current user: public

If you have questions about the server, please let us know.

Query: 6cc4_A mol:protein length:614 soluble cytochrome b562, lipid II flippase MurJ chimera, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610
# Score Template Links and tools%idFirst MADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLKSLAAVSSMTMFSRVLGFARDAIVARIFGAGMATDAFFVAFKLPNLLRRIFAEGAFSQAFVPILAEYKSKQGEDATRVFVSYVSGLLTLALAVVTVAGMLAAPWVIMVTAPGFADTADKFALTSQLLKITFPYILLISLASLVGAILNTWNRFSIPAFAPTLLNISMIGFALFAAPYFNPPVLALAWAVTVGGVLQLVYQLPHLKKIGMLVLPRINFHDAGAMRVVKQMGPAILGVSVSQISLIINTIFASFLASGSVSWMYYADRLMEFPSGVLGVALGTILLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFDALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLILTQLMNLAFIGPLKHAGLSLSIGLAACLNASLLYWQLRKQKIFTPQPGWMAFLLRLVVAVLVMSGVLLGMLHIMPEWSLGTMPWRLLRLMAVVLAGIAAYFAALAVLGFKVKEFARRTVLast
1 -160.0006cc4_A mol:protein length:614 soluble cytochrome b562, lipid II flippase MurJ chimera  ali model  100  1MADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLKSLAAVSSMTMFSRVLGFARDAIVARIFGAGMATDAFFVAFKLPNLLRRIFAEGAFSQAFVPILAEYKSKQGEDATRVFVSYVSGLLTLALAVVTVAGMLAAPWVIMVTAPGFADTADKFALTSQLLKITFPYILLISLASLVGAILNTWNRFSIPAFAPTLLNISMIGFALFAAPYFNPPVLALAWAVTVGGVLQLVYQLPHLKKIGMLVLPRINFHDAGAMRVVKQMGPAILGVSVSQISLIINTIFASFLASGSVSWMYYADRLMEFPSGVLGVALGTILLPSLSKSFASGNHDEYNRLMDWGLRLCFLLALPSAVALGILSGPLTVSLFQYGKFTAFDALMTQRALIAYSVGLIGLIVVKVLAPGFYSRQDIKTPVKIAIVTLILTQLMNLAFIGPLKHAGLSLSIGLAACLNASLLYWQLRKQKIFTPQPGWMAFLLRLVVAVLVMSGVLLGMLHIMPEWSLGTMPWRLLRLMAVVLAGIAAYFAALAVLGFKVKEFARRTV 614
2 -109.0005t77_A mol:protein length:475 Putative lipid II flippase MurJ  ali model follow..  25  1.......................................................................................................MSILFSSILFSIATFFSRILGLFRDVLFAKYFGVSYELDAYFIAIMFPFFLRKVFGEGAMSSAFVPLYSEKSGEEKDK----FLSSVINGFSLIILALVILSYFFPELIINLFGAGS--SHETKILAKKLLLITSPSIYFIFLWAISYSILNTNNKFFWPALTPSISNITIIIGTFLSTKY---GIISPTIGFLIGSILMFFSIIKSIIKHKYYFT------IKHFPHFLKLFFPTFMTMVVSQINTVVDMNVVSFYDKGSISYLQYASRFYLLPYGLFAVSVSTVVLSKISN-----DRKNFNYHLNDALKTTLFFTIPSMVGLIFLSTPIIRFFYEHGAFTSKDTLITSKILIAYTLGLPFYGIYSTISRSYHAIKNTKTPFIAATIVSLSNIILDIIFGLKYGPIGVALATSIAGIIGVLYLLFSVKTF--------PIKDFLKISLNSLIMLFVIYLTDFTD----------NEFWFLIQILIGILVYLIFSSIFYRDLIRRFLYAR 473
3 -28.1004z3n_A mol:protein length:499 Putative drug/sodium antiporter  ali model follow..  12  8.....................................................................................PDNGTPNDELFTVAGMFDGSLYKLLLRMALPMFVGMLTQVT-DIFWLSHIDVTNSGIIAGVGLVFPVGMGLFAIANGIQIGMGSLLSRAIGMQRLDRAQRILSVGIIIALFFAIVITVLGYVYAQPLLRSLG----ATKSIIGYATEFYYYSLLTVFSIMLIGVMMGLFQGAGKIMVIMKASLLGALVNIMLDPIMIFVFDFGVKGVALASFLAQLSMVAYFIYTLMGLHIGLSIRIAFSWKIYREFLSVGMAQMLMQLIIAVGIVIYNFFIVRLDVNAMAAFTLTGRIDYFII-TPMLAIATALLTVVGQNWGHGNVTRTLNAYWAAVALAFSIVLVLAVMHIVLAPWMYPLF------VVAVSDYAVLQTRIMALALPFVAISLLASEYYQAIGKPWYSVLLTLMHVFISVPVVYLLAIVMRITGVYFGAMSGTFVAALLAWRLLRLS............................................................................... 457
4 -28.1004mlb_A mol:protein length:492 PF0708  ali model follow..  11  3.................................................................................GSEIPMSEKTTKGVQLLRGDPKKAIVRLSIPMMIGMSVQTLYNLA-DGIWVSGLGPESLA-AVGLFFPVFMGIIAL----GLGVGTSSAIARRIGARDKEGADNVAVHSLILSLILGVTITITMLPAIDSLFRSMG----AKGEAVELAIEYARVLLAGAFIIVFNNVGNGILRGEGDANRAMLAMVLGSGLNIVLDPIFIYTLGFGVVGAAYATLLSMVVTSLFIAYWLFVKRDTY--DFSPSREILKDILRVGLPSSLSQLSMSIMFFLNSVAITAGGENGVAVFTSAWRITMLGI-VPILGMATATTSVTGAAYGERNVEKLETAYLYAIKIAFMIELAVVAFIMLFAPQVAY-LFTYSESAQVIKGDLISALRTLPVFLVLTPFGMMTSAMFQGIGEGEKSLILTIFTLVMQVGFAYIFVHYLGLRGVWIGIVIGNMVAAIVGFLWGRMR............................................................................... 454
