current user: public

If you have questions about the server, please let us know.

Query: 6c3a_A mol:protein length:413 Uncharacterized protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYEKRFTEAFFQLHRQPTALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLLRHGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRDSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFRVDHPELTATDVHRLLSADGVYVLPGRYFYWSEPSKGDAYVRMALAREPEMFADAMALTRQVLDRHGRLast
1 -110.0006c3a_A mol:protein length:413 Uncharacterized protein  ali model  100  1MGSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYEKRFTEAFFQLHRQPTALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLLRHGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRDSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFRVDHPELTATDVHRLLSADGVYVLPGRYFYWSEPSKGDAYVRMALAREPEMFADAMALTRQVLDRHGR 407
2 -84.5005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  32  2....................TTQPQLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLWAESEQRPVQQIESEAHQAYFTLLGQHYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEED---ALHGADLSAELLSSVGCVFVTTPNNPTGRVL---AEERLRRLAEQCAEHGTVLALDTSFRGFDAAAH----YDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSRDAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVER--VAFAGRTGTEVWEELQRHHVFALPCRQFHWAEPSDGDHMVRIALSRSTEPLEKSVQVLRTVLET... 375
3 -81.8002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  17  1MGSSSSGLVPRGSMISNKLANIPDSYFGKTMGRKIE--HGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPQKYGAFHGKEAFKQAIVDFYQRQYNVKEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTA---TKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPS----ILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALN-HYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGG-IYVWLETPPGYDSEQFEQFLVQEKSILVAPGKPF----GENGNRYVRISLALDDQKLDEAAIRLTELAYLYE. 398
4 -79.1001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  14  1MSSTSNETMHNKFDLPKRYQGSTKSVWVEYIQLA-----AQYKPLNLGQGFPDYHAPKYALNALAAAANSPNQYTRGFGHPRLVQALSKLYSQLVDRPMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPSSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVM---DRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIR---ICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFEKSPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGG-YFMVADWSSARKDYRFTKWMTKSVGLQGIPPSAFYSEPNKHGEDFVRYCFFKKDENLQKAAEILRKWKGS... 428
5 -78.8001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  2.............ALSDRLELVSASEIRKLFDIA----AGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGTHYGPNIGLLELREAIAEKLKKQNGIPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVL---TKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYS---IASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGA-FYIFPRIRDTGTSKKFSELMLKEARVAVVPGSAF----GKAGEGYVRISYATAYEKLEEAMDRMERVLKERKL 388
6 -78.5001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  13  1...........MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGTKYAPPAGIPELREALAEKFRRENGLTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVEPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVY---PKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH------FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTEASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGA-FYVLMDTSPIAPDEVRAAERLLEAGVAVVPGTDFA------AFGHVRLSYATSEENLRKALERFARVLGR... 384
7 -78.5002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  13  2..............LSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGTHYTDSRGILELREKISELYKDKYKAIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD------FTVESLEEALSDKTKAIIINSPSNPLGEVID-------REIYEFAYENIPYIISDEIYNGLVYEGKCYS----AIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETEREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGA-YYVFPNIGE--DGREFAYKLLKEKFVALTPGIGF----GSKGKNYIRISYANSYENIKEGLERIKEFLNK... 370
8 -78.5003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  10  25VQAVAQRAGTIDVQRNENFGKLRAGPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLSGYGAEQGQGALREAVASTFYGHAGRAADEIFISDGSKCDIARI-QMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFD-PDNHFFPDLSKAKRTDIIFFCSPNNPTGAAA---TRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYE---IPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPEGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYI-WVGFPGK-PSWDVFAEILERCNIVTTPGSGY----GPAGEGFVRASAFGSRENILEAVRRFKEAYGKRNA 442
9 -78.3003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  13  16MSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDIPNQYSPTRGRPSLINSLIKLYSPIYNLKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVF---TREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRI---ATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGT-YFVLVDFSKKGKDFRISHWLINELGVVAIPPTEFYIKEHEKAENLLRFAVCKDDAYLENAVERLKLLKDYL.. 447
