current user: public

If you have questions about the server, please let us know.

Query: 1wva_A mol:protein length:322 Arginase 1, from PDB1018

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLast
1 -96.400d2aeba_ c.42.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  100  1....SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYL.... 314
2 -86.300d2ef5a_ c.42.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  37  1.....ERVAVVGVPMDLGANRRGVDMGPSALRYARLLEQLEDLGYTVEDLGDVPVSLARASRRRGRGLAYLEEIRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAAR-GRRVGVVWVDAHADFNTPETSPSGNVHGMPLAVLSGLGHPRLTEV------FRAVDPKDVVLVGVRSLDPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHL---QGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILAESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRI.................. 289
3 -72.600d3nioa_ c.42.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}  ali model 3D-neighbors follow..  24  31.ELDALDAAFVGVPLDIGSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDSLNVADIG-----DVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFG-EKIAHGTTFRRAVEED---------------LLDCDRVVQIGLRAQTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKV---GGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGL-DLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVRR............. 316
4 -72.200d1gq6a_ c.42.1.1 (A:) Proclavaminate amidino hydrolase {Streptomyces clavuligerus [TaxId: 1901]}  ali model 3D-neighbors follow..  25  18.QPRGYDVVVIGAPYDGGSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAG-----DINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYG-GRYHHGTPFRHGIDEK---------------LIDPAAMVQIGIRGHKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKV---GQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDL-KPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH............... 301
5 -71.800d3lhla_ c.42.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}  ali model 3D-neighbors follow..  21  1.NYEESNLIVFGVGFDGTSNRPGARFASSSMRKEFYGLETYSPFL------DLDLEDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNN-SKNSHATVIKRIWD-----------------IVGDNKIFQFGIRSGTKEEFKFATEEKHTYMEIGGID------TFENIVNML---NGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIIKNSNNIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIK.............. 276
6 -69.300d1woha1 c.42.1.1 (A:3-304) Agmatinase {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  23  22DGDWQADVAALGVPFDIAGFRPGARFAPRALREASLRSVPPFTGLD----GKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFAD-VPDLHVVQLDAHLDFTDTRND-TKWSNSSPFRRACEAL----------------PNLVHITTVGLRGLDPEAVAAARARGHTIIPMDDVTADLAGVLAQLP-------RGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDH................ 301
7 -68.100d3pzla_ c.42.1.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 273116]}  ali model 3D-neighbors follow..  23  19.GYEEAKYVVFGIPFDNTSYRRGSKYAPDSIRGAYVNLESYEYSYGI-DLLASGMADLGDMEESE------DVEYVIDTVESVVSAVMSDGKIPIMLGGEHSITVGAVRAL---PKDVDLVIVDAHSDFRSSYMG-NKYNHACVTRRALD-----------------LLGEGRITSIGIRSVSREEFEDPDFRKVSFISSFDVKKNGIDKYIEEVDR-----KSRRVYISVDMDGIDPAYAPAVGTPEPFGLADTDVRRLIERLSY--KAVGFDIVEFSPLYD-NGNTSMLAAKLLQVFIASREKYYK.............. 290
8 -66.000d4myla_ c.42.1.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}  ali model 3D-neighbors follow..  23  13.REEDADIVIIGFPYDEGGGRAGAKKGPAAFRFFLQRLGSVNNLELNVDASHLKLYDAGDIT-------ASTLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAFGDVGVINVDSHLDVRPPLSD-GRVHSGTPFRQLLEES---------------SFSGKRFVEFACQGSGALHAQYVRDHQGHLMWLSEVRKKGAVAALEDAFGLTG----KNTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAGKTPTVMMMDMSELNPLVE-EYRSPRVAVYMFYHFVLGFATR................ 296
9 -59.200d1xfka_ c.42.1.1 (A:) Formimidoylglutamase HutG {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  17  29LANQEPGVALIGFECDAGVGRTGAKHAPSLIKQALANLAWHH-PIPIYDLGNIRCEG-------------DELEQAQQECAQVIQQALPHA-RAIVLGGGHEIAWATFQGLAQHFPRIGIINFDAHFDLRTFESELAPVSSGTPFNQIHHFCQQQ--------------WDFHYACLGVSRATPALFERADKLGVWYVEDKAFSPLSLKDHLTQLQHFI--DDCDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHKNKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQ.............. 322
10 -6.160d4zura_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}  ali model 3D-neighbors follow..  11  126......................................................................EAALSSMASAIDGADLIAAGHKAAFSL-GHHAAAVAAQRLLDKGAKKIAILDVDFH--------------HGNGTQDIF-------------------YERGDVFFASLHGDPAEAF---AGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDT-------FEQDPISFFKLTSPDYITMGRTIAASGVPLLVVME-------GGYGVPEIGLNVANVLKGVAG................. 341

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.