current user: public

If you have questions about the server, please let us know.

Query: 1wva_A mol:protein length:322 Arginase 1, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# E-value Template Links and tools%idFirst MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLast
1 0.000e+00UniRef50_UPI0004AF33E4 agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=UPI0004AF33E4  ali  25  18.SAEGLDVAFVGVPLDGTSNRPGARFGPRAIRAESPLLRPCNLGT-----GDSPFKRLRVADLGDVAVNPYNLQDSVMRIERYYEALLAHGCIPVTLGGDHTIALPILRAMARRHGPVALVHVDAHADVNDEMFGE-KIAHGTPFRRAVEEG---------------LLTCDKVFQIGLRGYTPDEFDWGASMGFHVIPAAQCWSRPMDDVVARIRAQV---GDHPLYISFDIDGLDPAYAPGTGTPEIAGLSSVQALQLIRGCAGM-NIVGADVVEVSPPFDCGGMTALTAANLAFELLCAV................... 297
2 0.000e+00UniRef50_A0A2H5Z7S5 Guanidinobutyrase n=5 Tax=Bacteria TaxID=2 RepID=A0A2H5Z7S5_9BACT  ali  23  41.SLDRVDVAIVGIPFDTGTYRPGARFGPAAVREHSSRIEQYHPVLGVDVLAELSVIDYG-----DLPVVAGYTERSFQLIEEGIGSLVESGVIPIGIGGDHSISLPELRAVARRYGPVALVHFDSHVDTWDTIW-ETKYNHGTPFRRAVEEG---------------LVDPGRSIQIGIRGGGQDELDQSRELGFEVWTAREVRRAGLARMCEAIHRRV---GASPVFLSFDIDFLDPVFAPGTGTPEVGGFATWEAQELLWGLVGLD-IVAADLVEVLPDRDPADVTALNAANLIFDMVAVIAATRRERGNGAAD...... 333
3 0.000e+00UniRef50_A0A0F2SC64 Arginase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A0F2SC64_9FIRM  ali  33  1................MGANRRGVDMGPSAIRYGGLKKAITNLNIGYKDIGDVPIPESYDDFVDESFKNEEEIGYVNKSLASLVRKSLLEGNLPIILGGDHSIAVGSILGTQSVLENIGVLWIDAHGDFNTRETTLSGNLHGMSLAASAGFGALEMTGFK--PKDVNYVNPKKVVLIGARDIDNEEAILIKESGITVFTMSDIDEYGMKEVMVRALEIVAAD-TEGFHVSFDLDVMNPNEAPGVGTPVNGGLTFREAHLAAEMISNSKKLRSLEVVELNPILDHMNQTGKLAVSL----ICSMIGKRILG............ 289
4 0.000e+00UniRef50_A9UZH7 Arginase (Fragment) n=2 Tax=Salpingoecidae TaxID=81529 RepID=A9UZH7_MONBE  ali  44  163...EPKTCAIVGAPFTYGQPRYGVDNGPEALRDAGLMEALLRLGWRAYEHGDITFESPPRYEGPGSCKHPYVVGEANRQIAEVCEEHAREGRFVLTLGGDHSIGVGTIAGQLLVRPETGVIWVDAHADINTPALSGSGNMHGMPLAFLSRLVAPEEVPGFDWLKRVPALDPSQLVYIGLRDVDKPERDIIRQHNIKAFTMSHVDKFGIGKVMEMALDHL---GERPLHLSYDIDACDPAIAPSTGTAVRGGLTYREAHYVAEAANETHRLASMDLVEVNPTF........................................ 443
5 0.000e+00UniRef50_UPI000CDE9C66 arginase n=1 Tax=Helcococcus massiliensis TaxID=2040290 RepID=UPI000CDE9C66  ali  33  5......NISILGIPMDLGASTIGTRLGPDSIRMTGVLDDLIDLGLNVTDLGNVDIDNYKKEKNVDNMTNLDRLLPSLAKINEQAYDLFDRDSFPLILGGDHSLVLATFKAFLKKHDNPGLIYIDAHADINTEKTSTSGNVHGMPIAALLNLCDDRLNKIGGDY----YLKPENIVYIAIRDIDEGEEKIIEDLNIKYFSMAEIYEKGIKKVLEETFEYLKD--VDNIYTSYDIDSIDMDIAPGTGVPVRGGLDYNMARDIMSRLGKNDKIKGLELVEVSPSLDIGNKTSL----IAKELLLGFFGKK............... 296
6 0.000e+00UniRef50_A0A257WCW3 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A257WCW3_9BACT  ali  24  19.SPTGADVAILGIPYDSTSNRSGTRFGPRAIREQSLLLWGYNNAQQVAPFKELKLVDLGDADVIPV-----DILATHRAIESAAKRVIDQPATLITLGGDHSISLPLLRAHHAKYGPLAVVHFDAHPDTWDSEYPGHKYSHGTPFVRALEEG---------------LIDRDAYVQIGIRGPTGGPQDYLDALNLRMITVDEFRMRDVADILAELQGRI---GSRSTYVSLDIDCVDPAFAPGTGTPEVGGLTSYEILQLVRGL-KSLNCVGFDLVEVSPPYDHAGITAILAANLAFEFLSLVALQHRR............. 305
7 0.000e+00UniRef50_A0A183L8S4 Arginase n=9 Tax=Digenea TaxID=256429 RepID=A0A183L8S4_9TREM  ali  44  35.........FLGIPTNRGQPKIGTYQGPELIRKSNFFQLVAEDGIQLIDCGDVTPVELSETEDPQGMKWSRSFSLTTLKIAERVEELMKQKSTPLVIGGDHSMATGTILGHAKAKPDLCVLWIDAHGDINTPLNSTSGNIHGMPLSFLVKELQDQIPWLDDFEGIKPCLNASNIAYIGLRDLDAYETHDIRKHGIAYFTMLDVDRMGIEAVIKEALQAVNPRLEKAIHLSFDIDALDPLIAPSTGTAVPGGLTLREGLRICEEVSATGKLSIVELAELNPLLGSKE-DVLKTQSSAVQILRACLGHCRSGHLP......... 351
8 0.000e+00UniRef50_U1GRI1 Arginase n=3 Tax=Spirochaetes TaxID=203691 RepID=U1GRI1_TRESO  ali  32  2......NIHIIEMPLDFGASRHGSDMGPSAIRLAGLRAKLESLGHTLVKYSPMRIHPQEYEEVGPKAKYLKPIAAACGQLAKETDDSFAAEEFPLTLGGDHSIVLGTLAGAARKGQRLGVLYVDAHGDFNTPETTLSGNIHGECLAASCGLG---LPELTNLYFDGRKVDPRNVCFVGIRDLDPGEKELMRKSGVTVFTMSDIERQGFPSVVKQVVLFFKTHADV-VHVSFDMDVLDPMFAPGTGIPLPAGMTNREALLLMEEMSDTGIVKSADIVEVNPILDVRNQTAVLAVSLAARLLG..................... 298
9 0.000e+00UniRef50_P00812 Arginase n=71 Tax=Eukaryota TaxID=2759 RepID=ARGI_YEAST  ali  41  10..YKNRELSIVLAPFSGGQGKLGVEKGPKYMLKHGLQTSIEDLGWSTELEPSMDEAQFKDSTTGGKAKRADLVGEATKLVYNSVSKVVQANRFPLTLGGDHSIAIGTVSAVLDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLMGLNKDVPHCPESLKWVPGNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVIEMAMKAVHPNGEGPIMCSYDVDGVDPLYIPATGTPVRGGLTLREGLFLVERLAESGNLIALDVVECNPDLAIHDIHVSNTISAGCAIARCALGET............... 331
10 0.000e+00UniRef50_A0A1Q7VGI4 Arginase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7VGI4_9ACTN  ali  35  5..TDGRPVALIGASLDLGAGRRGVDMGPSAIRYAGLAPRIERLGRPVFDWGNVEGAVPEATEMGERVRFLTPIKQACERVAHLVARSVEEGLHPLVLGGDHSVAIGTLGGLSRAHGPGGVLWIDAHGDVNRPETSPTGNVHGMPLAVALGL---AGPEFESEAWTLPAVTPERVALVGVRSLDSAEASLLSELDVAVYTMSDVDRLGLERVIRQSLSHIGGSGF--VHVSLDMDALEPDIAPGVGTPVRGGLSYREAHLAMELVAESGLAGSLEVVEVNPILDSENET----AKLAVELVASALGAR............... 301
11 0.000e+00UniRef50_A0A0G4H848 Arginase n=2 Tax=Chromerida TaxID=877183 RepID=A0A0G4H848_VITBC  ali  40  48....DKTVAYIGAPFNDGQELKGVDEGPKALRDAGLRAYTMKMGFAFEDWGDINPHAPGDSDYYTNVKNSREVGRACKKIHDATQHAAAEKKFVLTIGGDHSIAAGSIAGLLTERPDLAIIWVDAHGDCNTPETTPSGNYHGMPAAHLLGWFKKLVPGFEWMQKV-PTLPENRIAFVGLRDLDPAEKDMMMHSGVHCFTMQDVDRYGISKVMDMALSKIDPEGRRPLHLSLDVDACDPAVAPGTGTKARGGLTYREVHYICEAMAETSRLTSMDLVEINPLIDTPSEDGTQTVRLGVELIASALGKT............... 390
12 0.000e+00UniRef50_S0AEU1 Guanidinobutyrase Gbh n=530 Tax=root TaxID=1 RepID=S0AEU1_SERPL  ali  27  35........AFVGIPLDGTSNRSGTRYGPRQIRQESVMLRPYNMGTGAAPFERLQVADLG-----DIAINPYSLEDSVRRIELAYNGILSHGCVPLTLGGDHTLTLPILRAVARHHGPVGLIHVDAHSDTNEEMFGE-KLAHGTTFRRAYEEG---------------LLEPQRVVQIGLRGYAADDFDWSRRQGFRVVPAEACWYRSLAPLMAEVRQQM---GGAPVYLSFDIDGLDPAFAPGTGTPEVGGLSVWQGLEIVRGCRGL-NLIGADVVEVSPAYDRSGNTALLAANLLFEMLC..................... 305
13 0.000e+00UniRef50_B7G627 Arginase n=3 Tax=Eukaryota TaxID=2759 RepID=B7G627_PHATC  ali  42  3................YGQPFVGTDSGPELLRQAGLRKMLSALGWRVEDVPDLEFEALKSGTFEGNAKNHKLVGAGCEMLANAVEKTLKQKRFPLILGGDHSIGMGSLAGILRAQPETGVIWIDAHADLNTPALSESGNMHGMPVGMLMEGVAPDHRQIPGLEWDGPRLSPDSIVYVGLRDVDPAERRLIQSLDIAAYTMHEIDRYGIGQVMEMALDHLCAKNNRPLHLSYDIDAVDPVLAPATGTTVRGGLTFREAHYVAEAVAYTGNLASAEIVELNPSL-SCGEGAEATVELGLQLITSFMGKS............... 299
