current user: public

If you have questions about the server, please let us know.

Query: 6cbk_A mol:protein length:424 Neamine transaminase NeoN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MTKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLLLSAGYHGYDPMWYPSEAPLEPNADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTAELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAAFDEAVLGEAERRFARVCERLAPYAGGEPVGDAARYRVAWNVMDGLRQAPRDREETTGLLARLLDDLELast
1 -117.0006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model  100  1MTKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLLLSAGYHGYDPMWYPSEAPLEPNADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTAELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAAFDEAVLGEAERRFARVCERLAPYAGGEPVGDAARYRVAWNVMDGLRQAPRDREETTGLLARLLDDLE 418
2 -112.0006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  100  17MTKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLLLSAGYHGYDPMWYPSEAPLEPNADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTAELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEVSFTSFFEPTILAAADAALARVATGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYAGDNQGVSAAFDEAVLGEAERRFARVCERLAPYAGGEPVGDAARYRVAWNVMDGLRQAPRDREETTGLLARLLDD.. 432
3 -101.0006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  55  22..GAGKLLAQEPTCPRDADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDRSIVLSSGYHGYDPMWHC-DEPFTPNQHGIVEFLFDLDVLAEWLSRPEQVAAVVISPDHMHLGERWYTEFTRLTKEADVPVIADEVKVGLRYRAGLST-PLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDVSFTSYFEPTAMAAATTTLRRMATGEPQQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFEGDNQTPSAAFTDEVVEDACGRIDRVSAALTGRFTDRELTEESWYASAWGAMDGLADRPRTREETTAIVERLWED.. 433
4 -91.1005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  22  26..ARRVLPGGNTRTTVYSAPYPPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLADGVAFAMPTEHEIALAELLTERVPSLQQVRFTNSGTEAVMMAIKAARAYTGRPRIFDGCYHGSYDFAETGGTPQAVLDSVVVLPFNDIDGTERLIEHRDELAAVLIDPNPRSAEPAFLQRLREITRAYGIVLIFDEVIS-LRSDYGGMQSLGVTPDLTAMGKIIGGGFPVGAVGGSAEVMSVFDPTGGTFNANPVTMVAGLTAMRKL-TPAEFDRLATLGQQLRAGVEEVLREAGVPGQVTGYGSLFHIHLHQRPLADRVHEALMGRGIFITPALFGCLSTPMGVPEVEAFVDAFAAALQDARG............................................. 446
5 -86.5002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  22  21..ARSVMPDGVTADTRAFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMIFEGHYHGWHDFSAAPGVLPETTANTLLIRPDDIEGMREVFNHGSDIAAFIAEPVGSHVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGDVKMIAAMRMALILEGVDIGGRGSVFLSAQHEREHVEHLVTTFDRVLDRLADENLLSWQGTNLSGNQS............................. 453
6 -86.4006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  21  21..ARSVMPDGVTADTRVFDPHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMIIATHYHGWHDFSAAPGVLPEIAKNTLLIRPDDIEGMREVFQHGSDIAAFIAEPVGSHVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGQGTFTGNPITAAAAIAAIDTILEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGDVKMIAAMRMALILEGVDIGGRGSVFLSAQHEREHVEHLVTTFDRVLDRLADENLLSWQPTNLSGNQS............................. 453
7 -84.7002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  20  58..ARRSMPGGNTRSILFHRPFPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQTENEALFAEAVCDRFPSIDLVRFTNSGTEANLMALATATAITGRKTVFDGGYHGGLLNFASGHAPTNAPYHVVLGVYNDVEGTADLLKHGHDCAAILVEPMLGAAERAFLDLLRAEASRCGALLIFDEVMTS-RLSGGGAQELGISADLTTLGKYIGGGMSFGAFGGRRDLMERFDPAAGTFNNNILTMSAGHAALTQIYTRQAASDLSASGDRFRANLNRIAVENQAPLQFTGLGSLGTIHFSRAPIRSLFFFHMLRKGIYLAPRGMYALSLEIADAGRDAFAEALADFIGEQRAL............................................ 457
8 -83.5005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  23  13..AQKHIPGGVNSPVRAVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPTALEVEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYTGRDSIFEGCYHGHSDSLLSPGVPAAFAKHTLTLPFNDIEAVRKTLEVGKEVACIIVEPVAGNPAPGFLEGLREACDEHGVVLIFDEVMTGFRVALGGAQAYGVTPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLAGTLSGNPLAMAAGLTTLRLISRPGFHDELTAYTTRMLDGLQQRADAAGIPFVTTQAGGMFGLYFSGAERFKRFFHLMLDGGVYLAPSEAGFTSIAHGDKELEITLNAAEKAFAALK.............................................. 429
9 -83.4002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  20  18..AQKLMPGGVSSPVRAVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIFEGCYHGHADMFLSPGVPKKTTANTLTTPYNDLEAVKALFENPGEIAGVILEPIVGNPDAGFLEGLREITLEHDALLVFDEVMTGFRIAYGGVQEFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAAGTLSGNPLAMTAGIKTLELLRQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNRFHRGMLEQGIYLAPSQAGFTSLAHTEEDIDATLAAARTVMSAL............................................... 432