10 -78.2001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  15  2.............RLHPRTEAAKESIFPRMSGLA-----QRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFA----VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVF---GERELEAIARLARAHDLFLISDEVYDELYYGERP------RRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKARREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGT-YFLMAEL-----PGWDAFRLVEEARVALIPASAFY--LEDPPKDLFRFAFCKTEEELHLALERLGRVVNSPRE 373
11 -77.3002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  16  3...................RVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTGYCLKSCTLPFLEEAARWYEGRYGVPRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVA---DWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPS----PLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALK-TPKEVVRGYARVYRERALGMAEALKGV-LSLLPPRAT-MYLWGRLPEGVDDLEFGLRLV-ERGVALAPGRGF----GPGGKGFVRIALVRPLEELLEAAKRIREALD.... 376
12 -76.9004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  12  3........MDLSKRFNKNLNKIEVSMIRQFDQSI----SDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADSHYTGMAGLLALRQAASAFVKEKYHLPDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDRSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTY---SRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY-----LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALT-NGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGA-FYIFAKIPVGQDSFKFLQDFAKEKAVAFIPGVAF----GKYGEGYLRISYAASMETIKEAMKRLKEFMEQYAD 393
13 -76.6002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  14  2......GSDKIMDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRRQRVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTMEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVY---GKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEF------ASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLN-LDDSFFDFVRETYRERVETVLKKLEEHLKRFTKPSGA-FYITAELPVE-DAEEFARWMLTDFNTMVAPLRGFY-LTPGLGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCS 398
14 -76.5002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  11  13.TPQEKIEYKTKVSRNSNMSKLQAGPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRL-QVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYG-NGFFPDLSTVGRTDIIFFCSPNNPTGAAA---TREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRS----IFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYV-WVHFPNQ-SSWDVFAEILEKTHVVTTPGSGF----GPGGEGFVRVSAFGHRENILEACRRFKQLYK.... 426
15 -76.5003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  12  2........MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVDAPTPGAFDLFSAGVQSGGQAYTEYRGDLGIRDLLAPRLAAFTGAARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVY---SAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEA--AVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWF-DEAPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAG-SYLFPRLPKLAAPAEFVKILRLQAGVVVTPGTEF----SPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR. 406
16 -76.5004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  14  5.............LQARRLDGIDYNPWVEFVKLA-----SEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDNQYTKTFGYPPLTKILASFFGELLGQPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVF---SREELELVASLCQQHDVVCITDEVYQWMVYDGHQHIS---IASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFERQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGS-YFLITDISDFKYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKFDHYIRFCFVKDEATLQAMDEKLRKWKVELEN 424
17 -76.1005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  13  1.............ANAKRIEGLDSNVWVEFTKLA-----ADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNQYTRGFGHPALVKALSCLYGKIYQRPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVY---TRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVK---IATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGG-YFIIADVSSLGYDYKFVKWMTKHKKLTAIPVSAFCDSKSKPFEKLVRFCFIKKDSTLDAAEEIFRAW...... 410
18 -76.0002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  11  9.............RRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDGYSTSRGIPRLRRAISHWYRDRYDVPESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCV---ELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQ---VPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALE-GDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKAS-MYVWAKIPEHLGSLEFAKKLLQDAKVSVSPGIGF----GDYGDDHVRFALIENRDRLRQAVRGIKAMFRADGL 400