14 0.000e+00UniRef50_A0A1H0AFP5 Arginase n=2 Tax=Dendrosporobacter quercicolus TaxID=146817 RepID=A0A1H0AFP5_9FIRM  ali  34  1..............MWLGQACYGANLAPAALRAAGLQKRLTAFNQDIIDLGDIPIAVAGQCEAGEQVKNLQPIIAASNEIARCVDRIVASDRFPLVLGGDHSIAIGTLAGLIGHYDNLGIIWYDAHADINTPATTPSGNIHGMPLAVAMGSGHAELLSIGGAGVR---IKPENIVYIGVRDIDPGEAAFIDEQQIKLYTAEDVGRWGMPAIIEQTLAHLAA--CDGIHLSFDIDGIDPLAMPGVGTPAAGGVSYRDSILALQLLEQSRAVTSAEFVELNPVLDKDGQTTRAVVDLIAAFLGCGLQRTAAGRQEQD....... 301
15 0.000e+00UniRef50_U2E6X7 Arginase n=6 Tax=Clostridiales TaxID=186802 RepID=U2E6X7_9FIRM  ali  36  3.......LHIIGMPISYGASKKGSNLGPDKFREFKVEDLLRDLNFDVCDLGNIEVAKVNDDHCDQKLKFYDVVVDANTKLAFKVYDSISSGHFPLVLGGDHSLGIGSIAGVSKQYKNLGVVWIDAHGDLNTHETSETGNIHGMPLAASIGKGPDKLVNLFEHRI---KVKDENVVHIAGRDLDPGEVALINNSKINAFTMDKVYEHGIEKVMEESISYLKER-VDAIHVSFDIDSIDSSYVPGTGTPVRNGLTIEEAKKVLIALASSGLMVSLDLVELNPELDDNNKT----ADLYMELIRCIF.................. 294
16 0.000e+00UniRef50_A0A1Y2FU90 Arginase n=1 Tax=Protomyces lactucaedebilis TaxID=56484 RepID=A0A1Y2FU90_9ASCO  ali  40  1MSYTPSKVNVVPVAFSGGQAKGGVDDGPAMLLNHGLMDQIKQSGWDAQLLQDLDVLALKEDPPIGIMKNTRFVSSVTKKLSEVCGRSAATGGLTLTVGGDHSLAIGTIVGLMKQYPEACVLWIDAHADINTPTSTESGNIHGCPVSFVTGQAGPQSSLPETLQWIPACLDTSRLAYIGLRDIDPEERRIIRARNIAAYSMHHIDKYGIGTVVQMALDRVNPNLTRPIHLSYDVDAIDPVFVSATGTPVRGGLTFREGTYICEAIAETGCLVSMDLVEVNPNLRSEGQEVQATLDISTSLVRCALGET............... 319
17 0.000e+00UniRef50_A0A2D4CHE8 Arginase n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CHE8_PYTIN  ali  46  358....PQTVAIIGAPMTYGQPLLGTDGGPDLLRDAGLHKQLVEIGWSVEETGNLNFVPPRRDDPYGMAKNSFPVGNGLKQISDVFSEKAGEGKFCLVLGGDHTIGAGSLAGMLSVYPDAGFIWVDAHADINTPQLSGSGNMHGMPIAFLM-EGLVDATKVPGFEWIAPKMKPEQLVYIGLRDVDPPERRIIRELGIKAFTMQEVDRFGIGKTMEMALDHLCGKKERPLHMSYDIDAVDPVLAPSTGTKVRGGLTWREANYVAEAAAETNLLCGLDMVEVNPSLAP-GHGAQLTVDMALLLISSALGNR............... 665
18 0.000e+00UniRef50_C3M9P2 Arginase n=416 Tax=root TaxID=1 RepID=C3M9P2_SINFN  ali  35  2.....KSITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLSELGHTVHDEGDLRPLPARDLPNHAGANNLQMVAAFARALNDTVHDTARKGHVPIILGGDHALSMGSVSGMARVGRPLFVLWLDAHADFNSPSTSPSGNMHGMPVAFFCGEAEFT----PILAADRPLVDPKRVYQVGIRSVDSREREEIAEHGVNVYDMRAVDEIGMAHIMRQILDDVRAA-DGLLHVSLDVDFMDPEFAPGVGTTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKS----ARILVELTASLFGRRILDRP.......... 303
19 0.000e+00UniRef50_K0SBL4 Arginase n=3 Tax=Bacillariophyta TaxID=2836 RepID=K0SBL4_THAOC  ali  44  93............APMTFGQPFVGTDSGPKLIREHGLLKNLSSLGWRVEDHPDLDFADAEKSTRDPNAKHSQLVGAGTKVLADLVEDKLSTGRFPLILGGDHSIGIGSLSGILRARPETGVIWVDAHADLNTPSSSESGNMHGMPLALLMAELVPDRRVIPGFEWIKPFLSPDSLVYVGLRDVDKMERQYIKELGIKAFTMYDIDHLGIGRVMEMALSHLLDRADRPLHISYDIDAVDPMYAPATGTAVRGGLTWREAHFVAEHVVRSGNLASAEIVEVNESLSPGSETVELGHQLVTAMLGEAI.................. 395
20 0.000e+00UniRef50_UPI000719AF49 arginase, hepatic-like isoform X1 n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719AF49  ali  45  31.......IGIVGVPIWHGQPNPGTQWAPKRLRETGVIGGLQRLGWHVNDYGDLQFITFQDDIAPNAIYNPRTVGDATRKIAAAVRRSLQDNGISLNIGGDHSMTIGTFHAHAQVFDKPCLVWVDAHADINTAASSVSGHIHGMPVAFMLHETSGLCNVLPGFEWCRPSLTAKDVVYIGLRDIDPPEWDIIDRLGITYFDMKSIDQLGIAAVIKKALDAVNPNRDRPIHLSFDVDGLDTLEAPSTGTPVPGGMKLSEAVYIGEQLHKTGMLTCLDLAEINPDIG-SASDQKRTLYAARTIIEACFGKK............... 331
21 0.000e+00UniRef50_A0A2H5YY37 Guanidinobutyrase n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5YY37_9BACT  ali  23  32...EGVDIAVVGLPFDTGTYRPGARFGPAAIREQSSRIECYHPVLDIDVTDVVSVIDFG-----DAPVVPMETETSYASITATLQPLAARGIVPIGLGGDHSVSLPELRAVATRYGPVALVHFDAHVDTWDTIWGN-RYNHGTPFRRAVEEG---------------LIDPERSIQIGIRGGERAELEQSRELGFEVWTARQVRQASVSQVLGAIWRRV---GTHPVFLSFDIDFLDPVFAPGTGTPEIGGFTTWEAQEFLWGLVGL-RIVGADLVEVLPDRDPSGVTALIAANLVFDIIAVIAASRREQGHGATD...... 322
22 0.000e+00UniRef50_A0A136LMQ0 Arginase n=1 Tax=Chloroflexi bacterium OLB15 TaxID=1617416 RepID=A0A136LMQ0_9CHLR  ali  35  7.....APVRIYGVPMDLGQRRRGVDMGPSAVRYAGLQSKLEALGYTVTDGGNIVVEEIDDDPIDGLAHNVHSIVRVCTDVYHQVRDSLRAGETTIILGGDHSISLGSVSAAADVYPNVGVLWVDAHGDFNTPFTTPSGNVHGMVISSLIGLCPPPL------LLRSEPLSASQFAYIGVRDLDSQEKINMSASGAIIRTMRDIDESGMAEIVRGILSAMKDR--DAIHVSFDMDSLDPQVAQGVGTPVSGGLTLREAHLLMEMLADDGRVHSLDIVEINPILDTQNRTAQVAVELA----SSLFGQR............... 299
23 0.000e+00UniRef50_D9QTI4 Arginase n=2 Tax=Bacteria TaxID=2 RepID=D9QTI4_ACEAZ  ali  34  2......KIGIIGVPMDLGASRRGVDMGPSAVRYAHLAARIEELGLEVTDFGDIDVPVIRELENIDRSNFIPEIRDVCTSLSKKVQEIMIKGFIPLVIGGDHSIAIGTFGGVANAGKNVGLLWFDAHGDFNNLTTSQTGNPHGMPLAVINSDGPEDLVSITEGYD----LCEDNIALVGIRDLDYKERQRLKDTDIDVYTISDIDRQGIEEILEKAIQS-AGCGTEGVHVSFDVDVLDPLTAPGVGTAVPGGLDYREAHLALEMIAEAGVLASLELVEVNPILDERNRTAELAV----ELILSCLGKN............... 294
24 0.000e+00UniRef50_A0A226DYH3 Arginase n=5 Tax=Folsomia candida TaxID=158441 RepID=A0A226DYH3_FOLCA  ali  41  94.....RRIGVQGAPIRTGQRKPGVEHGPGLIRSSGIVEFLVNEGHNVLDYGDV---YLGQHFNGERARNPAAVAEATRYIYYSTKRILQDNRFPLTFGGDHSMAIATLSAVSEFYPDLAVIYIDAHADINTVQTTPTGNLHGMPLSFVIRELSGANAALTDFSWVIPRIPAANLAHIGLRDVNVGEIETLNRLGMASFNMRDVDRLGIRGVVDVVLNRIGGR-TRPVYISFDIDSLDDLEVHTTGTPVPGGLTVRDALSMLDELYRTVNLVGFELAEVNPSLGSQAE-GERTATISGKILACAFGSCRGHGPIKPGKFDPRK 408
25 0.000e+00UniRef50_A0A2R5GDU1 Arginase n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GDU1_9STRA  ali  41  115....PKTASIIGAPMSWGQPRAGTDQGSQILRACGLEDNLLALEWRIDDKGDLEFEPTRNDPAIDLAKNCFTVGKGLKKIHDRVYEAAKEKEFALILGGDHSLSAGSVSAILRARPDTGIIWVDAHGDLNTPETSPSGNMHGMPLGLMLGLIDPTLLPGFEWFKDVPKLNPEQIVFVGLRDLDAGERKIIRDHKITAFSMHHVDRFGIGNVMDMAIESLRKPDGRPLHLSYDIDAVDPEVAPSTGTVVRGGLNFREAHYVAEAVGNTGMLGSMDLVEVNPKLAP-GPESEMTAALGMALISSAMGAR............... 425
26 0.000e+00UniRef50_A0A163HN12 Flavin adenine dinucleotide binding n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163HN12_DIDRA  ali  44  13..PSRQDVGVVAVGFSGGQPKAGVDAAPMALIEAGLIKELEDLDLKVTFDGQVNYAELLPAEDPDGMKRPKFVSAVTKEVSEQVYNYAKTGKLVLTLGGDHSIAMGTVSGTARAGREIAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLATETREDVFGWLKAHHMLSTKKLVYIGLRDIDRGEKKILREHGIKAFSMHDVDRHGIGKVMDMALAWIGS--DTPIHLSFDIDALDPMWAPSTGTAVRGGLTLREGDFIAECVAETGSLIALDLVEVNPSLDELAISAL................................ 307