5 -25.9005c6o_A mol:protein length:464 BH2163 protein  ali model follow..  2........................................................................................EQKQQSERLGTEAIPKLLRSLSIPAMIGMFVMALYNVVDTIFISYAVGIEGVA-GVTIAFPIMMIMMSMLGIGGAS-----VISRRLGERRGEEANQVFGNILTVILVLSVIGFISAFTLLGPALQLFG----ATSVTQGYATDYLFPILLGSIFFFFAFAANNIIRSEGNATFAMVTMIVPAVLNILLDVLFIFGLNMGVLGASIATVIAQASVTGLVLRYFLTGKSTLSLHLRMKGSVIKEVCLVGLPAFVQQSSASLMIAINSMLLRFGSDFYVGVFGLVQRIMMFVMMPM-MGIMQAMQPIVGYNYGAKQYSRLRETVMLGFKVATIFSIGIFALLMLFPEALLRVF------DREVIQAGVSAMHILFCVTFLIGAQIVAGGLYQSLGKPKQALILSLSQIIFLIPLVLILPHIFGLSGVWWAFPIADVLSFILTVVLLYRD............................................................................... 441
6 -23.0004huk_A mol:protein length:459 Multidrug efflux protein  ali model follow..  10  11....................................................................................................KEIRLLTALALPMLLAQVAQVGIGFV-DTVMAGGAGKEDLA-AVALGSSAFATVYITFM--GIMAALNPMIAQLYGAGKTGEAGETGRQGIWFGLILGIFGMILMWAAITPFRNW----LTLSDYVEGTMAQYMLFTSLAMPAAMVHRALHAYASSLNRPRLIMLVSFAAFVLNVPLNYIFVGMPALGGAGCGVATMAVFWFSALALWIYIAKEKFFRPFGL----AVFKQIWKIGAPIGLSYFLEASAFSFIVFLIAPFGEDYVAAQQVGISLSGILY-MIPQSVGSAGTVRIGFSLGRREFSRARYISGVSLVSGWVLAVITVLSLVLFRSPLASMYND----DPAVLSIASTVLLFAGLFQPADFTQCIASYALRGYKVTKVPMFIHAAAFGCGLLPGYLLA--MGIYGFWTALIASLTIAAVALVWCLEKY............................................................................... 444
7 -19.3003mkt_A mol:protein length:460 Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux pump  ali model follow..  11  1............................................................................................ENSVHRYKKEASNLIKLATPVLIASVAQTGMGFV-DTIMAGGVSAIDMA-AVSIAASI-WLPSILFGVG-LLMALVPVVAQLNGAGRQHKIPFEVHQGLILALLVSVPIIAV-LFQTQFIIRFMD----VEEAMATKTVGYMHAVIFAVPAYLLFQALRSFTDGMSLTKPAMVIGFIGLLLNIPLNWIFVGAPELGGVGCGVATAIVYWIMLLLLLFYIVTSKRLAHVKV----KELIRLFRLGFPVAAALFFEVTLFAVVALLVAPLGSTVVAAHQVALNFSSLVF-MFPMSIGAAVSIRVGHKLGEQDTKGAAIAANVGLMTGLATACITALLTVLFREQIALLYTE----NQVVVALAMQLLLFAAIYQCMDAVQVVAAGSLRGYKDMTAIFHRTFISYVLGLPTGYILG-PLGAKGFWLGFIIGLSAAALMLGQRLYW................................................................................ 445
8 -16.1001yzc_A mol:protein length:106 edesigned apo-cytochrome b562  ali model follow..  90  1.ADLEDNDETGNDNGKGGEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTGRAGNQKG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
9 -16.0005unf_A mol:protein length:411 Chimera protein of Type-2 angiotensin II receptor and Soluble cytochrome b562  ali model follow..  34  1.ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSGDAIPILYYIIFVIGFLVNIVVVTLF-PKKVSSIYIFNLAVADLLLLAT---------LPLWATYYSYRYDWLFGPVMCKVFGSFLTLFASIFFITCMSVDRYQSVIYP-FLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYG---------NRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVPFLYCFVGNRFQQKLRSVFR........................................................................................................................................................................................................... 410
10 -16.0003hnj_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  81  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWLLIGAIHDALHLANEGKVKEAQKAAELLKAICNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
11 -16.0003m4b_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  85  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
12 -16.0004je9_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  85  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANCGKVKEAQAAAEQLKCTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
13 -16.0004u9d_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  84  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