19 -76.0001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  13  1.......MTNNPLIPQSKLPQLGTTIFTQMSALA-----QQHQAINLSQGFPDFDGPRYLQERLAHHVAQGNQYAPMTGVQALREAIAQKTERLYGYADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMAQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVW---QQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHAS---VLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLR-AEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGT-YFLLVDYSAVSDDVEFCQWLTQEHGVAAIPLSVFC--ADPFPHKLIRLCFAKKESTLLAAAERLRQL...... 386
20 -75.7003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  11  1...........MSLKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDLGYTVALGLPALRQRIARLYGEWYGVDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPPENRLQPVPADF---AGLDLAGLMVASPANPTGTML---DHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVT-------ALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALD--CDAELQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDTDDSRAFAAEILEKAGVAVTPGLDFD---PERGAGTLRFSYARATADIEEGLDRLEAFMQARGE 384
21 -75.6003jtx_A mol:protein length:396 aminotransferase  ali model follow..  14  1.............GMNTLLKQLKPYPFARLHEAMQGISPEGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRYD-ADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVL---DLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDD--EQHVIDNRRLYQEKFERVIPILQQV-FDVKLPDAS-FYIWLKVPD-GDDLAFARNLWQKAAIQVLPGRFLARDTGNPGEGYVRIALVADVATCVKAAEDIVSLYR.... 396
22 -75.1001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  13  1.......MGSDKIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGVKYTDPRGIYELREGIAKRIGERYKKSPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVEMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVY---RREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTS----ILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS----YMVQTFKERKNFVVERLKKMGVKFVEPEGA-FYLFFKVRG--DDVKFCERLLEEKKVALVPGSAFL------KPGFVRLSFATSIERLTEALDRIEDFLNS... 382
23 -74.7006DK6 Entity 1(prereleased)  ali follow..  12  7............NFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELKGYGPEQGYDFLRNAIADNDYKARGLEADEIFISDGSKCDTGNI-LDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYCTPENGFVPDIPQEKADLIYLCYPNNPTGAVA---TRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFE---IEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKSRRHSTKFNGASYIVQKGAEALYTDEGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYV-WVGCPAGLTSWQMFDKMLNEANVVITPGSGF----GSAGEGYFRISAFNSRANVEEVCRRIAAL...... 410
24 -74.4005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  11  1...........MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNLGYSVALGIPELRDAIAADYQRRHGIEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPPQTRFQPTAQMLA-EIDPPLRGVVVASPANPTGTVI---PPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQT-----SCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDTSDSLAFCSKLLADTGVAIAPGIDFD---TARGGSFVRISFAGPSGDIEEALRRIGSWLPS... 387
25 -74.3002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  11  2.............ATVSRLRPYATTVFAEMSALA-----TRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGNQYPPGPGSAPLRRAIAAQRRRHFGVPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVL---SATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLP---LAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALD-TEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGT-YFLCADPRPLGDSTEFCAALPEKVGVAAIPMSAFC-QQADVWNHLVRFTFCKRDDTLDEAIRRLSVLAERPAT 398
26 -73.1004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  10  13.ENLYFEGAMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVY---SKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLA----PDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHEGLEMLASMRLCANVPAQHAIQTALGGYQSSEFITPGGRLYEQRNRAWELINDIGVSCVKPRGA-LYMFPKIDAKRDDQKMVLDFLLQEKVLLVQGTAF----NWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ 424
27 -73.1001xi9_A mol:protein length:406 putative transaminase  ali model follow..  11  1.........AGSIRASKRALSVE-YAIRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGNYYGDSEGLPELRKAIVEREKRKNGVTPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALY---DKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSL-----TKDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLT-GPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGA-FYIFPKIEVWKNDKEFVLDVLHNAHVLFVHGSGF----GEYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLK 399
28 -72.9004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  14  39.............VRNVNLEKLKNNYLINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLRGYGLEQGNKTLRKAIAETFYRDLHVKSNEVFVSDGAQSDI-SRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQ-NSFFPDLAMTPRTDVIFFCSPNNPTGYVA---SRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRS----IYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSSGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYL-WVHFKGS-KSWDVFNEILENTHIITVPGSGF----GPGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTK 444