27 0.000e+00UniRef50_C1BR82 Arginase n=2 Tax=Caligidae TaxID=72034 RepID=C1BR82_CALRO  ali  41  30..FRSLHVGVIGASFEMGQPKNGVAKSPQLIIEMNLLKKIENLGHTVDYRGILEHTTSKEVATGTGALNRGNVHSFNKKLKNEVADALKANEFCITIGGDHSIGLGTVSGFTSVHPEGCLLWVDAHSDINTPHTSDSGNMHGMPVSYQLRELYEGFKDSDHSDWHKPRLSPERIAFIGLRSVDPGEEKILKDLNIEAYFMNDIDELGINEVIKRSLQRINPSGNRPLHVSFDIDSLDPLEAPATGTPVRGGLTLREGLRILYECHKSGSLKALDLVEVNSHLGNKEE-SLRTLTAAEHLIFSAFGH................ 336
28 0.000e+00UniRef50_A0A2V9BPY0 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9BPY0_9BACT  ali  32  453......KVRIIGVPMDLGQSRRGVDMGPSALRGAGLQAAIKKLGPSVEDIGNLEVKQPEEMPVGEKAKYLQEIAETCQDICRTVEKSLAEGFLPLVLGGDHSIAVGAASHFRQQKKEIGYLWLDAHGDMNTPESSPSGNIHGMPLAAIMGYGATELVELGGF---KPKAEPGNIVIVGARDLDAQERKIVKKSGVHVFTMRDIDERGLRDVMSEALKY-AMDDTAGVAVSLDMDFVDPTDAPGVGTPVRGGATYREAHLAMEMIADTESMVSMEVVEINPILDEHNRTALLGV----ELVLSALGQK............... 750
29 0.000e+00UniRef50_S0G6H1 Arginase n=12 Tax=Bacteria TaxID=2 RepID=S0G6H1_9DELT  ali  35  2....SRQISLIGVPMDFGQDLRGVDMGPAAVRYTGLITRLRELGHTVRDRGDVPIPIRDEAVPGPLAGNVEEISRICNAVYTLGRRVMEEKDFPLFVGGDHSIAVGTVAAAGADGEPIGLIWLDAHGDFNTPDTSPSGNIHGMPLAILMGEGH---PDLVNVGRPGPKVLPENVVMIGLRDIDPVEKKRLKTSGVTVFTMRDIDEQGISTVANKAVMKFAHM--KRIHLTVDMDALDPVEAPGVGTPVPGGITYREAHLLMEILADSKKVGSMDLVEINPILDVANKT----AKLAVELTLSALGKS............... 297
30 0.000e+00UniRef50_A0A1M4E2P9 Agmatinase n=27 Tax=Bacteria TaxID=2 RepID=A0A1M4E2P9_9ACTN  ali  26  30...ERADVAVVGVPFDTGSYRPGARFGPAAVREASRLLRPYHPGLDVSPFERAQVA-----DAGDIAVNPFDIGAAIETIEGAADDL---DARLVTIGGDHTIALPLLRSAARKHGPVALVHFDAHLDTWDTYFGA-EYTHGTPFRRAVEEG---------------LLDTEALSHVGIRGYGKKDLEEDRRLGFGIVTAADVLRRGLDEVIDLLRQRV---GERPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLAGL-NLIGADVVEVAPAYDHAEITSIAASHVAYDLVSLL................... 304
31 0.000e+00UniRef50_A0A0P5MVY1 Arginase n=5 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5MVY1_9CRUS  ali  46  15LSSRNYKIGVIGAPFDKGQRKEGAALGPSFLRQAGLVKHLEAIGCDVHDFGDVDYQPSQEDETVKNVRNMKNVIAFNEKLSQKVSKIINEGRMCLTLGGDHSIGVGTVHGHLKAQPETSLLWVDAHADINTPATSNSGNAHGMPLSFHIKELTEYQPELPGFQWHSPMISARNIAFIGLRDVEPYERLIIEKLGMCALSMEEVHGIGIKEAVKYALSRIDPRNTRHLHVSFDIDALDPLEAPSTGTPVRGGLTLR................................................................... 270
32 0.000e+00UniRef50_A0A0A9VX33 Arginase n=7 Tax=Neoptera TaxID=33340 RepID=A0A0A9VX33_LYGHE  ali  39  55...ESSRIGIIGVPFHKGQSSSGVEEAPSALREFGMVKQMISIGHNVKDFGDIICENIGERDVPDKIRSLPDLACASHALSSKVQDVMREHRKVLTIGGDHSIALGSVDGHIQANGEICLLWVDAHADLNTADTSDTGHMHGMPVSLLVKELADYWPYLPGLDWQKPTMSIKNLAYIGLRSVDHYERLIIEKYGVSAYGMEDIEKYGIHAVTTLALERINPTGTKSLHVSFDIDALDTLEAPCTGTSVRGGMTLREGVHIMEIAHRTGWLGAVDMVEINPRLGNILQ-VKTTLEAATHIIKAAFGFSRSG-HVPQHIEKLP. 372
33 0.000e+00UniRef50_G4D1A2 Arginase n=2 Tax=Peptoniphilus indolicus TaxID=33030 RepID=G4D1A2_9FIRM  ali  34  8....NKNISVIGAPLDMGGVRQGSRFAPDTLRLLGLIDKIKRLGLDIDRDFNLDVKNYKLEKSEDNLNHLDMILEQLDILFESVKNQMEEGRLPLVIGGDHTTVLGTMKGVLNNYPNAGLIYFDAHADINTTETSPSGNIHGMPIAALIGMGDERLKAVGGNLT----LNPENIVYVGLRDLDNGEKEILKENNIKCYTIADIDQLGMGRVMDEALEYLK--NTDGVHVSFDVDCLDPIFAPGTGIHLFGGLNFREARLGLEKCHASGKVLSLEFVELNPLLDYDNKT----AELLIELICAGLGEVR.............. 302
34 0.000e+00UniRef50_A0A0P5B101 Arginase (Fragment) n=4 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5B101_9CRUS  ali  47  22LSSRNYKIGVIGAPFDKGQRKEGAALGPSFLRQAGLVKHLEAIGCDVHDFGDVDYQPGQEDETVKNVRNMKNVIAFNEKLSQKVSKIINEGRMCLTLGGDHSIGVGTVHGHLKAQPETSLLWVDAHADINTPATSNSGNAHGMPLSFHIKELTEYQPELPGFQWHSPMISARNIAFIGLRDVEPYERLIIEKLGMCALSMEEVHGIGIKEAVKYALSRIDPRNTRHLHVSFDIDALDPLEAPSTGTPVRGGLTLREG................................................................. 279
35 0.000e+00UniRef50_B7QBR7 Arginase n=9 Tax=Ixodoidea TaxID=297308 RepID=B7QBR7_IXOSC  ali  44  44....KQEIGLVGIPLSCGQEKLGVEEGPSFLRAAGLVSRLEDLGHTVRDYGDVKVEGNPNVTSANAMKS-DCVGQTSKNAKDAVAEVLSSGLISVNLGGDHTMPIGTVSAHAVANSDISLLWVDAHSDINTPLSTTSGHIHGMPVAFLLHEMEPFLTKPEGMEWIQPCVHKDNFAYIALRAIDPYERYFMDKLGITLYSMDDVDRIGITEVIRLALRQINPRGTRSLHVSFDIDSIDMLIVPSTGTPVIGGLSMREALVIAEEVHRSGQLRVLDLAEVNPRLG-SAEDANRTVNCGVDLISTFFGRERRGDLP......... 351
36 0.000e+00UniRef50_UPI000B90794F arginase-1-like n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B90794F  ali  44  46......KIGVQGAGFDKGQRKPGVERGPTTIRSSGFIDFLRDEGHDVVDYGDLKVEERKSLDTSSALRNVVEVGKANLLISKSTAKIIQEKRIPLTLGGDHSIAIGTIHGVSEVVQDLAVLWVDAHCDINTPGSTPTGNMHGMSLSFLLKEL--KGHGIPEFSWAIPRISARNLAYIGLRSVDAGERKLLDNLGITAYSMRDVDRLGIVEVTRCALEKIAPSGSRPLHISFDIDVLDDLELGGTGTAVEGGLTLREGMTLLEEVREKANIVSMDLVEVNPALGSDEA-AKRTATLTKHLFGSVFGYCRGGMY.......... 361
37 0.000e+00UniRef50_A0A0K3AXM8 Agmatinase n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A0K3AXM8_9PSEU  ali  25  29...DKADIAVVGVPFDTGSYRPGARFAPAAVREASRLLRPYNPGLDVSPFERAQV-----VDAGDIVCNPFDIGKAITEISEQATELLDTGAKLVTVGGDHTIALPLLRSVAAKHGPVALLHFDAHLDTWDTYFGE-PYTHGTPFRRAVEEG---------------ILDTSALSHVGTRGYGRADLSEDARLGFGIVTSADVLRRGVDEVIEALRARI---GDRPLYVSIDIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLAGL-NLVSADVVEVAPAYDHADITSIAASHVAYDLVTLL................... 306
38 0.000e+00UniRef50_A0A2P2H787 Arginase n=9 Tax=leotiomyceta TaxID=716546 RepID=A0A2P2H787_ASPFA  ali  43  13..SKPGNLGVVAVGFNGGQCKLGVEAAPMALVEAGLLDQLRD-DLGYTLDYDGTVHYYENDPDHRGMKKPRAVSAVTEALSAQVYEKAKQGQMVLTLGGDHSIAIGSISGSAKAGRELAVIWVDAHADINIPEMSPSGNIHGMPMAFLTRLAREEQKDIFGWLQDEHIVSTRKLVYIGLRDVDRGEKQILREHGIKAFSMHDIDRYGIGRVVEMALAHIG--NDTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLVAMDLVEVNPSLESVG--ASETIRTGCSLVRSALG................. 320
39 0.000e+00UniRef50_D2AUK3 Guanidinobutyrase n=14 Tax=Actinobacteria TaxID=201174 RepID=D2AUK3_STRRD  ali  27  35......DVAVVGVPFDSGSYRPGARFGPSAVREASRLLRPYHPGLDVSPFAALQVA-----DAGDIACNPFDIGEAVETIEHAAGELQDTGARLVTIGGDHTIALPLLRSLARRHGPVALLHFDAHLDTWDTYFGA-EYTHGTPFRRAVEEG---------------ILDTEALSHVGTRGYGKKDLEDDRRLGFGVVTSADVMRRGVDEVVDALRQRI---GGRPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLAGA-NLVGADVVEVAPAYDHAEITSVAASHVAYDLVSLL................... 309