14 -15.9006c1q_B mol:protein length:422 Soluble cytochrome b562, C5a anaphylatoxin chemotactic receptor 1 chimera  ali model follow..  33  9DADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSNTILALVIFAVVFLVGVLGNALVVWVT-KRTINAIWFLNLAVADFLSCLA---------LPILFTSIVQHHHWPFGGAACSILPSLILLYASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLPPKVLCGVDYSHDKRRERAVAIVRLVLGFL-----------WPLLTLTICYTFILLRT--------------SRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMS-FLEPSSPTFLLLKKLDSLCVSF--AYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVL.................................................................................................................................................................................................... 409
15 -15.8005yo6_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  98  1.ADLEDNWECLNDNLKVIEKADNAAQVKDALTKMRACALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 106
16 -15.8004u9e_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  82  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPGMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQAY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
17 -15.8004jeb_A mol:protein length:106 soluble cytochrome b562  ali model follow..  84  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMADFRHGFWILIGQIHAALHLANCGKVKEAQAAAEQLKCTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
18 -15.8003nmi_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  92  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFAILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
19 -15.7006dhy_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  86  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAACDAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
20 -15.7005xzi_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  82  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKDAQEAAEHLKCTCNHCHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
21 -15.6003foo_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  91  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMCDFAAGFHILVGQIDDALHLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
22 -15.6003hni_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  87  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
23 -15.6005yo4_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  98  1.ADLEDNWETLNDNLKVIEKADNAAQVCDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLCNEGKVKEAQAAAEQLKTTRNAYIQKYL........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 106
24 -15.6005bu7_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  83  1.ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMHDFRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKCTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
25 -15.5001yza_A mol:protein length:106 Redesigned apo-cytochrome b562  ali model follow..  92  1.ADLEDNDETGNDNGKGGEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTIRAYNQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
26 -15.4003tol_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  84  1.ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMRDFRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
27 -15.2001lm3_B mol:protein length:106 SOLUBLE CYTOCHROME B562  ali model follow..  96  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDIRHGYDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYL........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 106
28 -15.2003c62_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  91  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFDHGFDILVGQIHAALHLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
