEGVVPAISIAIAFTKEGEAVLINSPVYPPFARSVRLNNRKLVSNSLKEENGLFQIDF---EQLENDIVENDVKLYLLCNPHNPGGRVWEREVLEQIGHLCQKHHVILVSDEIHQDLTLFGHEHVSFNTVPDFKDFALVLSSATKTFNIAGTKNSYAIIENPTLCA----------QFKHQQLVNNHHEVSSLGYIATETAYR-YGKPWLVALKAVLEENIQFAVEYFAQ-RLKVMKPQGTYLIWLDFSDGLTDDALFTLLHDQAKVILNRGSDYGSEGELHARLNIAAPKSLVEEICKRIVC.. 388

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24