40 0.000e+00UniRef50_UPI0009FBD015 agmatinase n=1 Tax=Paracoccus sp. S4493 TaxID=579490 RepID=UPI0009FBD015  ali  26  34.TAKGLDIGIFGVPFDGGTNRPGARHGPREIRTASSMQRTYNLATGVEPYEICNFGDIGDVPINPLDQHHSLIE-----IQSFCEEIIRENCLPIAVGGDHLVSLPLLRALGD--PSLGLIHLDAHSDTGDYDFTQTKYSHGTPFRRAIEE---------------RLLDPQKIVQVGIRGSSSEELEWAVAQGITIIGMDQFHQLGVEGVSAMIREVV---GNAPVYLTFDIDCFDPAFAPGTGTPEAGGLTSYEGLNLLRRMRGL-NFQGADLVEVCPPLDSSGITSILGATVLFE-ICCLLAESRQKG........... 319
41 0.000e+00UniRef50_L7ZQT6 Guanidinobutyrase n=104 Tax=Bacteria TaxID=2 RepID=L7ZQT6_9BACI  ali  23  35......DFAVIGVPFDTGTFAVGTRFGPEAVRSMSSLLRPYNPGLQIDIFQ-----YCSGVDYGDLSVNPGYIEDSYEMIANQLEPLLNKNVVPILIGGDHSVSLPHLRAMAKRYGKVSLIQFDSHGDTWDSYFG-KKYTHGTMFRRAVEE---------------QLVDPFSSVQIGMRGYSAEDLKDAEDLGYKVITTDQLRALTPNQLGEEIRKRV---GKNPVFVSFDVDFLDPAYAPGTGTPEIGGFTTYEAQQFVRQLKGL-NLVGFDIVEVLPDRDPTRVTSLAAANIGFEFISLVAWNKREKNSR......... 319
42 0.000e+00UniRef50_A0A2A5DEA7 Arginase n=25 Tax=Bacteria TaxID=2 RepID=A0A2A5DEA7_9BACT  ali  30  11.........IMGVPMDLGASRRGTDLGPSALRVAKVGAALRDLGFEVQREQDIPVPAMETRAGYDDARFLAEILQVCEELAQQVKLALDEGTTPLVFGGDHSIAMGTVAGVAQHFEEIGLVWFDAHGDMNTPASSPSGNIHGMPLAHLIGLD-GTNDALASIGGRKGIIKPENVALVGIRDIDRKEAALVRESGVHTWTMRDIDEKGMPRVVAEILDVVNVD-TAGFHLSFDVDGLDPEVVAGVGTPVPGGVNFREAHLMLETMADTGRMTSMEIVELNPLLDLCNQ----GAENMRHLICSAFGQS............... 308
43 0.000e+00UniRef50_UPI000C209304 arginase-1-like n=3 Tax=Onthophagus taurus TaxID=166361 RepID=UPI000C209304  ali  42  32.......VGIVDAPVEEGQKKRGVSKAPQVLREAGLIQKLEDCNVSVKDYGAISFDKSSSKKLPENMLNYERVVGYNKNLSEIVQKVINDGRICLTLGGDHSIGLGSVSGHCKAKGNTALIWVDAHADINTNKTSDSGNIHGMPVALLAQDLIPYWSNLPFMDWHHSLLPLKNIAYIGLRSIDPYEEFLIQKMGIVCYDIYDVQKYGIDSVINESLRKIDPDATKSIHLSFDIDALDPSDAPSTGTPVDGGLLLREGIYIASTIHKTGRLGAMDLVEVNPTLG-DEEDVQKTINSALQVIAAAFGYGRRGLKPGLEDL.... 347
44 0.000e+00UniRef50_T2MHD8 Arginase (Fragment) n=2 Tax=Hydra vulgaris TaxID=6087 RepID=T2MHD8_HYDVU  ali  44  29.......VGIVGVSVKEGQNLLGVELAPEKIRSGGLFEVIKSLNWDYSDKGDIKTEDIQTQKCYEELKNVDIIGAANEKLHNKTSEIAELGQFCITLGGDHGCASGSISGLKKVYKDLKVIWVDAHSDCNIPETSPSGNYHGMPVAHLLGWIPD--GSVPGFDWFKSCLKNEDIVIIGLRDVDEGEKVLLKKHGIKCFSMHDVVKYGISGVMEKTFEYFRKDGVDPIHISYDVDGIDPTVAYGTGTKARGGLLYREAHYIVREVVSTGQFVSMDVVEVNPLLDKEHGDSKLTVCLAIELCASALGYT............... 342
45 0.000e+00UniRef50_Q10066 Arginase n=5 Tax=Schizosaccharomyces TaxID=4895 RepID=ARGI2_SCHPO  ali  41  24.......VSIINMPFSGGQPKDGAELAPEMVEKAGLVDDLEHLGYDVKLIQNPEFKSRPSKEGPNQMKNPLYVSNVTRQVRDAVQRELEQQRVVVNIGGDHSLAIGTVEGVQAVYDDACVLWIDAHADINTPESSPSKNLHGCPLSFSLGYAEPLPEE---FAWTKRVIEERRLAFIGLRDLDPMERAFLRERNIAAYTMHHVDKYGIGRVVEMAMEHINPGKRRPVHLSFDVDACDPIVAPATGTRVPGGLTFREAMYICEAVAESGTLVAVDVMEVNPLLG-NEEEAKTTVDLARSIVRTSLGQT............... 321
46 0.000e+00UniRef50_UPI0003DE9B3A arginase-1 isoform X2 n=3 Tax=Holometabola TaxID=33392 RepID=UPI0003DE9B3A  ali  42  20.....KKLGIIGVPFEKGQHKKGVAQGPEAIRKAGLMKELELLG---------------------------DVAGCTSKLSEQFQQILKKDRRILTLGGDHSLGIGTIDGHVKEKGDIALIWVDAHADLNTNKTSTTGLFHGMPVALLTSELADYWPHLPGMDWQKPMLSIRNVAYIGLREVDSYERLVIEKFGITAFGMEDIERYGIHDVTYMALSKIDPNDSRSIHVSFDIDSLDPLEAPCTGTPVRGGLSLREAIHLMEVLYRTKRLNALDIVEINPYIGNKY-DVQLTIGAAIHIIQAGFGYSRRGLRVPEGVTDIP. 307
47 0.000e+00UniRef50_A0A1B2JCT6 Arginase n=1 Tax=Komagataella pastoris TaxID=4922 RepID=A0A1B2JCT6_PICPA  ali  42  119..YPNKEVTIISAPFSAGQRNGGVEKGPKYLLKHGLKEDLEALGWKVSLEEPLKGSGLDIFEAGNRMRNPTIVGQATEKIFETVKSVAHKKVFPLTIGGDHAIGMSTLAGFLDAYPDACVLWIDAHADINTPDTSPSGNLHGFPVSFAMGLKRDLWHKQFWLDNAKTKLLANRIAYIGLRDVDAGEKVILRDLGIAAYSMYHVDKYGIAKVVEMALSKINPSGKSPVHISYDVDALDPLFTPATGTPVRGGLTFREGMYIVEAVAETGNLAALDIVECNPDLAISNVHEFDTIAAGCAIAKSALGET............... 434
48 0.000e+00UniRef50_A0A143PPX2 Arginase n=65 Tax=root TaxID=1 RepID=A0A143PPX2_9BACT  ali  35  2.....AHIHLIGVPLDLGGGRRGVDMGPSAVRIAGIGTRLTALGHHVQDRGDILTPTPETREAGDPKKRYREIHDVCEALYAQALDSHAAGAFPIVIGGDHSLAAGSVAAAKRQGRPLGLIWVDAHADMNTPATTGSGNVHGMPLAALLGEDPR---ELALVGGYQPKVAPGHTVLVGIRNLDEREKEEVRASGVHVFTMKDIDRQGAASVIEQAIE-IAGRDTAGIHVSFDLDVCDPAIAPGVGTPVRGGLNYREAHMAMEILSDARRIIALDLVEVNPVLDHQNMT.................................. 285
49 0.000e+00UniRef50_F3YTU3 Arginase n=6 Tax=Desulfovibrio TaxID=872 RepID=F3YTU3_DESAF  ali  35  5.....KSVQVIGVPLDLGVSKLGVDMGPTALRYAGIFEALRYAGIDYRDAGDIDVLRNFSLDPLSPAERLREIIRTSETLARFTAKAIEDGHMPIVLGGDHSTAIGSVAGAAKARGRIGLIWIDAHPDANTPETSPSGNVHGMPLAISLGHG---MPELVNCLGFAPKVRPEDVCIVGAKDIDPEERKFLTRMGIRMFTTFDIENRGLARVMQEAVD-VVSRGTNGVYVSFDADVMDKRVAPGTGITTRGGLTYREISFIMRSIGAGVELIGFDIIEVNPLLDKANGTAELCVELAMAMLG..................... 300
50 0.000e+00UniRef50_A0A1V8V764 Uncharacterized protein n=1 Tax=Rachicladosporium sp. CCFEE 5018 TaxID=1974281 RepID=A0A1V8V764_9PEZI  ali  45  439......DLGLVAVGFSGGQCKAGVDAAPMALIESGLVDQLQN-DLAYKVHYDNEVHAYSSDPPHRGMKNPRAVSAVTQELSNQVYAHAKEGRFVLTLGGDHSIAIGTISGTAKAGRDMAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLATEFAENPFGWLKPEHRVSVKKLVYIGLRDIDRGEKRILREHGIKAFSMHDIDRHGIGKVMDMALGHIGT--DTPIHLSFDIDALDPSFAPSTGTAVRGGLTLREGDFIAECVHETGSLVALDLVEVNPSLEQNG--AAETVRAGVSIVRCALG................. 742
51 0.000e+00UniRef50_A0A2N3MXM2 Arginase (Fragment) n=123 Tax=Opisthokonta TaxID=33154 RepID=A0A2N3MXM2_9PEZI  ali  42  37..SNPHDLGVVAVGFSGGQGKAGVDDGPVALIESGLINQLRNLGYKIHGDEEVQVRSYHDIVPTDNMLNPRSVSAVTAKIADEVYSHAREGRMVLTLGGDHSIAIGTIAGTAKAGKELAVVWVDAHSDINTPETSDSGNIHGMPVAFVSGLAKEEKPDIFGWLKEDHMLSLKKLVYIGLRDVDVAEKRILRENGIKAFSMFDIDKHGIGRVVEMALAHIG--NDTPIHLSFDVDALDPMWAPSTGTPVRGGLTLREGDYICEALHETGNLVAVDLVEVNPRLAETELGPAETVRAGSSIVRCALGES............... 352
52 0.000e+00UniRef50_F4LMU9 Arginase n=14 Tax=Treponema TaxID=157 RepID=F4LMU9_TREBD  ali  33  2......KIHILEMPLDFGGNRHGSDMGPSAIRLAGLKERLSHLDHEVTSFSPIAINPQEYEDPGRAAKYLKQIVSACNLLAAETEKAVLDGKFPLVLGGDHSIALGTIAGLSGAYRKLGVLYVDAHGDFNTSETSPSGNIHGMCLSASCGFG---IPELTELYRPGVKVLPENVCYVGLRDIDSEEKKLMKRAGVTAFTMSDIDRLGFSAILQKVTSFFKSR-VDVVHVSFDMDVIDPMFAPGVGIPLPGGLNYREALLLMEEMAATGMVGSAEIVEVNPVLDVRSQTARMAVELVARLLG..................... 298
53 0.000e+00UniRef50_A0A1H5VR56 Arginase n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1H5VR56_9FIRM  ali  35  2...RKKSIGIVGSQMDLGAVRKGVDMGPLAIRHSGLIQKIRENGYEVKDYGDI-LPMVATDEGNSNMRYEKEINEANQRLFEQVFKIHESGAFPIILGGDHSIAAASVSATAQHYGDIGVIWVDAHGDFNDDKITPSGNIHGMPLSAVCGCGPDSIVSFTG-----ARVDPHKIAIVGARDLDPEEVKKLKKYGVNVFSISDIHHFGIRKIMETAIE-VTSDGTKGIHLSFDMDALDPGNAPGVGTPVMNGLTNREGFTVCEILSDIDRLLAIDMVETNPLLDSRNATGILAA----ELILTCIGKT............... 294