10 -83.3002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  21  1......MPGGVSSPVRAVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVFEGCYHGHADMFLSPGVPKATTAATLTAPYNDLEAVSRLFEYPNDIAGVILEPVVGNPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAAGTLSGNPLAMTAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGHISGMFGLFFTAGPVTNAFHRGMLEQGIYLAPSQAGFTSLAHTEADIERTIAAARTVLSQL............................................... 411
11 -82.8003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  20  14..AQDLMPGGVNSPVRAVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKIFIGCYHGHGDSLLSPGVPEGVAKNTITVAYNDLESVKYAFEFGDDIACVIVEPVAGNPQPGFLEGLREVTEQNGALLIFDEVMTGFRVAYNCGQGYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSAGTLSGNPLAMAAGYETLVQL-TPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIFFTDEPVINAYYREMVEQGVFLPPSEGLFLSTVHSDADIEATIAAAEIAMSKLKA............................................. 429
12 -82.8003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  19  16..AQKLMPGGVNSPVRSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKIFEGCYHGHGDSLLSPGVPEGIAKNTITVPYNDLESVKLAFQFGEDIAGVIVEPVAGNPQEGFLQGLRDITEQYGSLLIFDEVMTGFRVDYNCAQGFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSAGTLSGNPLAMTAGLETLKQL-TPDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMIGFFFTNEPVINSYYKGMANEGVFLPPSEGLFLSTAHTDEDIENTIQAAEKVFAEISR............................................. 431
13 -82.7004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  20  45..QARYMPGANSRSVLFYAPFPLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAALHFTGRRKIFSGGYHGGVLGFGARPSPTTVPFDFLVLPYNDAQTARAQIRHGPEIAVVLVEPMQGAGQPDFLQALRESATQVGALLVFDEVMTS-RLAPHGLANLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPHSGTFNNNVMTMAAGYAGLTKLFTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRSLLFFHLLNEDIYSSPRGFVVLSLPLTDADIDRYVAAIGSFIGGHGA............................................. 442
14 -82.3004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  27  32..IKSVIAGGVSSSMRAAVPLPLVVRSAGGCLLRDVEDGEIIDLNMGYGPHLFGYADREVLDAVADQFAKGHMTGLPHELDARAGALIAELVPGVEQVRFANSGTEAVASALRLARATTGRTLVFEGHYHGWSETVLALGMIPEALAHTVQLGWNDPDALRELFADGDRIAAVIVEPVLANPAPGFLQLLRELTGRSGAMLVFDEVITGFRVARGGAQEYGVEPDLTVLSKVMGGGFPVAAFGGRRHAMRMLASNAGVYAGNHAALRAVVAMLGKIRSPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMSVALLKGSAEPRLQTLAQKEGVYFHPNEPWFLSTAHTRDVIDKVAGALQRSLVGLG.............................................. 458
15 -82.0004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  22  14..AQQLIPGGVNSPVRAVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYTGRDKIFEGCYHGHADCLLSPGVPTDFAKHTLTCTYNDLASVRQAFEYPQEVACIIVEPVAGNPLPEFLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTAGTLSGNPIAMAAGFACLTEISQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFTNADRFKRFFHLMLEEGVYLAPSEAGFMSLAHSNEDIQKTVNAARRCFAKL............................................... 429
16 -82.0003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  19  15..ALEHIVGGVNSPSRSGGGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIFAGCYHGHSDLVLSAGVPQSIAQEVITVPFNNVETLKEALDWGHEVAAILVEPIVGNPKPGFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDKFFKLMLQEGVNLAPSEAWFLTTEHTKEDIEYTIEAVGRAFAALADN............................................ 433
17 -82.0002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  22  13..AKRHIPGGVSSPVRAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYIFRGNYHGHADGLLSAGVPEEYAKLTLVLEYNDPEGLREVLKRGEEIAAIIFEPVVGNPTEDFLKALHE-AKAYGVLLIADEVMTGFRLAFGGATELGLKPDLVTLGKILGGGLPAAAYAGRREIMEKVAPLAGTLSGNPLAMAAGLATLELLEEPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEGPVVTRFFHGLLDRGIYWPPSEAAFLSVAHREEDVEKTLEALRKAL.................................................. 424
18 -81.8005hdm_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic  ali model follow..  20  20..AKNLMPGGVNSPVRSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTNKEKFFEGCYHGHANAFLSPGVPKAATSDTLTAPYNDLEAVEKLFAHKGEISAVILEPVVGNPTPEFINGLRQLTKDNGVLLIFDEVMTGFRLAYGGAQEFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAAGTLSGNPLAMTAGIHTLKRLKQAGTYEYLDKITKELTNGILEAGKKTGHPMCGGYISGMFGFFFAEGPVYNRFFRGMLEEGVYFAPSQAGFTSLAHTPEDIQLTIAAAERVLSRI............................................... 434
19 -81.6002epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  23  19..TKELFPGGVNSPVRAAKPYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLIFDGCYHGSHDAVLSAGVPEAVARLTLVTPYNDVEALERVFEYGDRIAGVIVEPVIANPRREFLAALQRLSRESGALLILDEVVTGFRLGLEGAQGFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQAGTFNAHPITMAAGLATLKALEEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFIGVEEVSNKLHEEMLRRGVFIAPSEAVFTGLPHQGEALEIAVEGLRSSLKTVLGS............................................ 434
