|
current user: public |
|
Query: 5lzs_l mol:protein length:51 Uncharacterized protein, from PDB1018 |
. 10 . 20 . 30 . 40 . 50 | |||||||
# | Score | Template | Links and tools | %id | First | MSSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL | Last |
1 | -33.200 | PF00832.20; E5S598_TRISP/142-183; Ribosomal L39 protein | ali follow.. | 69 | 1 | ........IKRKLAKAQRVNKPVPQWFRLRTGNRIRYNVKRRHWRRTKLK. | 42 |
2 | -6.780 | PF14117.6; D0J295_COMT2/9-67; Domain of unknown function (DUF4287 topsan) | ali follow.. | 8 | 10 | ...............EKAYGKPVTHWLKILDELRDKKHMEQVAHLKLEHGI | 45 |
3 | -6.720 | PF00424.18; REV_HV2BE/1-91; REV protein (anti-repression trans-activator protein) | ali follow.. | 28 | 5 | .ADEEGLQGKLRLLRLLHQTNPYPQ-----PGTASQRRNRRRRRRRQWLRL | 50 |
4 | -6.580 | PF16322.5; G3WUT0_SARHA/29-239; Tubby N-terminal | ali follow.. | 23 | 1 | .......RQRALLEQKQKKKRQEPLMVQSNPDSRARTRRTRQSEEQAPL.. | 42 |
5 | -6.110 | PF04428.14; A7F968_SCLS1/226-304; Choline kinase N terminus | ali follow.. | 21 | 38 | ............LSNSKRAEKERKAWIQFKNE-RLAHTLRLKGWRRVPLD. | 76 |
6 | -5.640 | PF16881.5; LIPA_SCHJY/7-112; N-terminal domain of lipoyl synthase of Radical_SAM family | ali follow.. | 14 | 58 | .........ENVVLPNGSVHKRLPSWLKTKVPLGTNFNKIKNDLRGLNLH. | 98 |
7 | -5.610 | PF14475.6; C4R4U2_KOMPG/35-74; Sec1-binding region of Mso1 | ali follow.. | 19 | 15 | .KETDTLVHKALVNYYITRDLPFPDWL........................ | 40 |
8 | -5.420 | PF14715.6; Q21X44_RHOFT/40-88; N-terminal domain of cytochrome oxidase-cbb3, FixP | ali follow.. | 21 | 14 | ................REMNNPLPRWWAWLFVITIVFSF............ | 36 |
9 | -5.370 | PF06621.12; W5K1F0_ASTMX/351-643; Single-minded protein C-terminus | ali follow.. | 15 | 9 | ..SRKGNKSRTSRTKPKTRLSPYSHYPGFHTE-RSESDQDSSPWGGSPL.. | 54 |
10 | -5.190 | PF06910.11; G3PF21_GASAC/45-162; Male enhanced antigen 1 (MEA1) | ali follow.. | 14 | 70 | MDADHVELVKRTMAAIALPSLAVPSWANEISDDQWKDMVQNT......... | 111 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26; |