54 0.000e+00UniRef50_UPI000C77A8E8 arginase, hepatic-like isoform X1 n=2 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C77A8E8  ali  41  67.....SRVGILGACFDQGQPHQGVGEAPNLIREAGLISKLKEKGFEVIDHGDISRPRV------DGKRKQKDVLDFNRVVSEKVEKILGQDSFCLTLGGDHSIGLGTVAGHLAADPEAVVLWVDAHADINTVSSSNTGNMHGMPVSFNIKELQKENSKLEGLEWLNPSLSPSRLAYIGLRDVEGVEWSYIQKFSIPCFPMQAIDRIGIVNAVESALNIVDPLKKRKIHMSFDIDVLDPAEAPATGTKVRGGLTLREALTLCEIVHDTGRLTGLDLVEVNPELATCKQDLDKTMEAALEVILAALGK................ 362
55 0.000e+00UniRef50_M0PIT3 Arginase n=15 Tax=Halobacteria TaxID=183963 RepID=M0PIT3_9EURY  ali  35  4.......VRIIGAPTDYGANRRGVDMGPSAIRYGGLADQLAGAGVETVDAGDLAVPRAEERDPDGNAKFLRETADVSRRLADAVSDTLADGEVPLALGGDHSIAIGSLVGSAR-DADIGAVWFDAHADLNTPSTTPSGNVHGMPLAAALGFDEFADTDWAN----APGLSPENVALVGLRSVDEAEVDVIRDHGFTAYTMSDIDERGITDVTEEAMAA-AADGTDGVHVSLDLDWLDPKEAPGVGTPVRGGVTYREAHSAMETVDEADCLRSMELVEVNPTLDQHNET----AELATELAASAFGKR............... 299
56 0.000e+00UniRef50_A0A2W5XPS1 Arginase n=1 Tax=candidate division WPS-2 bacterium TaxID=2052317 RepID=A0A2W5XPS1_9BACT  ali  35  10....NKTVSVIGVSMDLGASRSGARLGPEMLRMAGLISRIKALGLQVRECADIVVAPEDSVDGGPGPKHVQAIVNASSAIADAVEAALRTDTFPVVVGGDHSMAAGVMAGIARVLGPQGIIWIDAHADLNTPDSSPTGNLHGMSMAAALGEMQDIFAPGV---FPSPAADAKRCVFIGLRELDPAEKRRIHDLGIACFTMSDIDRIGMGRALEKAIA-IAGHGPGSVHVSYDIDSLDPSLAPGTGTPVRGGLTYREAHLAMEMIAKSGVAHSLELAEVNPLLDTHNKTARLAAELICSLLGKAI.................. 306
57 0.000e+00UniRef50_A0A1Z5SRI2 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5SRI2_HORWE  ali  45  729......DIGMVAVGFSGGQCKPGTDAAPMALIESGLVDQLKD-DLKYDVHYDGQVHAYGDIIPHRQMKKPRAVSAVTQKLSQQVYDHAKEGRFVLTLGGDHSIAIGTISGTAKAGREMAVIWVDAHADINTPETSDSGNIHGMPVSFLTGLALDKPDAPFGWIKDDQKVSVKKLVYIGLRDVDRGEKKILRDHGIKAFSMHDVDRHGIGKVMDMALGWIGS--DTPIHLSFDIDALDPMWAPSTGTAVRGGLTLREGDFIAECVHETGSLVALDLVEVNPSLEEQG--AAETVRAGVSIVRCALG................. 1032
58 0.000e+00UniRef50_A0A1W9VNE7 Arginase n=1 Tax=Spirochaetaceae bacterium 4572_7 TaxID=1972456 RepID=A0A1W9VNE7_9SPIO  ali  33  4.....KKIGLIGVPQDVGASKKGVDMGPGAIRVAGVIKKLRKLGHEVKDFGTVDCYTVDQFDSIDGMNYLDIIIDTCTLLKARVEAIIDAGYFPLVLGGDHSIAIGTLAGLKKIHGHTGLIWIDAHGDFNIPDSSPSGNIHGMPLAVATGRGHKDLLSV----GPSPTVSEKNCVIIAARDIDPKEAELLKKSDVTVFTMMDIIKYGIVDITKRAIE-IASYGVEHIHVSFDVDSLDPIVAPGTGTQVPGGLHYREAALLLESISKCNKISSFELVEVNPALDIYNKTAELSVDLLCHAFG..................... 299
59 0.000e+00UniRef50_B9A9C6 Arginase n=41 Tax=Holometabola TaxID=33392 RepID=B9A9C6_BOMMO  ali  39  12......RVGVIGVPFEKGQKKYGVSIAPAAVRAAGLIDELKEIGLDVKDFGDIETSSCENNVNVNNMNHLPLVSACNKNLSERVSHVLKDGRIAVTVGGDHSIGVGTVDGHYNVNEDMILIWVDAHADINTNKTSESGSVHGMPVALLVRELSDYWPYLPTMDWQVPRFSIKNLGYIGLRSVDKYERLAIEKYNVPTFTMEDVDLHGVEKSITHLLKVLDPENRKPIHVSFDIDSLDALEAPSTGTPVRGGLTLREAIKLMEIIHATGRLRAIDLVEINPAIG-NENDRKRTIEAGLCVLKAALGFSRKGS-PPKGITDLP. 325
60 0.000e+00UniRef50_A0A1D2MVY3 Arginase n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2MVY3_ORCCI  ali  42  47......RVGVQGVELYRGQNKRGVELGPKAIRDTGVVAALRNVGHEIVDYGNAPIQTVPESDYNGNVHYVKQVADANRMISDWTSKIMRDGRVCLTLGGDHALGIGTVNGASQVHPDLGVLWIDAHSDINTPLTTGSGKIHGMSVAFFVQELQPYMTQLPEFSWVQPRIKAANLAFIGLRDVDPAERAILEMLGITAYSMRDVDRHGIQKVTEMALSKISQDKKRPIHVSYDIDSLCESIVKSTGTPVPGGLSLREGITLLEMINETGRMVSMDLVEVNPLLG-SELDAAATAQAAKHLILGAFGHSRGGM--ALNSIPKP. 381
61 0.000e+00UniRef50_D8ITV1 Arginase n=220 Tax=root TaxID=1 RepID=D8ITV1_HERSS  ali  35  3......RIRMMGAPTDVGASRRGASMAPAALRVAELQRGLQQHGLDVIDGGDLAGPANPQQPPVQGLRHLEQVVQWNQTVHEAVAQCLADGELPLLMGGDHALAVGSIAAVAAHGKELRVLWLDAHADANTSQSTPTGNIHGMPVACLLGVGPAALTAI---GGQTPALQPQQICQVGIRSVDREEKRHLRELGVRVFDMRHIDEYGMRQTMEEALAGVGPQ--THLHVSFDVDFLDAALAPGVGTAVPGGPTYREAQLCMEMIADTGALASLDVMELNPACDVRNQT----AELVVDLVESLFGKS............... 298
62 0.000e+00UniRef50_A0A069RBJ7 Guanidinobutyrase Gbh n=12 Tax=Bacteria TaxID=2 RepID=A0A069RBJ7_PEPLI  ali  26  32...EGLDFAVVGVPFDTASYRTGSRFGPSAIRNISSLIKPNNVNLQVNVLESLKGA-----DCGDVNVVPGWIHETFENIENELKPILDADVIPIILGGDHSISLANLRAIAKKHGPVAMVHFDSHADINDKVFGM-PHNHGTPFRRAHEEG---------------LIDPDHVIQIGMRGYDPDEHRVAEELGFRLIAAHKVREMGIEGLIKEIKDRV---GDKKVFLTFDIDFVDPAYCPGTGTPEVGGFTTLETLTILREL-KDLNFVGCDIVEVAPQYDPSEMTAFMAANVAFEFISMLAAKK............... 314
63 0.000e+00UniRef50_F0WCX4 Arginase n=26 Tax=Oomycetes TaxID=4762 RepID=F0WCX4_9STRA  ali  42  63........AVIGAPMTYGQPLLGTDTGPDLLREAGLHKNLVELGWSVEETGNLHFDPPKRTDPYGHAKQCFAVGNGLQKISEIVARKTEEGKVSLVLGGDHTIGCGSVAGMLKTYPDAGIIWVDAHADINTPKTSLSGNMHGMPLAFLMGMVENEIIPGMEWLADGPYLLPEQLVYIGLRDLDAGERHIINELGIKALTMQQVDRYGIGKTMEIALDHLCGKKRRPLHMSYDIDAVDPLIAPSTGTRVRGGLTWREAHYVAEAVAETNLLCGFDLVEVNPTL-SSNNDSVITVDMGLLLISSALGNR............... 366
64 0.000e+00UniRef50_B3RJY7 Arginase n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3RJY7_TRIAD  ali  45  37.......VNIIGYPFSIGQPIDGVHLGPDAMREYGIVQRIRDAGRKVRDLGNILLDNSRKGEQFGIVKDPATVSAASKLLSEKIQSVLEDDSLPITIGGDHSLAIGSIHGHTARIDDLCVLWIDTHADINTGESTVTGNMHGMPLSILMKELEKK--RIPGFEWAKPCMTAKDIAYIGLRDVDPEEFKYIEDIGIHMATMADIDHHGMGSVFERALDTINPRRDRPLFVTWDIDVFDPSEAPSTGTAVRGGLTLREGLHLAEQIAKSGLLVGFDLVEVNPKIGSQE-DVKKTMDTACFIIEALLGKTRRAN........... 338
65 0.000e+00UniRef50_Q3BN30 Arginase n=174 Tax=cellular organisms TaxID=131567 RepID=Q3BN30_XANC5  ali  34  1MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDLGNLDGPRNPWQAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGDHCLGIGSITAVAKQGRPLRVLWLDAHSDFNTSEVTPSGNVHGMPVACLCGLGPESLTHL---GGSAPALLPEQVRQIGIRSVDPEEKRLIKQHRIDVYDMRYIDEAGMKRTMEAALQGMSA--DTHLHVSFDVDFLDPSIAPGVGTTVPGGPNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLV----ESLFGKS............... 302
66 0.000e+00UniRef50_UPI000719D3A9 arginase, hepatic-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719D3A9  ali  45  34.......IGVVGVPFAHGQNKPGVHEGPRLLREAGFIDGLEKLGWKVHDYGDLDFELVKEDESYGNIQLPRTNGLANKLISAAVQKSIVDHGTCISIGGDHSLSAGTIHGHAQAHEDIVLIWVDAHADINTSLTSYTGHLHGMSGAFSIKELDKYIPKMPGWDWLTPTVAARDIVYIGLRDVDPGERYLLDKYRIQCYDMYLVEKYGMAKVMEMTLEYINPKLNRPIHLSFDIDCLDIAFAPATGTPVPGGLTLREGLFLAEELNKTEMLTGVDLVEVNPMLDVGKNLTLWAANLV---LQSCFGKITAGNVPAGFEMPKP. 349