20 -79.0005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  21  37..NRRHWLYGAPLHWMQQGNCPLLVKEAQGARVTDIDGQQYVDFALGDSGAMFGHAQPAVADAIARQARRGSTLMLPTEDSLWVGAELAR-RFGLPYWQVTTSATDANRFVLRLCRMLSGRDKVFNCNYHGSVDESQVHPNGVRHATTTRLVEFNDLDALEAALAH-GDVAAVLTEPFMTNPAEGFHAGLRELTRRHDVALIIDETHT-ISCGPAGYSGHGLEPDFFVLGKCIAGGIPSAVWGCSQAQAERIWAVGGTLAGNALQLAAMRATFAEVMTEDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIGARVEYLFMTHAPRNCLHLYLLNRGVLLTPFHNMALTCPARAEDVELHDRLLRDCLGELLERP........................................... 460
21 -54.3003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  20  12..............ANNYHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRAFHSDQLGWYEKVAKLTNKEMVLPMNTGAEAVETAIKTARRWANRAEIIEDNFHGRTMGAVSMSSNEEYKRGIIVIPYGDLEALKAAIT--PNTAAFILEPIQGEPPAGFLKEALEVCKKENVLFVADEIQTGLGRTGKACDWDNVTPDMYILGKALGGGFPISCAAANRDILGVFEPGGSTFGGNPLACAVSIAALEVLEEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPA--RPYCEQLKAAGLLCKETHENVIRIA-SEEDLEWAFQKIKAVLS................................................. 392
22 -54.1004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  20  18.TEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWPDSAKVINNNYWGRTITACSSSTTFDCYNGFELIDYDDVGALEEALK-DPNVAAFFVEPIQGEPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDSDAIDNDVVMKLKENGILSKPTRGRVMRFI-TDEEHRDATTRIIKSFLAVEEE............................................ 423
23 -54.1005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  21  8.NSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRAFYNSKLGYEQKITSLLGFDKVLPMNSGAEAVETAVKLARKWENAAKIIENNFHGRTTTIVSFSNDPDANQGFIRIPYNDIAALEEVLSKAGNIAAFLVEPIQGEPNEGFLKQSSELCKKHNVLFIADEVQTGIARTGKACHHEDVQPDILILGKALSGGMPVSAVLANNNIMDVIKPGGSTFGGNPLACAVAMAALDVVQDEKLSERAEKLGNLFRSEIEKLIEKTDLITKVRGKGLLNAILINDTPTAWNLCLALKENGLLAKPTHGNIIRLA-TEEQLLDCVKIIEKTILEF............................................... 413
24 -54.0001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  19  39.TSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGYEEYITKLFNYHKVLPMNTGVEAGETACKLARKWKYKAKIVAGNFWGRTLSAISSSTDPTSYDGFDIIPYNDLPALERALQ-DPNVAAFMVEPIQGEPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRAVDYENVRPDIVLLGKALSGGLPVSAVLCDDDIMLTIKPGGSTYGGNPLGCRVAIAALEVLEEENLAENADKLGIILRNELMKL--PSDVVTAVRGKGLLNAIVIKETKDWDAVCLRLRDNGLLAKPTHGDIIRFA-KEDELRESIEIINKTILSF............................................... 439
25 -53.8001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  20  23....................HPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQYEPYLELCEIMNQKVPGAKKTLLVTTGSEAVENAVKIARAATKRSGTIAGAYHGRTHYTLALTGKVNPYSAGMISEDDAIASIHRIFKNPEDIAAIVIEPVQGESSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGGTYAGNPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDKLTAEIVARARDKGLILLSCGRILVPLTIEDAQIRQGLEIISQCFDEAKQ............................................. 426
26 -53.4004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  20  33.TEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWPDSAKVINNNYWGRTITACSSSTTFDCYNGFELIDYDDVGALEEALK-DPNVAAFFVEPIQGEPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDSDAIDNDVVMKLKENGILSKPTRGRVMRFI-TDEEHRDATTRIIKSFLAVEEE............................................ 438
27 -52.6005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  17  33.....................PVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDR-VWDTYATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTHDYHGWTGGAATVT-SDGNLLKDENGELLSVKYTRRMIENPEQVAAVITEVSQGAPPYEYIPQIRKMTKELGVLWINDEVLTGFGRTGKGYQHYGVQPDIITMGKGLSSSSPAGAVLVSKEIAAFMDKHVSTYAGHPVAMAAVCANLEVMMEENFVEQAKDSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKPTQIIMKKALEKGVLIGGVMPNTMRIG-SRGDIDKAMDALDYALDYLESG............................................ 471
28 -52.6005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  21  27..........IGPHSPLFYRQPLELVSGSGVWLTDAQGKVYLDGYN--NVPHVGHANPAVADAIYQQLLTNLHTRYLNSRVVEYAEALLSKFDGLERLFLTNSGSEANELALRIARQHTGNTGVLDFSYHGNTTSLAEAHVRALRIPDVSGIAEVD-AAIASLQAAGHGVSVFLFDPLFSTLPSGYIEGVATRVRAAGGLVISDEVQSGFGRTGSGYQMFNVEPELVTMGKPMGNGHPIGAVVTTAELLDEFGRHFNTFAGNPVSSAAGLAVLRYMDQEDLMAKADQLGKYIRKRLENIAQRSGNVGSVRGRGLFFGIDIIESALTKILIEDMRERGVLISRVGPH--PLVFGREHADILLGQLELSLASLPQP............................................ 441
29 -52.5003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  18  9.SSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRAFFSDSLGCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWENSAKIINNNFSGRTLGCVSASTDKKCKNNFLKVPYDDLEALEKELQ-DPNVCAFIVEPVQGEPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKCTHHYGVKPDVILLGKALSGGYPISAILANDDVMLVLKPGGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVVWDICLKFKENGLITRSVHDKTVRLT-TKEQLDECTEIIVKTVKFFDDN............................................ 413
