Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: 5lzs_l mol:protein length:51 Uncharacterized protein, from PDB1018

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst MSSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGLLast
1 -38.200d1vq821 a.137.1.1 (2:1-49) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}  ali model 3D-neighbors follow..  39  1..GKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTD. 48
2 -5.880d2nqra1 b.85.6.1 (A:327-410) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  1......................LPARQRVRTASRLKKTPGRLDFQRGVL.. 27
3 -5.610d3t3la_ d.82.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  52.........GTYVINKQTPNKAI--WLSSPSSGPKRYDWTGKNWVYSH... 88
4 -5.280d4wiqa1 b.1.6.2 (A:58-163) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  8  23IPTDLIASSGEIIKVSAAGKEALPSWLHWDPHSHI................ 57
5 -5.150d4ec2a_ d.82.2.1 (A:) C-terminal domain of frataxin {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  57.........GTYVINKQPPNKQI--WLASPLSGPNRFDLLNGEWVSLR... 93
6 -4.530d2nsfa1 a.213.1.4 (A:1-160) Micothiol-dependent maleylpyruvate isomerase {Corynebacterium glutamicum [TaxId: 1718]}  ali model 3D-neighbors follow..  12  1MTTFHDLPLEERLTLARLGTSHYSRQLSLVDNAEFGEHSLLEGWTRSHL.. 49
7 -4.410d2fbwc_ f.21.2.2 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  21  1.ATTAKEEMARFWEKNTKSSRPLPHISIYKWSLPMAMSITHR......... 42
8 -4.250d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  9  40...HTDLGKGFLYAINARTKRRVGEDYELQFNDIVK............... 72
9 -4.030d1yrka1 b.7.1.1 (A:1-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  82..SEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQ........... 119
10 -3.710d1ecwa_ a.61.1.1 (A:) SIV matrix antigen {Simian immunodeficiency virus [TaxId: 11723]}  ali model 3D-neighbors follow..  29  14..........................IRLRPGGKKKYMLKHVVWAANELD. 37
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;