29 -15.2005y50_A mol:protein length:461 Protein DETOXIFICATION 14  ali model follow..  11..........................................................................................................TKKLSYIAGAMIAVNSSMYVLQVISIMMVGGELFLSSTAIAVSFCSVTGFSVVFG-LASALETLCGQANGAKQYEKLGVHTYTGIVSLFLVCIPLSLL--TYIGDILSLIG----QDAMVAQEAGKFATWLIPALFGYATLQPLVRFFQAQSLILPLVMSSVSSLCIHIVLCWSLVFKFGLGSLGAAIAIGVSYWLNVTVLGLYMTFSSSCSKSRATISMSLFEEFFRFGIPSASMICLEWWSFEFLVLLSGILPNPKLEALSTQSSLYQIPESL-----GAAASTRVANELGAGNPKQARMAVYTAMVITGVESIMVGAIVFGARNVFGYLFSS----ETEVVDYVKSMAPLLSLSVIFDALHAALSGVARGSGRQDIGAYVNLAAFGIPTAILLAFGFKMRGRGLWIGITVGSCVQAVLLGLIVIL................................................................................ 437
30 -15.1001yyj_A mol:protein length:106 redesigned apocytochrome B562  ali model follow..  97  1.ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTIRAYNQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
31 -15.1002qla_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  93  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
32 -15.1002bc5_A mol:protein length:106 Soluble cytochrome b562  ali model follow..  95  1.ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMWDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTCNACHQKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 105
33 -14.6005yo3_A mol:protein length:107 Soluble cytochrome b562  ali model follow..  98  2.ADLEDNWETLNDNLKCIEKADNAAQVKDCLTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 107
34 -14.6005yo5_A mol:protein length:107 Soluble cytochrome b562  ali model follow..  98  2.ADLEDNWETLNDNLKVIEKCDNAACVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYL........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 107
35 -14.6005yck_A mol:protein length:471 multi drug efflux transporter  ali model follow..  13..........................................................................................................LKRVTRLAAPMATVTIAQYLLPVISVMVAGGELQLSGVALATSFTNVTGFSIMYG-LVGALETLCGQAYGAKQYEKIGTYTYSAIASNIPICFIISII--FYIENILISLG----QDPDISRIAGSYAFWLIPVLFAQAIVIPLTRFLLTQGLVLPLLYTAVTTLLFHVFVCWVFVLVFVLGSNGPAMATSVSFWFYAVILSCYVRFSSSCEKTRGFVSEDFVSQFFQYGVPSAAMICLEWWLFELLILCSGLLSNPKLETLTTETLHYVISSGV-----AAAVSTRVSNNLGAGNPQVARVSVLAGLCLWLVESAFFSILLFTFRNIIGYAFSN----SKEVVDYVADLSPLLCLSFILDGFTAVLNGVARGSGWQHIGAWNNIFSVGAPVGVYLAFRHDLNGKGLWCGVVIGSTVQATVLAIVTAS................................................................................ 439
36 -14.1005n2s_A mol:protein length:436 Soluble cytochrome b562,Adenosine receptor A1  ali model follow..  33  2SADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLASSAAYIGIEVLIALVSVPGNVLVIWAV-LRDATFCFIVSLAVADVLVGALV--------IPLAILINIGPQTYFHTCLMVACPVLILAQSSILALLA-IAVDRYLRVKIP-------KMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAAAGSMGEPVIKCEFEKVISMEYMVY-FNFFVWVLPPLLLMVLIYLEVFALIRKQLNKKVSA-LKIAKSAALIAFLFALSWLPLHILNCITLFCPSCHKPSILTY-------IAIFLAHGNSAMNPIVYAFRIQKFRVTFLKIW............................................................................................................................................................................................................ 410
37 -12.7006cmo_R mol:protein length:463 chimera protein of Soluble cytochrome b562 and Rhodopsin  ali model follow..  31  24TADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLMCGSMLAAYMFLLIVLGFPINFLTLYVT-LRTPLNYILLNLAVADLFMVLGG-GPTGCNLQGFFA---------------------TLGGEIALWSLVVLAIERYVVVCKP--ENHAIMGVAFTWVMALACAAPPLAGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVH-------FTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAE----KEVTRMVIIYVIAFLICWVPYASVAFYIFTHQGSCFGPIFMT-------IPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTI............................................................................................................................................................................................................ 451