30 -52.4005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  17  33.....................PVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDRYGFVWDATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTHDYHGWTGGAATVT-SNGNYLKDENGELLSVKYTRRMIENPEQVAAVITEVSQGVPPYEYVPQIRKMTKELGVLWISDEVLTGFGRTGKGYQHYGVQPDIITMGKGLSSSSPAGAVVVSKEIAAFMDKHVSTYAGHPVAMAAVCANLEVMMEENLVEQAKNSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKPTQIIMEKALEKGVLIGGAMPNTMRIG-SRGDIDKAMDALDYALDYLESG............................................ 471
31 -52.4001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  19  21..............SGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQ-TPMRGEFYRTLTAILPPLNRVFPVNSGTEANEAALKFARAHTGRKKFVMRGFSGRTMGSLSVTWEPKYREPVEFIPYNDVEALKRAVD--EETAAVILEPVQGEATPEFLRAAREITQEKGALLILDEIQTGMGRTGKAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPK---REVRGMGLMVGLEL-KEKAAPYIARLEKEHRVLALQAGPTVIRFL-EKEDLERVVEAVRAVLA................................................. 395
32 -52.1003dod_A mol:protein length:448 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  15  18............TQMKDYDENPLIIESGTGIKVKDINGKEYYDGFSSVWLNVHGHRKKELDDAIKKQLGK-TLLGMTNVPATQLAETLIDISPKLTRVFYSDSGAEAMEIALKMAFQYPEKQKFIANGYHGDTIGAVSVGSESGDPDECRDQCLRELAQL--LEEHHEEIAALSIESMMIVMPEGYLAGVRELCTTYDVLMIVDEVATGFGRTGKACEHENVQPDLMAAGKGITGGYPIAVTFATEDIYKAFYDHGHSYTGNQLGCAVALENLALFESENIVEQVAEKSKKLHFLLQD-LHALPHVGDIRQLGFMCGAELVRSKIGYKVSLKMRELGMLTRPLGDVIAPLASTAEELSEMVAIMKQAIHEVTSL............................................ 446
33 -52.1003a8u_X mol:protein length:449 Omega-amino acid--pyruvate aminotransferase  ali model follow..  21  24............TANRNFLRDPRLIVAAEGSWLVDDKGRKVYDSLSGLWTCGAGHTRKEIQEAVAKQLST-PGFQYGHPLSFQLAEKITDLTPGLNHVFFTDSGSECALTAVKMVRAYATKTKMIGRGYHGVNIAGTSLGGVNGNRKLFGQPMQD-ADELLKLIELASNIAAVFVEPLAGSPPEGYLKRNREICNQHNILLVFDEVITGFGRTGSGADSFGVTPDLMCIAKQVTNGAPMGAVIASTEIYQTFMNQGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPHFEKALHG-IKGAKNVIDIRNFGLAGAIQIDAIVRPFEAGMALWKAGFYVRFGGDTLQTFNSKPQDLDRLFDAVGEVLNKLLD............................................. 449
34 -52.1001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  18  26.....................VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARQRFLTNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFARLMAAHRHEIAAVIIEPIMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKACEHAEIAPDILCLGKALTGGTTLSATLTTREVAETISNGGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAP-ARDAEMVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIAPFGKLIYPYIILPQQLQRLTAAVNRAVQDETFF............................................ 427
35 -52.1004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  16  26...ETYSLYGWTDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERHAAFGKMSDQTVMLSEKLVEVSPFSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTNAYHGATAVSASTGFPYNSVFGLPLPGFVHLRELEETIQRADTIAGFFAEPVMGAPAKGYFQAILPILRKYDIPVISDEVVCGFGRTGNGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKDKVSERIANTCTDLGLICFPLGQSVVPFILTEAQMDEMFDKLEKALDKVFAE............................................ 465
36 -52.0004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  19  39....................YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPAHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSGSYHGSTYGSQTLSGSSETEHDVSLRYFNEFKKPFESFLPADETACVLIEPIQGDAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGAIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKDDAATKVIYYAFAHGVVIITLAGNILRFQ-PREQLDQALQVLDDAFTAVENGEVTIPKDTGKIG................................ 461
37 -52.0003tft_A mol:protein length:457 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  17  40............SSIGREAVSPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV-MFGGLTHEPAARLAKLLVDITPGLDTVFFSDSGSVSVEVAAKMALQYPGKRRLMTGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAAQLAQHAGELAAVVVEPVMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGAAADHAGVSPDIMCVGKALTGGYSLAATLCTADVAHTISAGGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDT-ARALPAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYPYICTPAEITQITSAMVEVARLVGS............................................. 449
38 -52.0003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  19  38.....................TRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRENTFFKTTHVPAIALAQKLAELAPGLNHVFFAGGGSEANDTNIRMVRTYPEKTVIISNAYHGSTVASSAGGMAGMHAQSGLIPDVHHIRELEEAILEENRVAAFIAEPVQGAAPDSYWPEIQRICDKYDILLIADEVICGFGRTGNGTQTMGIRPHIMTIAKGLSSGYPIGGSIVCDEVAHVIGKDGYTYSGHPVAAAVALENLRILEEENILDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKIGYICRERCFANNLIMRHVGDRMIPLVITPAEIDEMFVRIRKSLDEAQAE............................................ 455