29 -72.1001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  11  2.............KLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGTRYGPAAGEPRLREAIAQKLQRDNGLGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVY---TPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAAS--PEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYE-NSQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGA-FYMFPSIAKTGSSLDFCSELLDQHQVATVPGAAFG------ADDCIRLSYATDLDTIKRGMERLEKFLHGI.. 387
30 -72.0003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  14  1..................GMTFEPYPFERLRALL-KEITPKKRGLDLGIGEPQFETPKFIQDALKNHTHSLNIYPKSAFEESLRAAQRGFFKRRFKIKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTL---SLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMLANEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLD--DRHAEFFRNIYANNLKLARKIFKNT-----LIYPYSFYVYLPVQN---GENFAKTLYQNEGIITLPALYLG--RNRIGADYVRLALVYDTPLLEKPLEIIETYRENHA. 376
31 -70.1005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  13  59.NDAETLSSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGTRYTLNAGITELREAICRKLKEENGLAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVY---PKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTS---FASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGKAGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGA-FYLFIDFSAYNDSSSLALYFLDKFQVAMVPGDAFG------DDSCIRISYATSLDVLQAAVEKIRKALEPLRA 471
32 -69.9003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  10  2.............KRNPHFVSLTKNADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLRGYGPDFGLPALRQKLSEDFYRGF-VDAKEIFISDGAKVDL-FRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIPCLQENAFFPE-----FPEDTHIDILCLCSPNNPTGTVL---NKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFE---IPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ---LEAIHYYRENSDLLRKALLATGFEVFGGEHA-PYLWVKPTQANISDDLFDFFLREYHIAITPGIGF----GRSGSGFVRFSSLGKREDILAACERLQMAPALQS. 394
33 -69.5001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  14  1........MSSWDVSMSNHAGLVFNPIRTVSDNA-KPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEANGYFPTVGSPEAREAVATWWRNSFTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNF---SRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLV-CGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGA-MYLMSRIDDIKTDVEFFEKLLEEENVQVLPGTIFH------APGFTRLTTTRPVEVYREAVERIKAFCQRHAA 415
34 -68.2003ele_A mol:protein length:398 Amino Transferase  ali model follow..  10  3.............VVNESMYQLVRSAIRELFEYKRAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDYHGYTSAQGDVETRAAIAEFLNNTHGTNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPDTEHFQIDFDALEERINAHTRGVIINSPNNPSGTVY---SEETIKKLSDLLEKKPIFIIADEPYREIVYDGIK------VPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGVCAPSLFQKMIVKCQG------ATGDINAYKENRDLLYEGLTRIGYHCFKPDGA-FYMFVKAL--EDDSNAFCEKAKEEDVLIVAADGFG------CPGWVRISYCVDREMIKHSMPAFEKIYKKYNK 398
35 -67.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  12  7LGTENLYFQSMWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGNGYAPSIGFLSSREEIASYYHCPAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVF---SKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLS----TDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGA-MYLMVGIEMEENDVEFTERLVAEQSVHCLPATCFE------YPNFIRVVITVPEVMMLEACSRIQEFCEQHYH 420
36 -67.5004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  15  1MGSSSSGLVPRGSHSSLRPRREDPPVLEEWYRRHLG--PDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVDDSVSQGGEGVRRAIADRYAG---GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTL---SPQGLRALKERTAATGAVLVWDAATAEIAHRWEV------LADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVR-HADELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGG-VCALPVFREPQEVERFCLELLERHRTLLVPGTAFG------APHGARLGFGGPQEDFRAGLDGLSRFLRERAA 398
37 -65.8003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  12  4..............RPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGNGYAPSIGYLSSREEVASYYHCPEPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVF---SKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLS----TNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGA-MYLMVGIEMEENDVEFTERLIAEQSVHCLPATCFE------YPNFFRVVITVPEVMMLEACSRIQEFCEQH.. 401
38 -65.7003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  2MNFPIDEKLIREKQNELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGSIYPNLDGLPELKQEASRFAKLFVNIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCM---TDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSHPGEYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKNDGEYNFRDSVIEYGRKARIMKKMFLDNGFDGNEPLADGFY-FTVGYKGMDSSKLIEKFVRYGMCAITLKTT-----GSKRNEAMRICTSLLESQFPDLEKRLQMLNAE... 436