67 0.000e+00UniRef50_A0A2D0QQX3 Arginase n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A2D0QQX3_ICTPU  ali  60  27......SVAIVGAPFSKGQKRRGVELGPKAIRDAGVVERLASLENAVHDFGDLSFEHLEEDDRFMNVPFPRTVGRANQILSDTMSRAVGAGHTAVMLGGDHSLAIGSVAGHAQQRPDLCLIWVDAHADINTPMTSPSGNLHGQPVAFMLKELQDKMPVVPGFSWMKPFLAARDLVYIGLRDVDPGEHVILKSLGIQCFTMRDIDRLGMQRVMEVTLDHLLARKQRPIHLSFDIDAFDPTLAPATGTPVNGGLTYRE.................................................................. 276
68 0.000e+00UniRef50_A0A098R1X2 Arginase n=2 Tax=Spirochaeta lutea TaxID=1480694 RepID=A0A098R1X2_9SPIO  ali  31  5.....SKLSIIGFLQDIGASKRGVDMGSYAIRAEKLVEKLKALGYQVSDEGNVECYSMDEGDTNPKLRYAAAIRRNMLELKEQVQAIVQQDAMPIVLGGDHSMAMGSLAGLKERYGNLGLLWVDAHGDFNTPETTPSGNVHGMPLAAITGRGAPELVDIGPF----PGVREENTVLFGIRDLDPEESMLIRESRVTMYTIRDIIERGFYTCLQEALQ-VVTTGVDQFHLSFDMDSIDPIFAPGTGTPVMGGLNDREVLYLMERVHETGRLVSMDLVEVNPALDVGNKTARLAA----ELILRALGKK............... 302
69 0.000e+00UniRef50_A0A2B8JBT7 Arginase n=1 Tax=Bacillus megaterium TaxID=1404 RepID=A0A2B8JBT7_BACME  ali  32  2....KKTIDILRVPFALGSHRRGSDLGPLAISHTGLARSLSEKNYAVLERE-VTISTEPDKNENPNLLHLKAVCDTSEELAKQVDSVIERGHFPLVLGGDHSIALGTIAGVTTHYDNVGVLWIDAHGDANTDETSPSGNIHGMPLAASLGYGHPLLTNL--YGSVLPKVKPKNVALIGVRDLDEGEVEFFKQHDITYYNMSRVNEIGISIVLQQIKEQFQHESVKHIHLSFDMDVLDPELVPGVGTPVPGGMRLTQAEQVIKEVKSWNQLVSAEFVEVNPLLDNKNRTAKLAARLIKHL....................... 293
70 0.000e+00UniRef50_A0A0B0HX53 Arginase n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A0B0HX53_9BACL  ali  37  3....EQSISIIRVPFGLGAGRPGSEHGPDSIMKFGLAKKLAGLGYDVGADRSIRLPEGVRSPAGTKMKHVQEVLAVCTRLGEAVSEAVADGRIPLVLGGDHSIAIGSLAGLTRHYGNMGVIWVDAHSDLNTESTSPSGNMHGISLAAGLGLTHLKLKQIAEGAAS---LKAEHCVIIGARDLDRDEKALIRSCGLTCFTMHEIDRLGIEQVVREAL-RIAGQGTDGVHLSFDIDSVDPIEAPGTGTPVRGGLSYREAHLLLELLSESGAVTSADFVEVNPLLDRNNQTSKLAV----ELIGSLFGSR............... 297
71 0.000e+00UniRef50_A0A0M2VQ20 Arginase n=7 Tax=Bacillales TaxID=1385 RepID=A0A0M2VQ20_9BACL  ali  35  6.......ISLLRVPLGLGGARPGAELGPKSLIDAGLIRQLNHIHVHVSDEGSISIDSSTDSSAPRNLKHLETIAQVNARLRDKIDSLMEKCTFPLILGGDHSIAIGTIAGLTRHYQRLGVIWFDAHGDLNTPDTSPSGNIHGMSLAVSLDQGHPLLTELR---KGCHPLDPAKVVIVGARELDQGEREMIKRLGITCFTMHEIDRYGMAAIMEKTLE-IVSDGTDGVHLSFDIDSLDPYEAPGTGTTVRGGATYREAHFALEMMFEANLLTSAEFVEVNPLLDHNKQT----VKLANELICSALGKR............... 299
72 0.000e+00UniRef50_A0A1D1VD08 Arginase n=2 Tax=Parachela TaxID=210572 RepID=A0A1D1VD08_RAMVA  ali  46  31LSPNTKIAGVFGALMNRGQGKEGVRDGPNAIREAGLLTLLKDCGISFRDYGDVEIQAIASDDPWKKVKYSRTVAGGCKQIADKVQTIIRENGVPIMLGGDHASAIGSISGHLEIHGPLAVLWIDAHADINTPLTTATGNLHGCPVSFLLKEMSPYIPDIPGFEWQQPCLTADRIAYIGLRALDPDELFVMDKLKIKYFPMQDVDKLGVQKCVELALQHINPNNDLPLHLSFDIDALDPSVAFSTGTPAMGGLTLREGLQIVEYVRSTGQLSAMDLVEVNPTLGNGYQRAK-TMEAACAIIAGALGKPRQAIPYKLDFDLP.. 362
73 0.000e+00UniRef50_A0A267MM19 Agmatinase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A267MM19_9CLOT  ali  27  32.NLEELDFAVVGVPFDTASFRTGSRFGPGAIRNISALIKPNNVHLEVNVLDSLKGADYG-----DLNIVPGYIEKSFENIEEGLQPLLDANVIPIILGGDHSISLPHLRAIAKKHGPVALVHFDSHADINDTVFGEKHN-HGTPFRRAFEE---------------KLIDPDHVIQVGMRGYDPDEHKIAEELGFRLIAAHKIREMGIDNLIEEIKDRV---GDKKVFLTFDIDFVDPAYAPGTGTPEVGGFTSHETLTIVRAL-KDLNFVGCDIVEVAPQYDPTEMTAFMAANVAFEFI-SMLATKKK............. 317
74 0.000e+00UniRef50_A0A1Y2LJR6 Arginase n=85 Tax=Fungi TaxID=4751 RepID=A0A1Y2LJR6_EPING  ali  44  60......DVGVVAVGFSGGQPKPGVDAAPMALIEAGLIKELEN-DLDMKVSFDGQVHNYEEDPDYRGMKRPKFVSAVTKQVSDQVYKYAKDGKLVLTLGGDHSIAMGTISGTAKAGREIAVIWVDAHADINTPETSDSGNIHGMPVSFLTGLAKEDREDCFGWLKPEHMLSTKKLVYIGLRDIDRGEKKILREHNIKAFSMHDVDRHGIGKVMDMALAWIGS--DTPIHLSFDIDALDPMWAPSTGTAVRGGLTLREGDFIAECVAETGSLIALDLVEVNPSLDEVG--ASDTIRAGNSIIRCALG................. 363
75 0.000e+00UniRef50_A0A1S7HGC0 Arginase n=4 Tax=Zygosaccharomyces TaxID=4953 RepID=A0A1S7HGC0_9SACH  ali  43  9..YPQRKLALVLAPFSGGQGKSGVEKGPEYMLRQGLAHEIQELGWNVTKHEPLKTLPESDEVQCGKVKNANLVGEATERIYRTNLEALNQDSFPLTLGGDHSIAMGTVSAVLEKHPDAGLIWIDAHADINTLQGTESGNLHGCPVSFLLGLNKEAPGKL---SWVPNKLHPSKIVYIGLRDLDRPEKRIIKELGIKAFSMYHVDRYGINQVIEMALQHL---GNGPVMCSYDVDAIDPQYVPATGTPVRGGLTLREALFLVERLAETGKLVALDVVEVNPQLATDDVHVVDTINAGCALARCALGET............... 307
76 0.000e+00UniRef50_A0A0A2LCI9 Ureohydrolase n=2 Tax=Aspergillaceae TaxID=1131492 RepID=A0A0A2LCI9_PENIT  ali  45  18.......LGVVAVGFNGGQCKKGVEAAPMALIESGLLTQL-SEDLDYDVHHDNTVHYYENDIPHRGMKKPRAVSAVTEKLSTQVYNYAKDGKFVLTLGGDHSIAIGTVSGTAKAGREMAVIWVDAHADINTPETSDSGNIHGMPMAFLTRLAREEKKDLFGWMQDEHIVSTQKLVYIGLRDVDRGEKKLLRENGIKAFSMHDIDRHGIGRVVEMALAHIG--NDTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICEAVHETGNLIAMDLVEVNPSLESKGAS.................................. 305
77 0.000e+00UniRef50_A0A059WWP7 Arginase n=27 Tax=Bacteria TaxID=2 RepID=A0A059WWP7_9BACT  ali  33  21....GKRVSILGVPLGFGCSLPGVDIGPAAIRVARLSQRIAQLGYEVRDLGDMRIAPLYVAPPNESAKYLKEMTESCENLSVEVRDILRDGELPLIIGGDHSIAIGSIAGVAEREETLGLIWFDAHADMNTPETSPTGNIHGMPLSSLLGYGPPELTHIAGFA---PKLDPRLCAHIGARDIDLGERELIRKLGLRVITMREIDERGMSACIDEAIS-IASKASAGYAVTFDVDVMDPGDAPGSGTLVRGGLSYRESHLAMEKIAEAGGMLSLEVVEINTALDVNNRT----AELGVELILSALGKR............... 320
78 0.000e+00UniRef50_A0A293MDY4 Arginase (Fragment) n=3 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293MDY4_ORNER  ali  44  29.....KHIGVVGMPLAHGQRKAGVEEGPQFLRNAGVLDRLRALGHDVQDTGDIAVQGLPNVREGKVLEN-SLVGATARNVCKAVENVVSEGKMCLTLGGDHSCAIGTICGHAAAHSDVAVIWVDAHADINTTKSTSSGNMHGMPVSFLVHEMEPYTTRPSGLDWVQPCVHKESLAYIALRDVDSYERYFIDHLGITCYSMDDIDRYGIREVVQRALKKVNPTGSKSLHVSFDIDAVDEQIVRSTGTPVAGGLTVREALVIAEEISRTDSLRVLDMVEVNPRLGTSEE-RDRTLRCAVEIIASFFGSQRRGNLP......... 335
79 0.000e+00UniRef50_UPI000B87FB5A arginase n=1 Tax=Aliicoccus persicus TaxID=930138 RepID=UPI000B87FB5A  ali  39  3.....KKIDIIGANTAFGQPRLGVDLGPDAVRYAGLVSTLKGLNNEVEDKGNIS-PDLKVDEKVENLRNFNQVKEFSYALAKQVDASLENGRFPLVIGGDHSLSIGSIAGVAKHYDNLGVIWYDAHGDLNDGATSPSGNIHGMPLAVSLGLGHD---ELVNLYGDGAKIKHENVVLIGMRDLDDGEKEYIKENNIKLYTATDIRKLGIDTVIQEAIAYL-EDKTDAIHISLDVDALDPIHTPGTGTPVTGGLSLVDTQVTMETLNRNGKVVSMDLVEVNPLLDEKNRTAEVAVDIA----AFMFGKK............... 301