39 -52.0006erk_A mol:protein length:451 Aminotransferase  ali model follow..  15  41.....................NIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGK-MFGGLTHQPAIDLGKKLLSIVPGLDAIFYADSGSIAVEVALKMALQYPSKCQFASSGYYGDTWHAMSVCDPINGMHSLYGKQLPMQHFVAAFVKNSDKLAGFIIEPIMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFGRSGKACEHAAISPDIMTIGKALTGGYTFAATLSTREIADTISQSGPTFMGNPLACAVACASIDLIVSYDIEARTENMQAIMNEQLAPAVSLEGVK-EVRCLGAVAVIELNEAVDMPIFQTLLINNGIWVRPFGKLVYPYVITDDELTTLCQALLKVVSSYLTR............................................ 443
40 -51.9004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  20  25............SANRNFQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTSPGFQYGHPLSFQLAEKIAGLLPELNHVFFTGSGSECADTSIKMARAYPQKTKLIGRGYHGVNVAGTSLGGIGGTRGMAQTGGVELANELLKLIELASNIAAVIVEPMSGSPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTGAEYFGVTPDLMNVAKQVTNGAPMGAVIASSEIYDTFMNQGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHG-LQGAKNVIDIRNCGLAGAIQIDPTVRPFEAGMKLWQQGFYVRFGGDTLQTFNARPEELDRLFDAVGEALNGIA.............................................. 448
41 -51.9004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  20  39............SANRNFHKDPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGTSPGFQYGHPLSFQLAEKIAQMTPGLDHVFFTGSGSECADTSIKMARAYAQKTKLIGRGYHGVNVAGTSLGGIGGTKGAAETGGVELANELLKLIELASNIAAVIVEPMSGSPPKGYLQRLREICDANDILLIFDEVITAFGRMGKGAEYFGVTPDIMNVAKQVTNGAPMGAVIASSEIYDTFMNQGYTYSAHPVACAAGIAALDLLQKENLIQQSAELAPHFEKALHG-LKGTKNVIDIRNCGLAGAIQIDAIVRPFEASMKLWKEGFYVRFGGDTLQTFNAKPEDLDRLFDAVGEALNGVA.............................................. 462
42 -51.9003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  17  45............SSIGREAVSPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV-MFGGLTHEPAARLAKLLVDITPGLDTVFFSDSGSVSVEVAAKMALQYPGKRRLMTGGYHGDTFLAMSICDPHGGMHSLWTDVLAAQVFAAQLAQHAGELAAVVVEPVMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFGRTGAAADHAGVSPDIMCVGKALTGGYSLAATLCTADVAHTISAGGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDT-ARALPAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYPYICTPAEITQITSAMVEVARLVGS............................................. 454
43 -51.9004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  24  46....................VPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHFTHTCTPYEGYVAVTEQLNRLTPGAKRTVLFNSGAEAVENAVKVARLATGRDAVVAHAYHGRTNLTMALTAKAMPYKTNFAEAAKRAITMIEKQIGGDQVAAIIIEPIQGEPAEGFLPALSEWAKEKGIVFIADEVQSGFCRTGEAVDHEGVVPDIITMAKGIAGGLPLSAITGRADLLDAVHPGGGTYGGNPVACAAALAAIDTMEQHDLNGRARHIEELALGKLRELAAEGSVVGDIRGRGAMLAIELVQPELTKAVAAACLKEGVIILTCGRLLPPLVISDELLIDGLEVLAAAIKAHA.............................................. 456
44 -51.9001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  18  26.....................VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-MFGEITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARDRFLTNGYHGDTFGAMSVCDPDNSMHSLWKGYLPENLFARLMAAHRHEIAAVIIEPIMRMYHPEWLKRIRKICDREGILLIADEIATGFGRTGKACEHAEIAPDILCLGKALTGGTTLSATLTTREVAETISDGGPTFMGNPLACAAANASLAILESGDWQQQVADIEVQLREQLAP-ARDAEMVADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIRPFGKLIYPYIILPQQLQRLTAAVNRAVQDETFF............................................ 427
45 -51.9001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  18  22.TPEDYINNELKYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRAFFSVPLGCERYLTNLLGYDKVLMMNTGAEANETAYKLCRKWENMAKIVKNNFSGRTLGCISASTTKKCTSQFSKVPYDDLEALEEELK-DPNVCAFIVEPIQGEPSDNYLQGVYDICKKYNVLFVADEVQTGLGRTGKCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGGSTYGGNPLAASICVEALNVLINEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKNELVVLDICLKLKENGLITRDVHDKTIRLT-TKEQLDECTEIIVKTVKFFDER............................................ 426
46 -51.8004grx_A mol:protein length:465 Aminotransferase  ali model follow..  17  24...ETYSLYGFTDMPSVHQRGTVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRHAFFGRMSDQTVMLSEKLVEVSPFNGRVFYTNSGSEANDTMVKMLWFLPQKRKILTNAYHGVTAVSASTGKPYNSVFGLPLPGFIHLRELEDTITRADTIAGFFAEPVMGAPAKGYFQAILPILRKYDIPMISDEVICGFGRTGNGCLTYDFMPDAIISSKNLTAGFPMGAVILGPDLAKRVEAAGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEAGLKR-IADRPNIGEYRGIGFMWALEAVKDKVSERIANTCTDLGLICRPLGQSIVPFILTEAQMDEMFEKLEKALDKVFAE............................................ 463
47 -51.8004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  17  26...ETYSLYGFTDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPFSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTNAYHGVTAVSASTGKPYNSVFGLPLPGFVHLRELEETIQRADTIAGFFAEPVMGAPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKDKVSERIANTCTDLGLICRPLGQSVVPFILTEAQMDEMFDKLEKALDKVFAE............................................ 465