39 -65.5004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  13  20YDDDDKDRWTSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGNGYPPTVGADNLRQVVSTYWRRFCQLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNF---SRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFD----TNVPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERL-TQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQAS-MFVMLKLNLSKSDMEFYEKLLDEENVQVLPGEIFG------MSGFLRATVSRPSAVLNEAVDRIIEFCERHKK 438
40 -65.0003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  16  1...............GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEELFALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTG---VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVM---DRTYLEELVEIASEVGAYILSDEVYRSFSELD--------VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALA-HYQEILERNRHILEENLAILDQWIEEELVSYIRPAVV-STSFVKIAVDMPMEDFCLQLLQEHGVLLVPGNRFE------RDGYVRLGFACEQETLIKGLEKLSQFLRRFDK 373
41 -62.9003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  14  42.GEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGSYSASQGVNCIREDVAAYITRRDGADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQ---SRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRKVLYEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRCPPVSGQAAMDIVVNPPVREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGA-MYAFPRIFQMAPDMFYCMKLLEETGICVVPGSGFGQ---REGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE 489
42 -61.9003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  62VTESKLTINNGIMAGYINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANN-YPVPDRCLVNTEKIINYFLQELSYAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEF---DTNALNAIKQAVEKNKLMIISDEVYGAFVPNFK--------SIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDPDADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTH-YYSLIDIYRNFEQVDFLLKLAEKNGVVLVDGVGFG-----AKPGELRVSQANLPTEYALIGKQVLELLKEYYE 527
43 -60.8003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  11  3.............TFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKNYDGPQGKTALLNALAVLLRETLGIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVI---TDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFS------EARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNDRLSETVIKPFYYQRVQQTIAIIRRERCLIHKPEGAIFL-WLWFKDLPITTELLYQRLKARGVLMVPGHYFFPGLDKHTHQCMRMNYVPEPDKIEAGVKILAEEIERAWR 415
44 -60.4001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  12  1...........MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENAKNPEAAAFKKNGESIFAEALFQDYHGLPAFKKAMVDFMAEKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTIVPIHCTSSNGFQITETALEEARNLRVKGVLVTNPSNPLGTT---MTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGL-VSSQTQHLLSAMLSDKKKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFC-WVDMRHFEAEMELWKKIVYEVHLNISPGSSC----HCTEPGWFRVCFALPERTLDLAMQRLKAFVGEYYN 434
45 -60.3003if2_A mol:protein length:444 Aminotransferase  ali model follow..  13  3.............KFSKFGQKFQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDAVNTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDLENLPALKEGRIGAICCSRPTNPTGNVL---TDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYS------DAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDKQLSDNEIKPFYQKQATLAVKLLKQYPLMIHKPEGAIFL-WLWFKDLPISTLDLYERLKAKGTLIVPSEYFF-SDYQHAHECIRMSIAADEQTLIDGIKVIGEVVRELYD 442
46 -60.2003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  13  76................................REVLALCDHPDLLQREEIKTLFSAISRAKQILAMIPGRAGAYSHSQGIHGLRDAIASGIASRDGFNADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPLNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVL---AEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKKIVRSLGYGEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASLVASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGA-MYVFPQICNKAPDAFYALRLLESTGIVVVPGSGFGQVP---GTWHFRCTILPQEDKIPAVISRFTVFHEAFMS 486
47 -59.1001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  11  2.......LSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKAIANFQDYHGLPEFRKAIAKFMEKRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTT---LDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEQEMTDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFC-WMDLRPFDSEMSLWRVIINDVKLNVSPGSSF----ECQEPGWFRVCFAMDDGTVDIALARIRRFVGVEK. 428
