Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: 5lzs_l mol:protein length:51 Uncharacterized protein, from PDB1018

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
# Score Template Links and tools%idFirst MSSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGLLast
1 -38.900[J] COG2167 Ribosomal protein L39E  ali follow..  48  1MARNKPLAKKLRLAKAMKQNRRVPVWVIVKTNRRVLTHPKRRHWRRTKLK. 50
2 -32.200[J] KOG0002 60s ribosomal protein L39  ali follow..  73  148FIALGTFRIKRFLDKKQKQNRPIPQWIWMKTGNKIRYNSK-RTLEKNQAG. 196
3 -4.240[S] COG3235 Predicted membrane protein  ali follow..  38  206.......................PHWINTFDDNRY-LKSDRGIWR...... 226
4 -3.890[OU] COG4960 Flp pilus assembly protein, protease CpaA  ali follow..  13  120SRSQEIMAFGIPIPDSLMVAQKIPYGIGIAIAGLLTY.............. 156
5 -3.810[C] COG4117 Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)  ali follow..  14  34LVIHALLRRMLAPKTAGGEEHRDYLY---------SLAIRRWHW....... 68
6 -3.770[S] COG3059 Predicted membrane protein  ali follow..  13  30IGLLKFVPYEADSITPFVANSPLMSFFKQYLTHEGEYKPEARAWQS..... 82
7 -3.540[G] KOG0449 Succinate dehydrogenase, cytochrome b subunit  ali follow..  21  53KSDLWSSNKEEELLVSQRKKRPIPHLTVYEPEMSWYLSSLHR......... 95
8 -3.520[R] KOG1891 Proline binding protein WW45  ali follow..  24  13.............TNHGSEDLPLPPWSVDWTMR-IDHNTNTTHWSH..... 50
9 -3.280[L] COG2946 Putative phage replication protein RstA  ali follow..  17  200VGRKKNSRFVRVYEKGRQLGDKESKWVRFE----IQFNYGDIE........ 238
10 -3.250[U] KOG2376 Signal recognition particle, subunit Srp72  ali follow..  12  555.KEKVKRKRKPKYPKGFDLENS-PEWLPRRERSSYRPKRKDKRAAQIR... 606

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9.