48 -51.7004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  20  1MSQPITRENFDEWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLLAKKLIDATFADRVFFCNSGAEANEAALKLARKFSHKSGIVKNAFHGRTLFTVSAGGQPAYSQDIRHAAYNDINSASALID--DSTCAVIVEPIQGEASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGEAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAISQEAAKAGVMVLIAGGNVVRFA-SEEEVTTGLDRFAAACEHFVSR............................................ 403
49 -51.7003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  15  12..............IPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSNLYYNENIAAAKNLAKASALERVFFTNSGTESIEGAMKTARKYAFNKIAFKHSFHGRTLGALSLTANEKYQKGVKFAKYNDISSVEKLVN--EKTCAIILESVQGEANKDFYKALRKLCDEKDILLIADEIQCGMGRSGKAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSGDHGSTYGGNPLVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKSVKVAKVIQKCQENALLLISCGENDLRFL-QKEHIDEMSEKLRKALKSF............................................... 395
50 -51.6004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  19  65.....................AVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIAGAFHGKSLGALSATAKSTFRKGFRHVPFGNIEAMRTALNEGDDVAAVILEPIQGEPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNIEPPLTLTIEQCELVIKAARKALAAMRVS............................................ 455
51 -51.4004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  19  14.QTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTSNVFTNEPALLGRKLIDATFAERVLFMNSGTEANETAFKLARHYPFKTKIIHNAFHGRSLFTVSVGGQPKYSDDIIHVPFNDLHAVKAVMD--DHTCAVVVEPIQGEATPEFLKGLRDLCDEHQALLVFDEVQCGMGRTGDAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGGSTYGGNPLACAVAGATFDIINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRAFLYAGAEAGVMVLNAGADVMRFA-EEADIHEGMQRFAQAVGKVVAL............................................ 415
52 -51.3005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  19  63.....................AVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIAGAFHGKSLGALSATAKSTFRKGFRHVPFGNIEAMRTALNEGDDVAAVILEPIQGEPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLFDHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNIEPPLTLTIEQCELVIKAARKALAAMRQQ............................................ 453
53 -51.3003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  25  50....................LPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFPYEGYVKVAEHLNRLTPGEKRTALFNSGAEAVENAVKIARAYTRRQAVVVHAYHGRTNLTMAMTAKNQPYKHGFGPFANEVHALDLINKQADNVAAVVIEPVHGEPAPGFLGALQKWCTDNGAVFVADEVQTGFARTGAACEHENVVPDLIVTAKGIAGGLPLSAVTGRAEIMDGPQSGGGTYGGNPLACAAALAVIDTIERENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVKPDLTKRVAAAAHAQGLVVLTCGRFLPPLSMPDHLLDEGLDILAAVFAEVK.............................................. 453
54 -51.3001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  19  25....................EPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGKLDHLFSGSRPVVDLATRLANITPPLDRALLLSTGAESNEAAIRMAKLVTGKYEIVGQSWHGMTGAAASVGSFAIPAPFTYRPRFERLDYAFDLIDRSGNLAAFIAEPILSSLPDGYMAALKRKCEARGMLLILDEAQTGVGRTGTACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELYTTHVSDPLPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKDGLGAKITRECMNLGLSMNIVQRIAPPLTVSEDEIDLGLSLLGQAIERA............................................... 432
55 -51.2002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  20  10..............MNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLFWNRPQMLAELLSKNTFGGKVFFANTGTEANEAAIKIARKYEKKYRILHNSFHGRTLGSLTATGQPKYQKGFEYFEFNNVEDLRRKMS--EDVCAVFLEPIQGEATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKAYQKYGVVPDVLTTAKGLGGGVPIGAVIVNERANVLEPGDHGTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIRFL-EYGEIDLAVETLKKVLQGI............................................... 391
56 -51.1003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  22  43....................MPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGDFTHTCTPYEGYVAVCEQLNRLTPVDKRSALFNSGSEAVENAVKIARSHTHKPAVVAHAYHGRTNLTMALTAKVMPYKDGFELAAKRAITVIDKQIGADNLAAVVIEPIQGEPADGFLPTLLDWCRKNDVVFIADEVQTGFARTGAACEHEGIDPDLIVTAKGIAGGLPLSAVTGRAEIMDSPHVSGGTYGGNPIACAAALATIETIESEGLVARAQQIEKIMKDRLGRLQAEDDRIGDVRGRGAMIAMELVKADLTKALCAGAHAAGVIVLSCGRFLPPLSIGDDLLNEGLDVLEEVLRG................................................ 450
57 -51.1003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  16  26...ETYSLYGFTDMPSLHQRGTVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPFSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTNAYHGVTAVSASTGKPYNSVFGLPLPGFVHLRELEETIQRADTIAGFFAEPVMGAPAKGYFQAILPILRKYDIPVISDEVICGFGRTGNGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAGFTASGHPVGCAIALKAIDVVMNEGLAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKDKVSERIANTCTDLGLICRPLGQSVVPFILTEAQMDEMFDKLEKALDKVFAEVAAAALE..................................... 472