38 -12.5004yay_A mol:protein length:414 Soluble cytochrome b562,Type-1 angiotensin II receptor  ali model follow..  34  1.ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLILNVMIPTLYSIIFVVGIFGNSLVVIVI-LKTVASVFLLNLALADLCFLLT---------LPLWAVYTAMEYRWPFGNYLCKIASASVSFYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFIGLGLTKNILGFL-----------FPFLIILTSYTLIWKALKKAYEIQ---------NKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLK........................................................................................................................................................................................................... 413
39 -12.0004n6h_A mol:protein length:414 Soluble cytochrome b562, Delta-type opioid receptor chimeric protein  ali model follow..  35  5MADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSPIAITALYSAVCAVGLLGNVLVMFGI-MKTATNIYIFNLALADALATS----------LPFQSAKYLMETWPFGELLCKAVLSIDYYMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPRDGAVVSWYWDTVTKICVFLFAFV-----------VPILIITVCYGLMLLRLRSVRLLS-----GSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRC..................................................................................................................................................................................................................... 404
40 -11.8006b73_A mol:protein length:418 Soluble cytochrome b562, kappa-type opioid receptor  ali model follow..  34  5MADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGSIVIITAVYSVVFVVGLVGNSLVMFVI-MKTATNIYIFNLALADALVTT----------MPFQSTVYLMNSWPFGDVLCKIVLSIDYYMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVLIIIVCYTLMILRLKSVRLLS-----GSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALGSTSHSTAALSSYYFCIA-LGYTNSSLNPILYAFLDENFKRC..................................................................................................................................................................................................................... 400
41 -11.7004er9_A mol:protein length:131 Soluble cytochrome b562  ali model follow..  82  26.ADLEDNMDILNDNLKVVEKTDSAPELKAALTKMRAAALDAQKATPPKLEDKAPDSPEMKDFRHGFDILVGQIDGALKLANEGNVKEAKAAAEALKTTRNTYHKKY............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 130
42 -10.9004xxb_B mol:protein length:148 E3 ubiquitin-protein ligase Mdm2  ali model follow..  10  4.EDPEDYWKCTS-NPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVPDCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 119
43 -10.7004jkv_A mol:protein length:475 Soluble cytochrome b562, Smoothened homolog  ali model follow..  29  3TADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLSGQCEVPLVRTDNPKSWY-----------------------------------EDVEGCGIQCQNPLFTEAEHQDMHSYIA-AFGAVTGLCTLFTLATFV-------ADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYAL--MAGVVWFVVLTYAWHTSFKALGTTYQPLS-------GKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYRAGFVLAPIGLVLIVGGYFLIRGVMTL-NHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSC--------FYDFFNQAEWERSFRDYVLCQANVTIGLPTKQ--------PIPDCEIKNRPSLLVEKINLFAMFGT-------GIAMSTWV............................................................................................... 456
44 -10.5004ea3_A mol:protein length:434 Fusion protein of Nociceptin receptor and cytochrome b562  ali model follow..  33  11.ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLGAFVTIVGLYLAVCVGGLLGNCLVMYVI-MKTATNIYIFNLALADTLVLL----------LPFQGTDILLGFWPFGNALCKTVIAIDYYMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVE-PVFAICIFLFSFI-----------VPVLVISVCYSLMIRRLRGVRLLS-----GSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAILRFCTA-LGYVNSCLNPILYAFLDENFKAC..................................................................................................................................................................................................................... 403

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.