48 -57.2002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  11  58..AAAESELSYSYMTVGVGGLAKLDGIEGAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLTVSEQIVRQYIVREPPESVDLFAVEGGTAAMSLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKM---DQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQ--------SLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQ------LPESAKKALDHRYR-SLLPDVRSLKFIDRLVADSRVVALNHTGLSTPQQVQMVYYTLIDLQNQSSTGDMLFRVADETGIVLLPGRGFG-----SDRPSGRASLANLNEYEYAAIGRALRRLAD... 519
49 -56.2003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  12  57FAAAESELSYSYMNTVGVGGLAKIEGIEGAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGC-NYPVPPRMLNISEKIVRQYIIREMGAESVNLFAVEGGTAAMSMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVDPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKM---DERSLERVRKIVAEHDLMILTDDVYGTFADGFQ--------SLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVD-YYTLIDLQDQSSTGDMLFRIADETGIVLLPGRGFG-----SDRPSGRASLANLNEYEYAAIGRLRQMADELYA 524
50 -56.0002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  12  57FAAAESELSYSYMTTVGVGGLAKIDGIEGAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGC-NYPVPPRMLNISEKIVRQYIIREMGAESVNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVDPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKM---DQRSLERVRNIVAEHDLMILTDDVYGTFADDFQ--------SLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVD-YYTLIDLQDQSSTGDMLFRIADETGIVLLPGRGFG-----SNRPSGRASLANLNEYEYAAIGRALRKMAD... 520
51 -55.1002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  11  1.....GAMNPLAQSLNEQLQQSNATAFAMLSDLGQNSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDLTPYAPPQGIEELRDLWQQKMLRDNP-NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTDKDGHYTTDSLVEALSYNKDKVIMILNYPNNPTGYTP---THKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSFTALTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFM-AIKVHDV-DPEALRKHLIDKYSIGVIALNATD----------IRIAFSCEKDDIPHVFDSIAKAIDDLR. 430
52 -53.2003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  10  2.....................VKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMS-LEPELEDAIKDLHGVNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGD---------AWGFDKKGPYIELVTSPNNPDGTI--------RETVVNRPDDDEAKVIHDFAYYWPHYTP-----------ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLE-KEETDLVSELRRHKVMSRAGERCG-----SDKKHVRVSMLSREDVFNVFLERLANMKLIKSI 389
53 -52.0001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  15VANINCSEHGRAFLDGIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVLVSPWHRMS-ISFELEKTIKELHEVNAAAKDRYIVFGVGVTQLIHGLVISLDAPESKVVAHAPFYPVFREQTKYFD------KKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH-------------AVIKGCKSIYDMVYYWPHY-----------TPIKYKADEDILLFTMSKFTGHSGSRFGWLIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKGTMRDLNTFGFKKLRERWVNITALLDQSDFSYQELPQSEYCSYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFE-----ASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRK 427
54 -50.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  11  2........NAMPMTIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDDKGKSVYDRLDEMDRSHASYAPIEGEKDYRKIVIDTLGPYKPEGYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEDDFAFNIDVYKEAIDEGIRDSASLINSPNNPTGYSL---SDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPRNLFVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEASLAHSARCNWSNGTHAAQNILKKIYEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFF-TFIPTD----KAFDIVKDLEKENIFTIPSA-----------KGIRVAICGGEEKIPKLVQRLAFYTNK... 412
55 -50.0002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  13  1........MDYTKYLAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPEL-GEIAKEVLEKEPKSVMYTPANGIPELREELAAFLKKYDHLSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDND-LLEEKIKELKAKGQKVKLIYTIPTNPMGVTMSMERR---KALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKAL----DNEGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKRGEKYHLEGALLGYKEKRDIMLKALEN-NAEFTKPIAGMFV-MFFLPEGADGISFANELMEREGVVVVPGKPFY---DESGKNAIRLNFSRSKEEIPIGIKKLAKLYKEK.. 404
56 -49.2001vp4_A mol:protein length:425 aminotransferase, putative  ali model follow..  11  1MGSDKIMVVNLEGKISKIGQNMKSSIIREILKFAAD------DAISFGGGVPDPETAEIAKEIIEKEYHYTLQYSTTEGDPVLKQQILKLLERMTGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPEDDGMDLNVLERKLSEFDKNGKFIYVVSNNPAGVTTSLEKR---KALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKI----GGPERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLEQLKPTIELYRRKRTVMLNALEEPGVKWVKSEGGLFI-WLTLPEGFDTWEMFEYAKRK-KVFYVPGRVFKVY--DEPSPSMRLSFCPPDEKIVEGIKRLREVVLEYGK 414
57 -49.2003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  11  24..........................................GVLPLWVAESDFSTCPAVLQAITDAVQREA-FGYQPDGSLLSQATAEFYADRYGARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREG--IFIDATGGINLHDVEKGFQAGARSILLCNPYNPLGMV---FAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTV---AAGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSNPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRGAKITPMQAT-YLMWIDFRDTTIEGSPSEFFIEKAKVAMNDGAWF----GEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT. 377