58 -51.1005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  18  28.....................VFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYESRQRFLTNGYHGDTFGAMSVCDPHNSMHSLWKGYLAENLFARLMAAHRHEIAAVILEPIMRIYHPQWLQRIRQMCDREGILLIADEIATGFGRTGRACEHAGIAPDILCLGKALTGGTTLSATLTSRQVAETISNGGPTFMGNPLACAVANASLTLLESGDWRRQVAAIEAQLREELAPAADSPQVA-DVRVLGAIGVVETTRPVNIAALQQFFVRQGVWVRPFGKLIYPYIIQPEQLRRLTQAVNEAVREETF............................................. 428
59 -51.0003i5t_A mol:protein length:476 Aminotransferase  ali model follow..  17  37.....................QPVLTHAEGIYVHTEDGRRLIDGPAGMWCAQVGYGRREIVDAMAHQAMVASPWYMATSPAARLAEKIATLTPGLNRIFFTTGGSTAVDSALRFSEFYPQKKRIIVDGYHGSTALTAACT--HAGNRSQEAFLDDLVQEFEDRIESPDTIAAFLAEPILASPPAGYHARFKAICEKHDILYISDEVVTGFGRCGASEKVFGVVPDIITFAKGVTSGYPLGGLAISEAVLARISGEGYTYSNQPVACAAALANIELMEREGIVDQAREMADYFAAALAS-LRDLPGVAETRSVGLVGCVQCLLDPFTLKIDERCFELGLIVRPLGDLCVPLIISRAQIDEMVAIMRQAITEVSAA............................................ 457
60 -51.0003i4j_A mol:protein length:430 Aminotransferase, class III  ali model follow..  24  12.....................YPVAVRGEGVFLYDDAGRRYLDGSSGALVANIGHGRAEVGERMAAQAARVHGSQFSSDVLEEYAGRLARFVGLTFRFWAVSGGSEATESAVKLARQYPGRFKVITPSYHGASLGSLAAS-PKLPKPDPARNGAEDAEGLRALLERPETVAAFMAEPVVGAPAPGYYERVRDICDEAGIIFIADEVMSGMGRCGALSRWSGVTPDIAVLGKGLAAGYPLAGLLAAPQVYETVMGGSGTYAGHPVSVAAGLSVLDIVEREDLTGAAKERGAQLLAGLQALQARFPQMMQVRGTGLLLGVVLGDLATGQAFGAAALKRGLITYPGSGAEPNGR-TAAEVDGLLALLAGALEDV............................................... 428
61 -50.9005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  18  49.....................ARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLENLFFQTAHPPALELAKAIADIAPGMNHVFFTGSGSESNDTVLRMVRHYPQKKVVIGNGYHGSTVAGVSLGGMKALHSQGDLPIPG-AEQLEKKILEEENVAAFIAEPIQGAPPDTYWPKIREILAKYEILFIADEVICGFGRTGEGSQYYGNAPDLMPIAKGLTSGYPMGGVIVRDEIVDTLNEGGFTYSGHPVAAAVALENIRILREEKIVETVKAETAPYLQKRWQELADHPLVGEARGVGMVGALELVKNGVGMLCREHCFRNGLIMRAVGDTMIPLVITKPEIDELITLARKCLDQTAAV............................................ 465
62 -50.8005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  19  51....................YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQKLIHYTPHHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSGSYHGSTYGSQTLSGSSETEHDVSLRYFNEFKKPFESFLPADETACVLIEPIQGDAPEEYMQLVYKFCHEHGILFAIDEVNQGLGRTGAIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPLFTTAGNPVCSAASLATLDVIEYEGLVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKDDAATKVIYYAFAHGVVIITLAGNILRFQ-PREQLDQALQVLDDAFTAVENGEVTIPKDTGKIG................................ 473
63 -50.6004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  23  46....................APVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHTCFMVTPYEQYVQVAELLNALTPGDKRTALFNSGAEAVENAIKVARLATGRPAVVANAYHGRTNLTMALTAKSMPYKSVYRMPASYISRIETQIG-AQSLAAIIIEPIQGEPAPGFLATLTAWASENGVVFIADEVQTGFARTGAASEHEGIVPDIVTMAKGIAGGMPLSAVTGRAELMDAVYAGGGTYGGNPVTCAAAVAALGVMRELDLPARARAIEASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVKPALTKSIAAEALSQGVLILTCGRLLPPLVIGDDLLDEGITALSDIIRAKASH............................................ 452
64 -50.6004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  20  395LDRYHQYINPMMVDFLKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPNFIQPEQTAKLAEVLCRLAPGMGRVFFSNSGTEAVEAAMKIAKASTGKPGIARNSYHGKTLGALSITGRDKHRRAMVEVPFGDLAALREALN-REDVGALMIEPIQGEPPAGYLQAVQQLCRETGVLLMVDEVQTGLGRTGKACEWDGIEPDVLMLSKSLSGGLPIGATLCRADLWQKAYGHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQF-DQAFTGAVNASAREFATRLPGDWHTTWKFL-VQAHLRAAMDRMEQALGEMFCM............................................ 797
65 -50.4003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  18  33.....................NRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQAREHSYVGHGTEASITLAKMILDRAPKMSKVYFGLGGSDANETNVKLIWYYNEKKKIISRGYHGSGLVTGSLTGLELFHKKFDLPVEQ-VAELEALIERADTIAAFIGEPILGTPPAGYWEAIQTVLNKHDILLVADEVVTGFGRLGTGSDHYGLEPDIITIAKGLTSAYPLSGSIVSDKVWKVLEQGGWTYSAHPIGAAAGVANLKLLDELNLVSNAGEVGAYLNATMAEALSQHANVGDVRGEGLLCAVEFVKDRIGPQISAKLLEQDKIIARAMPQ--PFCLTRAEADQVVEGTLRAVKAV............................................... 456
66 -50.4003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  21  54....................LPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQTCFMVTPYEQYVAVAEQLNRITPGEKRTVLFNSGAEAVENSIKVARAHTRKQAVVAYAYHGRTNLTMALTAKSMPYKSGFELAAERAINLIDKQIGAANLAAVIIEPIAGEPADGFLPALQRWCRDNDVVFIADEVQTGFARTGAACDHENVEPDLIVTAKGIADGFPLSAVTGRAEIMDAPHTSGGTFGGNPVACAAALATIETIERDGMVERARQIERLVMDRLLRLQAADDRLGDVRGRGAMIAMELVKSALTQKLAAAAHAAGVIVLTCGRLLPPLTISDELLSEGLDILCQILAD................................................ 461