80 0.000e+00UniRef50_G0QWW2 Arginase n=1 Tax=Ichthyophthirius multifiliis (strain G5) TaxID=857967 RepID=G0QWW2_ICHMG  ali  38  15...KTKNIDIIGVCIKEGQNLTGTELAPDCLRKSGLNLVLEFLGWKINDLGNINLESQDELKYYTNMKHSETIGQACQQLHEKVKQSSQKSNFPLILGGDHGIATGTISGMLETYENLKVIWIDAHGDINLPETSPSGNYHGMPVAHLLGWFQKK---VKGFDWLKFKLKPENIVFIGLRDLDEEEKDLLNKNKIKCFCMHQIDQFGIGEVMKQAFKYLKIDEDQNLHLSFDIDAVDPSFAPGTGTKSKGGLTYREAHYICRSAAESGKLVSMELVEVNPNLDDKNIKGSKTVGLAIELIKSALGYT............... 352
81 0.000e+00UniRef50_A0A1Q3SWL5 Arginase n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3SWL5_9CHLR  ali  40  2......RVSIIGAPLALGQSKPGVGLAPAALRKAGLVEALTQLGHSVLDEGDLHFPSGTLHEAVTHVKYAREVGESCRIISEKVAERAKAGDFCLTLGGDHSIALGSIPGILTARPDTALIWVDAHGDFNTPETSPSGNMHGMPLAMVLGYASLKLPQFAWLQNEERKLTPDRVALVGVRSLDAGERHLLRDAGVNVYSMSEIDRYGIGQVMDRAMTAINGDGRRTFHVSFDIDSIDPSEAPGTGTLVKGGLTYREAHAILEMVAETGLLTSLDLAEVNPELDLNGQTTALGV----ELIASALGKS............... 329
82 0.000e+00UniRef50_N6UIJ9 Uncharacterized protein (Fragment) n=9 Tax=Hexapoda TaxID=6960 RepID=N6UIJ9_DENPD  ali  40  490......KVGLLGVPFEKGQTKKGVAAGPEAIRKLGLVERLEEIELDIKDYGDVCYTDLKEKDV-PNMKEYAHIAACNQQVSKTVEKIINEGRICVTLGGDHSLGVGTVDGHIKAKGNICVLWIDAHPDLNTNKTSSTGNVHGMPMALLAKELSDYWPYLPGMDWQKPVISLRHIAYIGLRSVDSYERLVIDKLGINAFGMEDIENYGIRTIVDMALNKIDPESNKSIHVSFDIDSLDSLEAPSTGTSVRGGMTLREGIQLMEIIHQTCRLGALDVVEVNPSIG-SEADVKRTVDAAIHVIAAALGHSRRGLSPRSGVLPPPK 813
83 0.000e+00UniRef50_A0A0N1PI57 Arginase-2, mitochondrial n=1 Tax=Papilio machaon TaxID=76193 RepID=A0A0N1PI57_PAPMA  ali  39  226.....KNVGIIGVPFEKGQKKYGVSVAPAAMRSAGLINHLQTIGLDVKDYGDIDTTTTEAEVKVDNMSHLSQVSACNKKLSERVSQVLKDGRVAVTIGGDHSIGVGTVDGHYKVNQDMILIWVDAHADINTNKTSGSGSVHGMPVALLVKELADYWPYLPTMDWQVPKFSIKNLGYIGLRSVDEYERLAIEKYNVPAFAMEDIEEHGIRKSIQHILNVLDPEMKKPIHVSFDIDSLDALEAPSTGTPVRGGLSLREAINLMEIIHATGRLRAIDLVEINPALG-NDYDRKRTIEAGLCVLKAALGFSRRG-TAPRGVLDLP. 540
84 0.000e+00UniRef50_A0A259SZ26 Arginase n=14 Tax=Bacillales TaxID=1385 RepID=A0A259SZ26_9BACL  ali  38  6.......ISIISVPFGYGAGRPGSEQGPDSILKFGLVKKLEQLGYDVDAGRRIQLPSSLKPYPVTHMKHVDQVMAICSQLAREAAAAASAGGVPLILGGDHSIAMGSLAGLSRRYPNMGVIWVDAHSDLNTEITSPSGNMHGIPLAAAFGLTQLKLTQVLSGAVH---LKPENCVIIGARDLDRDEKTLIRSRGITCFTMYEIDRLGIEHVVQEAL-RIAGTGTDGLHVSFDIDSVDPFEAPGTGTPVRGGLSYREAHLIMELMSESGLVTSADMVEVNPSLDRNNQTSKLAV----ELLCSLFGSR............... 297
85 0.000e+00UniRef50_A0A0D0HQ65 Agmatinase n=4 Tax=Anoxybacillus TaxID=150247 RepID=A0A0D0HQ65_9BACI  ali  25  31...KNYDVAIIGVPYDGGSYRPGTRFGPREIRSHSSLIRGYSYYSKSDLFSRLRIADYGDIDA-----SPYNIELTYKLIEDTIESILNENVFPVVIGGDHSISLGILRAVAKKYGPVGLVQFDAHSDTYD-GVYGTEYHHGTPFKRAIEEG---------------LIDPSRSLQIGIRGVSSTDLDYALQSGMKILMMDDINKKGISDVIKNI----EGLGKEPVYVSLDIDAVDPAFAPGTGTPVPGGFDSREIIQLVRSLKPL-NVVGFDLVEVSPPYDNNGITSLLASNLIYEFL...................... 304
86 0.000e+00UniRef50_A0A2B6LRW5 Arginase n=54 Tax=Bacillaceae TaxID=186817 RepID=A0A2B6LRW5_9BACI  ali  35  2....NKKVSILGAPTYFGASIGGVDLGPYVVRYGGMSKQLTEIGIDFVDLGDISLPSTNNKNYGIVKQEFSNVIDICKNIASTVENELEKGHFPLVLGGDHSIAIGTVTGILRKIPRLGVIWFDAHGDANTFETSISGNIHGMSLAILLGYGNEK---FKDFLEKETKIDPKNIVQIGIRDLDPGEEEFLKNLGVTIFTAEDVRKQGIKSIMEKAIKILN-NNTDAVHLTFDLDALDPEFAPGGGLAVPHGLSLDDTKEAIDMLRNNTNLVAAEFTEINPILDKDNITVNTTIELITELL...................... 294
87 0.000e+00UniRef50_A0A1I8IK30 Arginase n=5 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8IK30_9PLAT  ali  43  44.....KQVGIIGFPTNLGQPNSGVQMGPRAIRRSGLFESIEAMGIELVDYGDMRVTEVFPDPPKFGLRHPRTHAENAMNISQSLQVALNQGKILFCIGGDHSVSLGTVHGHAQVNKDMVLLWIDAHADCNTCLTSGSGNVHGMPLSFLINELQEFVPRMEEFDELRPCISFKDIAFIGLRDIDPGERYLLEKFGVTYYGMQEVDHLGIQEVVRRSLQEVNPGFKRPIHLSFDIDSLDPGFAKCTGTPVPAGLTLREGLYIAEEVHRTGCLKVVDLVEVNPDLGDPAQ-SEVTVNAAKEVIRACFGWQRAGIVPSNYQIPMP. 361
88 0.000e+00UniRef50_Q6FP31 Arginase n=12 Tax=Saccharomycetales TaxID=4892 RepID=Q6FP31_CANGA  ali  44  7..YKDRQLSLVLAPFSGGQGKLGVEKGPKYMLKHGLQKDLEELGWGTEIQSPLDEEEYNTQDQFGIIKRPQLVGEATELIYKSVTDVLSRDRFPVTLGGDHSIAIGTVSAALDKHPNAGLLWIDAHADINTLESSPSGNLHGCPVSFLLGLNKGKHESLKSLDWVPGKLKPNKIAYIGLRDVDSGERKILKELGIKAFSMYHIDRYGINTVIEMALEAIKDPESEPIICSYDVDSIDPLFVPATGTPVRGGLTLREGLFLAERLAETGNLISLDVVECNPDLAIQDIHVSNTISAGCAIARCALGET............... 319
89 0.000e+00UniRef50_A0A1A5YR96 Arginase n=5 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1A5YR96_9BACL  ali  34  2...REKGVRLISVPFWLGGGRAGVEYGPEDMMSAGLGRQIRNLGIRLDGDYEVCCPREGKLDPGPRIKYLPEIKEMSGLVGEQVYRAVSAKTFPIVLGGDHSVAIGTLAGLTGHYNRLGVIWFDAHGDLNTEATTPSGNIHGMVLAVAMGFSRFKLTDIPGAGT---LINKKNVVIIGTRDLDPGEKELIRSQGIACYSMHDIDKHGIAKVLEEAVA-IASDGTDGVHLSFDMDCLDPLEASGVGTPVPGGLSYREAHFAMELLAETGKITSMDLVEVNPMLDHDKKTTRLAV----ELTASLLGKK............... 298
90 0.000e+00UniRef50_A9B1J3 Arginase n=3 Tax=Herpetosiphon TaxID=64 RepID=A9B1J3_HERA2  ali  35  3.......IDLIGVPLDLGAGRRGVDMGPSAIRYAGLRSQLEELGHTVIDRGNLTASIAETLPVGDLLRYFEPIRDTLIQLASEVDQSCSQGHVPVVLGGDHSLGLGSVSGAA-HNRDIGVLWIDAHGDFNIPSTSPSGNIHGMPLAALCGYGDERLIHLSGQRLANSMINPHRVALVAVRDLDPEERQLLTEAGVQVFATEYIDRYGMYETMVRAIS-VANQARDGFYVSFDLDVLDPAVAPGVGTPVPGGLTYREAHLAAELIAESGRMIGLDIVEVNPILDDRNCTATVAVEIA----LSALGKRVWHKQHP........ 304
91 0.000e+00UniRef50_D1VUT9 Arginase n=5 Tax=Peptoniphilus TaxID=162289 RepID=D1VUT9_9FIRM  ali  38  2....NKKISIIGLPLDMGASIRGARLGPSTLRLNGLIRELKSLDLEIKDLGDIEVSSYEDQVGPKNLKNYQIVKEACTKLYNKVDEIIKTKNLPLVLGGDHSLAIGSVKAALNNYPDLGVIWIDTHGDINNEKISPSGNIHGMSLSAIMGL---ACEELSNIGQNKNFLKSQNLVYIGLRDLDKEERQVLKDYNIKAFSLQEIDEYSIGKVTKEALKYLNK-KTNHIHVSLDIDVVDPIYAPGTGTRKNGGLTPREIFLLTEILSKSDLITSVDLVEVNPLLDIKSQTSVLAIDIAK----SLFGEK............... 297
92 0.000e+00UniRef50_W4ZC46 Arginase n=4 Tax=Deuterostomia TaxID=33511 RepID=W4ZC46_STRPU  ali  45  1MASRLQSIGVLGVPINKGQDKDGVVYGPTVLRDAGLISSIQDLGHSVIDHGDLVFPAGDEETAVNGVKNAAFLGKALKKISKGVEDITKQDQLCVTLGGDHGITIGSLHGHTRSRPDLCVLWVDAHADINLPQASPSGHIHGMVLSFVCHELRHYLPKLPNFDWLDSCISCKDIAYIGLRDVDVGERYILEKHGIKIFSIHEVQKYGVAEVYARAMDMINPRGTRPVHMSFDIDSLDPGVSASTGTPVLGGLTYREGIYIAEEIAETGMLSSMDLVEVNPQLGTPSQ-QESTINAGVDVILAAMGKRKQGNVPVGYEILIP. 321
93 0.000e+00UniRef50_UPI0004409C3E Ureohydrolase n=1 Tax=Fomitiporia mediterranea (strain MF3/22) TaxID=694068 RepID=UPI0004409C3E  ali  50  9..PNPKTAAIVGCPFRGGQAKLGVDQGPIHLVNAGLIEQLKSLGWTVKFDGHHQFEEVNQDPPIGILKNPRLVSRVSKAVADVVGTHAGRGELPVTIGGDHSLAMGTISGTLKKYPDACVIWVDAHADINTVDTTESGNIHGMPVSFLLGL---NKPAVAEYSWIEPRLTPDRIVYIGLRDVDAGEKRILRENGIKAFSMHEVDKYGIGAVVEKALDHVNPDRKRPIHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICEAVHETGLLVAFDIMEVNPSL-ADVESAKATVAVGCSLVRSALGET............... 339