58 -49.2003ue8_A mol:protein length:439 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  14  1........MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVARDILSRWKPEDAKNPQKNTPKFLYTV-PNNPTGNSLTSERK---KEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSM----DVDGRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGMAHVDRVIDFYSNQKDAILAAADK-LAEWHVPAAGMFL-WIKVKGINDVKELIEEKAVKMGVLMLPGNAFY-VDSSAPSPYLRASFSASPEQMDVAFQVLAQLIKE... 423
59 -49.0006d0a_A mol:protein length:431 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  14  1........MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVARDILSRWKPEDAKNPQKNTPKFLYTV-PNNPTGNSLTSERK---KEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSM----DVDGRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGVDRVIDFYSNQKDAILAAADK-LAEWHVPAAGMFL-WIKVKGINDVKELIEEKAVKMGVLMLPGNAFY-VDSSAPSPYLRASFSASPEQMDVAFQVLAQLIKE... 423
60 -49.0003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  9..............AKHAKGKKLKDVIFVTAGQADAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEVGYAPIAGIPDFLCAAEKECGNFRPEGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYS--NHEAFQNRVNELAAKQTNVVVIFNTPNNPTGYSI---EDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNWSNICRPAMRTMANIVADPAEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFI----TIPTDSANAICEELKKEHIYVIALANGIRIA-----CGIPKCQMTGLAEKIYNAMKSLGKL...... 418
61 -48.7003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  15  1..............MFENITAAPADPILGLADLFRADERP--GKINLGQGVYKDETGKSVKKAEQYLLENEKNYLGIDGIPEFGRCTQELLFGKGSALINDQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYADAENHTLDFDALINEAQAGDVVLFHGCCHNPTGIDP---TLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAE--GLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMYSNPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSF--SGLTKEQVLRLREEFGVYAVASG--------------RVNVAMTPDNMAPLCEAIVAVL..... 396
62 -48.7003ez1_A mol:protein length:423 Aminotransferase MocR family  ali model follow..  13  2..............MTKEASRPALDLARQAYE-AFKARGLNLNMQRGQPADADFDLSNGLLTVLGAEDVRMNYPGGVAGLPSARALFAGYLDVKSSLELQGLVLTFALLHGVRGSTGPWLSQTPKMIVTVPGYDRHFLLLQTLGFELLTVDQSDGPDVDAVERLAGTDPSVKGILFV-PTNPGGETISLEKARRLAGLQ--AAAPDFTIFADDAYRVHHLVEEDRAEPVNFVVLAGYPDRAFVFASTSKITF-AGAGLGFVASSEDNIRWLSKYLGAQSIGPNKVEQARHVKFLTEYPEGLMRDHAAIIAPKFRAVDEVLRAE-ATWTLPKGGYFI-SLDTAEP--VADRVVKLAEAAGVSLTPAGATYPAGQDPHNRNLRLAPTRPVEEVRTAMQVVAACIRLATE 417
63 -48.2001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  11  6.KKLSAEPINFDSFFSEKAMLMKASEVRELLKLVETS-----DVISLAGGLPAPETKKIAVEVLEEHADKALQYGTTKGFTPLRLALARWMEKRYDISKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDK-LLEEKLEELRKQGKRVKIVYTVSTNPAGVTMSVDRR---KKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHF----DDYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVENGYDEHIPKIIEFYKPRRDAMLEALEEEGVEWTKPEGGMFV-RVTLPEGIDTKLMMERAVAK-GVAYVPGEAFFVHRD--KKNTMRLNFTYPEETIREGVRRLAETIKEEMK 413
64 -47.1002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  1..............MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYDETGKTPVLTSVKKAEQYTKNYLGIDGIPEFGRCTQELLFGKGSALINDQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYADAENHTLDFDALINEAQAGDVVLFHGCCHNPTGIDP---TLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE--GLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSF--SGLTKEQVLRLREEFGVYAVASG--------------RVNVAMTPDNMAPLCEAIVAVL..... 396
65 -47.1004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  14  1..........MAVGTFENITAAPADPILGLADLFRADERP--GKINLGIGVKDETGKTPVLTSVKKAEQYTKNYLGIDGIPEFGRCTQELLFGKGSALINDQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYADAENHTLDFDALINEAQAGDVVLFHGCCHNPTGIDP---TLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAE--GLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMYSNPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSF--SGLTKEQVLRLREEFGVYAVASG--------------RVNVAMTPDNMAPLCEAIVAVL..... 400
66 -47.1005c6u_A mol:protein length:435 Aminotransferase  ali model follow..  13  4............SLSPQELAALHARHQQDYAALQGM--KLALDLTRGKPSAEQLDLSNQLLSLPGDDYRDPENYGGQHGLPGLRAIFAELLG----IAVPNLIAGNNSSLELMHDIVAQEQDGIKFLCPVPGYDRHFAITETMGIEMIPIPLQDGPDVDLIEELVAVDPAIKGMWTV-PVNPSGVTYSWETVRRLVQMR--TAAPDFRLFWDNAYAVHTLTLDFPRQVDVLGLAAKAGNRPYVFASTSKITF-AGGGVSFFGGSLGNIAWYLQYAGKKSIGPDKVNQLRHLRFFGDADRLHMLRHQQILAPKFALVAEVLDQKIASWTEPKGGYFI-SLDVLPG--TARRTVALAKDVGIAVTEAGASFPYRKDPDDKNIRIAPSPSVPDLRNAVDGLATCALLA.. 416