67 -50.4005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  25  26....................FPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANASILSASNAPAVALAERLTASFPGTHKVWFGHSGSDANEAAYRAITRATGRTGVIAGAYHGCTVGSMAFSGHSVQADAAKADGLILLALLKERLAAAGSIAAAFIEPIQSDPPDGFLRKFADICRAHGISVVCDEVKVGLARSGRCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFMQTLHGNPVCAAAGLAVLETIEAENLTTAAERKGKLLREGLARLAERHELIGDIRGRGLACGVELVRNAETAKLIYRAYELGLVLYYVGMN--PLTMTEDEVRHAVNLLDQAFTELSTV............................................ 429
68 -50.3003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  24  32....................FPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANATILSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGVIAGAYHGCTVGSMAFSGHSVQADAAKADGLILLTLLTEKLAAAGSIGAAFIEPIQSDPPDGFLRKFADICRAHGILVVCDEVKVGLARSGRCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAFMQTLHGNPISAAAGLAVLETIDRDDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCDAETAKLIYRAYQLGLVVYYVGMN--PLTITETDIHKALDLLDRAFSELSAV............................................ 435
69 -50.2005ghf_A mol:protein length:456 Aminotransferase class-III  ali model follow..  19  13...IRYHLHSYTDAVRLEAEGPLVIERGDGIYVEDVSGKRYIEAMSGLWSVGVGFSEPRLAEAAARQMKKHTFSYRSHGPVIDLAEKLVSMAPVMSKAYFTNSGSEANDTVVKLIWYRPERKKIISRGYHGVTIASASLTGLPNNHRSFDLPIDR-ADELEQLIIAPHTIAAFIGEPVMGAPPKTYWEKVQAVLKRYDILLIADEVICGFGRTGNGSQTFDMKPDILVMSKQLSSSYPISAFLINERVYAPIAEEGFTASGHPVAAAVALENLAIIEERDLVANARDRGTYMQKRLRE-LQDHPLVGEVRGVGLIAGVELVTDKLGAKANAVLQERGVISRAMGDTLAPLIINDQQVDTMVSALEATLNDVQAS............................................ 453
70 -49.5002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  21  14..........LATSTRDPELFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAAANNIPQLELAKKLVTYSPGQKKVFFSNSGTEAIEASIKVVKN-TGRKYIIAGGFHGRTFGSISLTASKAVQRSIVGPFMPGVDYIFVNLVPPEEVAGIFFEPIQGEPPKNFFAELQKLAKKYGILLVDDEVQMGLGRTGKAIENFNTVPDVITLAKALGGGMPIGATIFRKDLDFKPGMHSNTFGGNALACAIGSKVIDIVK--DLLPHVNEIGKIFAEELQGLADD------VRGIGLAWGLEYNEKKVRDRIIGESFKRGLLLLPAGRSAIRVI-SEEEAKQGLDILKKVIKVVK.............................................. 419
71 -49.4003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  19  34.....................TRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNHAYVGHGTEASITLAKMIIDRAPKMSRVYFGLSGSDANETNIKLIWYYNEKKKIISRGYHGSGVMTGSLTGLDLFHNAFDLPRAP-ADKLEEMILAPETIAAFIGEPILGTPPAGYWEKIQAVLKKYDVLLVADEVVTGFGRLGTGSDHYGIKPDLITIAKGLTSAYPLSGVIVADRVWQVLVQGGWTYSAHPICVAAGVANLELIDEMDLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVADKIGPQVATALAASGVIGRAMPQGDIPLCLTREQADIVVSKTADAVKSVFAN............................................ 459
72 -49.3005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  21  30.....................TLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDEQTFDGIAHPRVFDLAERLTGMFARMARVLFSSGGSDAVETALKMARQYPGRTRFLSNGYHGVHMGGTSVG-QLLAGCHLLDTPW--IRQLEEQIALAQTIAALIAEPVQGAPPADYWPRLREVCDRHGILLIADEVVTGFGRSGCGSRGWGVAPDILCLAKGITAGYPLGATLFNQRIADAIENGGYTYSGHPTACAAALAVLDIVEAEDLPGNAAKVGAQLLEQLQPLVERYAVVGEVRGKGLMIALDLVSDKQPSRIADEARRAGVLVRPIGNKIIPLTLTRDEAGLMVSALEAAFARC............................................... 451
73 -48.9003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  18  32.....................TTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQT-FPMSQSHEPAIKLAEKLNEWLGGEYVIFFSNSGSEANETAFKIARQYYHRYKFMSRGYHGNTMATMAATGQAQRRYQYEPFASG-VKEVDRVMTWSETIAAFIMEPIITGAPQDYMKAVHETCQKHGALLISDEVICGFGRTGKGFMNYDVKPDIITMAKGITSAYPLSATAVKREIYEAFKGKINTFGGNPAACALALKNLEIIENENLIERSAQMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGIELVNDDKIASVVNACKEKGLIIGRNGMT--PLVISSEEIAFVIGTLKTAMERI............................................... 452
74 -48.7002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  16  15TTPDRVHEVLGRSMLVDGLDIVLDLTRSGGSYLVDITGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNYSVAMARFVETFARVLGALPHLFFVEGGALAVENALKAAFDWKSRHLHLRGAFHGRSGYTLSLTNTKPTITARF-LEAEALRQARAAFETPHDIACFVAEPIQGEFRPEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAYQQLDVAPDIVAFGKKTQVCVMAGRRVDEVADNVFAVPSNSTWGGNLTDMVRARRILEVIEAEGLFERAVQHGKYLRARLDELAADFAVVLDPRGRGLMCAFSLPTTADRDELIRQLWQRAVIVLPAGADTVPLTVSTAEIDAAIAAVRSALPVVT.............................................. 449
75 -48.6005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  18  46.....................GRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQHTYVGHSNDPVIELSSRIIEDWAGMKKVFYGMSGSDANETQIKLVWYYNNKKKIIARSYHGSGIVTGSLTGLPSFHQHFDLPIDR-VEELEKLIARADTIAAFIAEPVMGTPPQGYWEAIQAVLRKHDILLIADEVVCGFGRLGSGSEHYGIKPDLITVAKGLTSAYPLSAVIVSEKVWDVIEKGGWTYSGHPVCAAAALANLDILERENLTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMADKVSQKVAAAALEDGLIVRALPHGDIPLVTTRAEVDEIVAIAKEAFDEVADA............................................ 471

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.