67 -46.8003l8a_A mol:protein length:421 Putative aminotransferase, probable beta-cystathionase  ali model follow..  16  1MGSSSSGLVPRGSHMASMTGGQQMGR-LNQFTYKWKTSENNPELLQMWVADMDFLPVPEIKEAIINYGREH--FGYNYFNDDLYQAVIDWERKEHDVVKEDILFIDGVVPAISIALQAFSEKGDAVLINSPVYYPFARTIRLNDHRLVEQIINGRFEIDFEQLEKDIINNVKIYLLCSPHNPGGRV---WDNDDLIKIAELCKKHGVILVSDEIHQDLALFGNTHHSLNTLD--ASYKDFTIILSSATKTFNIAGTKNSFIIQNESLRRKFQYRQLANNQHEVPTVGMIATQAAFQYGKPWLEELKTVIEGNIKLVIKELEAKTKIKVMEPEGTYLVWLDFSAYAIAQPQLSELQNEAKVVLNDGAHF----GKEGKYFARLNVATPKNTVQEALSRIISVFGK... 415
68 -46.6003d6k_A mol:protein length:422 Putative aminotransferase  ali model follow..  12  1.....SNAMSLKDYDAARLAQVREEVTAKYAELKAK--NLSLDLTRGKPSAEQLDLSNDLLSLPGGDFRTKDNYGGLLGIADIRELWAEALG----LPADLVVAQDGSSLNIMSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEMINVPMTDE--PDMGVVRELVKDPQVKGMWTVPGNPTGVTFSEQTCRELAEMST--AAPDFRIVWDNAYALHTLSDEFPIVHNVIEFAQAAGNRFWFMSSTSKITH-AGSGVSFFASSKENIEWYASHANVRGIGPNKLNQLAHAQFFGDVAKAHMLKHAASLAPKFERVLEILDS-VAKWTSPTGGYFI-SVDVVPG--TASRVVELAKEAGIALTGAGSSFPLHNDPNNENIRLAPSPPVAELEVAMDGFATCVLMA.. 418
69 -46.6003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  12  25..........................................ELIHAWIADMDFEVPQPIQTALKKRIEHP--FGYTLPPENIGDIICNWTKKQYNIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVQKQNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRV---WKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLS--EELAARTITCMAPSKTFNIAGLQASIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHTLSVMKPEGS-FLLWIDCSALNLSQDERTKLEEKGKIIVEPGEKY----GLGGEEHIGINIGCPRSVLEEILNRLRHTFS.... 383
70 -46.0005iwq_A mol:protein length:434 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  2......SSVSLQDFDAERIGLFHEDIKRKFDELKSK--NLKLDLTRGKPSSEQLDFADGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLG----VPVEQVLAGDASSLNIMSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNED--PDMDAVEELVKNPQVKGMWVVPSNPTGFTVTEDVAKRLSAMET--AAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNRFWAFTSTSKIT-LAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAERAVMRKHAASLAPKFNKVLEILDS-VAQWTVPAGGYFI-SLDVVPG--TASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSPPVEELEVAMDGVATCVLLA.. 419
71 -45.8002egy_A mol:protein length:397 Alpha-aminodipate aminotransferase  ali model follow..  12  8............EAFGKGAGRIQASTIRELLKLTQR------GILSFAGGLPAPEL-EEAAEAAARILREKGEVALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEE--PDLDALEEVLKRERPRFLYLIPSNPTGGLTPLPAR---KRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAR-EAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSERLERVRRVYREKAQAMLHALDRKEVRYTRPKGGMFV-WMELPKGLSAEGLFRRALEE-NVAFVPGGPFFANGG--GENTLRLSYATDREGIAEGVRRLGRALKGL.. 393
72 -45.4003b1c_A mol:protein length:392 BetaC-S lyase  ali model follow..  14  17...........................LSHHTYKWKETETDPQLLPAWIADMDFEVMPEVKQAIHDYAEQL--YGYTYASDELLQAVLDWEKSEHQFDKEDIVFVEGVVPAISIAIQAFTKEGEAVLINSPVYPPFARSVRLNNRKLVSKEENGLFQIDFEQLENDIVNDVKLYLLCNPHNPGGRV---WEREVLEQIGHLCQKHHVILVSDEIHQDLTLFGHEHVSFNTVS--PDFKDFALVLSSATKTFNIAGTKNSYIIENPTLCAQFKHQQLVNNHHEVSSLGYIATETAYRYGKPWLVALKAVLEENIQFAVEYFAQERLKVMKPQGT-YLIWLDFSDYGLTDDALFTLLDQAKVILNRGSDY----GSEGELHARLNIAAPKSLVEEICKRIVCCLPK... 392
73 -45.2003aov_A mol:protein length:448 Putative uncharacterized protein PH0207  ali model follow..  10  36..NIKSMLGDVERFFSKKALEMRASEVRELLKLVETS-----DIISLAGGLPNPKTRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKRGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDE-ILEEKLKELKSQGKKVKVVYTVPTNPAGVTMNEDRR---KYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKAL----DNEGRVIYLGTFSKILA-PGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYEKHIPEIRKFYKPRRDAMLEALEE-GVKWTKPEGGMFI-WVTLPDGIDSKKMLERAIKK-GVAYVPGEAFYAH--RDVKNTMRLNFTVDEDKIMEGIKRLAETIKEELK 441
74 -45.2003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  13  1..............MFQKVDAYAGDPILTLMERFKEDPRSSIGLYYNEDGIIPQLQAVAEAEARLNAQPHGSLYLPMEGLNCYRHAIAPLLFGADHPVLKQTIQTLGGSGALKVGADFLYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADL---TNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAY--AIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMGRVLGQLKATVRRNYSSPPNFGAQVVAAVLND-EALKASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYL---FSYTGLSAAQVDRLREEFGVYLIASG--------------RMCVAGNTANVQRVAKAFAAVM..... 397
75 -45.2004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  13  2.............AMFEHIDAYPGDPILTLNENFQKDPRD--QKVNLSIGIYDAEGRIPVMGAVREAETAPKPYLPMVGLAAYRDAVQSLVFGADHPARAAQTLGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPDEATGGLKFDAMLAALPARSIVLLHACCHNPTGVDL---DEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDA--DAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGT-PALRKQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRY---FTYTGLTESQVDALREVHGVYILRSG--------------RMCVALNDSNVGIVADAIGKVLKSGA. 402

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.