94 0.000e+00UniRef50_A0A151ADS7 Formimidoylglutamase n=214 Tax=Archaea TaxID=2157 RepID=A0A151ADS7_9EURY  ali  35  4......RIRVIGAPLDYGADRRGVDMGPSAIRYAGLAAELASSGRTSIDRGDLSVPRAEERDPNGSAKFVKEVRDVCERLSDEVADTLASGEFPLVLGGDHSIAIGSMQG-SSRDAEVGVLWFDAHGDFNTPETSPSGNVHGMPMAAALGHG-----SFADTDWANASIDPENVALVGLRALDEKERLAIRESPVTAYSMSDIDERGITAVTEEAVE-VASTGTEGVHTSLDLDWLDPKEAPGVGTPVRGGVTYREAHAALEIVANSGALRSLEVVEVNPILDSENETASLAVELA----ASALGKR............... 299
95 0.000e+00UniRef50_K5ABK5 Arginase n=8 Tax=Paenibacillus TaxID=44249 RepID=K5ABK5_PAEAL  ali  34  1MTSQERQLSIIQVPFGLGAGRRGAERGPECLMQSGLVRHLNQLGLAVDEEREVNCIAAAKAEAPGKAKYVPEVIAMSDALAEQVQAVVESGRFPLVLGGDHAIAIGTLGGLTQQYHKLGVIWFDAHADLNTEDTSPSGNVHGMSLAVALGRGSLTDGQ---WKWPGNHLDPKNVVLVGSRDLDPGERSYIREQGIACFTMHDIDRYGMLHVMQEAI-RIASDGTDGVHLSFDVDSLDPIEAPGTGTPVRGGVSYREAHLALELLHESGIVTSAEFVEVNPSLDTDNRT----ARLALDLIGTLLGDR............... 309
96 0.000e+00UniRef50_A0A1R0IKZ0 Arginase n=18 Tax=Bacteria TaxID=2 RepID=A0A1R0IKZ0_SULTH  ali  35  4.....KTVRIIGVPLDYGADRRGVDMGPSAIRYAGLHEKLRQVGHKVIDIGNLPVPVPESRTKNEHLKYADEIVKVSRVLARAVEKSLDEDNYPLILGGDHSIAIGTIAGLLRKFSRLGVLWFDAHGDYNTDQTSPSGNVHGMPVATAVGLGHPALKIPFH----GHFVDPHKIVYVGVRTLDADEAEALRHSGATVFSMHEIDRYGMRDVMAKAIDIVTDQ-TDGVHLSFDIDAVDPLYAPGSGTPYSGGLTEREAHLALELLAESDIVSSMEMVEVNPILDEHNRTGELAANL----IASALGHR............... 297
97 0.000e+00UniRef50_E6RA13 Arginase n=28 Tax=Fungi TaxID=4751 RepID=E6RA13_CRYGW  ali  49  64...KPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISGLGWNVHPYNPLPVQRLPDPDIG-NMKKPRLVSAVNEMVAKEVGDIAEKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTETGNLHGCPVSFLLGLDGCDVE--PFNKWLKPCLKPEDIVYIGLRDIDDAEKKILKENKIKVFTMHHVDKYGIGKVMELALQHINPSGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCLVALDIMEVNPSLDP--RSVEKTVAAGCSLTRASLGET............... 396
98 0.000e+00UniRef50_A0A146HNC2 Uncharacterized protein n=1 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HNC2_9AGAR  ali  52  6..............YAGGQPRPGVDKGPISLVEAGLIEQLADLGWQVNFDGHHQFEEVNADPPIGKLKNPRLVSRVTESVAKVVGGHAKNGELPVTLGGDHSLAMGTISGTLEQYPDACVVWIDAHADINTVETTDSGNIHGMPVSFLLGIG----TSVPEFAWVKPLLKADRLVYIGLRDVDAGEKRILKEHNIKAFSMHEVDKYGIGKVVEMALDHVNPKRDRPIHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICEEIWATGLLVALDLMEVNPSLDPA--SVQQTVTIGCSLVRSALGET............... 295
99 0.000e+00UniRef50_H3SNB4 Arginase n=12 Tax=Bacillales TaxID=1385 RepID=H3SNB4_9BACL  ali  35  6.......ISLLRVPYGKGGARPGAEQGPDALLEAGLVRHLSQLGLQTIDEGAVLPPSAQDSTSGTKLKHLEEIAALNSELADRVAEAAASGRFPLILGGDHSIAIGTIAGLTRHYRNLGVIWFDAHGDLNTEDTSPSGNIHGMSLAVNLDQGHPLLTRIRRQSSR---IDPAKVVIIGARSLDEGERAYIRQAGITCFTMHDIDRKGMPYVMEQAL-RILGDGTDGVHLSFDIDSLDPAEAPGTGTPIPGGVSYREAHLALEMMYESGLITSAEFVEVSPPLDSQKRTVRLAIGLIGSLLG..................... 297
100 0.000e+00UniRef50_A0A2E6DBT2 Arginase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2E6DBT2_9BACT  ali  32  2...KHKHIAFLGVPMDLGGGRRGVDMGPSAIRIADLGLAVSALGYEFEDWGNVPVRTPEDSKAVDKARFLDEIADCCSCLRDRILQMLEQEKFPLVVGGDHSIACGTLAGHHRRGEKVGLVWFDAHGDMNTPETTESGNIHGMPLASILGEGPD---ALTGLGERFPMVDLENVALVGVRSLDGGERRLIREMGVACFTMKDIDSHGIHDVMKQALAR-ATQGTAGFHLSFDMDGTDPEVAPGVGTPVPGGLTLREAHTVMELAAETGALLGLEITEINPILDVANKTAKHGA----DFVLSALGMR............... 302
101 0.000e+00UniRef50_Q6CLS8 Arginase n=47 Tax=cellular organisms TaxID=131567 RepID=ARGI_KLULA  ali  43  10..FQQKKLGIVLAPFSGGQPKSGVENGPKYLMKQGLRSDIESLGWETTLEEPLKGRDFDETDVYGIMKRPNLVGEATKLIYESVKKVSNEGRLAVTLGGDHSIAIGTVAGVLDKYPNAGLLWIDAHADINTCSTTESGNIHGCPVSFLMGLDAKNTP--PSLKWVPKCLDPKKIAYIGLRDVDAAERKILKDNGIASYSMYHVDRYGLNKVIEMALEKVAPNGDEPIMVSYDVDAIDPLYVPATGTPVRGGLTLREGLFLVERIAETGRLVALDVVECNPELASHDGHVVDTITTGCSIARCALGET............... 317
102 0.000e+00UniRef50_A0A224YTT6 Arginase n=1 Tax=Rhipicephalus zambeziensis TaxID=60191 RepID=A0A224YTT6_9ACAR  ali  45  51.....REIGVLGVPIHQGQPKPGVEKGPQFLRDAGLLDQLRDLGHEVKDFGDVSVEDPSVTDCG--ARNSDVVGKTNKNVRDAVAKVLGSGRVSLNLGGDHTLSIGSVSGHAQVDTEVALIWIDAHGDINTPSSSTSGNMHGMPLSFLVHEMAPYVVKPKGLEWVEPCIHKDNLAYIGLRDVDPYERYFMNHLGIRTYDMADIDRLGIRGVTQRILQEINPTGEKSLHISYDIDSIDKMIAPSTGTPVLGGLSLREALVIAEEVSKSGQLRVLDLAEVNPELG-SEQDARNTVDCGVRLVDSFFGSRRGGNLP......... 357
103 0.000e+00UniRef50_Q5KEH0 Arginase n=6 Tax=Agaricomycotina TaxID=5302 RepID=Q5KEH0_CRYNJ  ali  49  64...EPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISALGWNVHPYNPLPVQRLPDPDIGS-MKKPRLVSAVNEMVAKEVGDIAEKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTESGNLHGCPVSFLLGLDGCDVE--PFNKWLKPCLKPEDIVYIGLRDIDDAEKKILKENNIKTFTMHHVDRHGIGKVMELALQHINPNGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCLVALDIMEVNPSLDP--RSVEMTVAAGCSLTRASLGET............... 396
104 0.000e+00UniRef50_G7DU16 Uncharacterized protein n=1 Tax=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) TaxID=764103 RepID=G7DU16_MIXOS :  ali  51  649...QPAHVGIIGCPFSGGQPKAGVDIGPLQLIEAGLLDDIKGLGYGIVFDGQLEFEHSEADDPPGILKRPRLVSRVNKTVADTIEANARAGRLTLTLGGDHSLAMATVSGTFRVHPDACLIWIDAHADLNTPLTTESGNLHGCPVSFLLGL---EGCDIPEFSWIKPVLKADRLVYIGLRDIDAGERRILREQKIKAYSMHDVDKYGIGRVVEMALDHVNPNRDRPIHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICEAIAETGLLVSLDIMEVNPSLADKDA-VKQTVEVGRSLTRSALGET............... 949
105 0.000e+00UniRef50_A0A1F9TUQ3 Arginase n=1 Tax=Elusimicrobia bacterium RIFCSPHIGHO2_02_FULL_57_9 TaxID=1797943 RepID=A0A1F9TUQ3_9BACT  ali  34  2....KRKVAVLGVPLDLGASKQGTSGGPAAVRRAKLLEMLEDLGLAASDNGDVAVPKAAGRS-SSKLKNAAVILKVCRDLEKRVYDEVKGGHVPITIGGDHSLAVGTVTGVAKAYKKIGLIWVDAHADINTPETSPSGNIHGMPMAHILGMGSRDFARLGGFW---PKVEPRNLCLIGVRDVDKAEAANLRKSGVRVFSMQEIDRFGMGVVIEQAIDA-ASDGTAGFHLSFDIDVVDPGSAPGTGTAKRGGLTYRESHLLMELAADSERLLGLDMVEINPLEDVQNATAVLAA----ELVASAMGKS............... 299
106 0.000e+00UniRef50_A0A087TFD2 Arginase (Fragment) n=3 Tax=Entelegynae TaxID=74971 RepID=A0A087TFD2_9ARAC  ali  45  26......SVGILGAPFSKGQPKQGVDQAPDAFRKFGLIKELQSLGLDVKDYGNVLFEDENELSTYDKLKFPLTVGAACKKVSNAVKEVLSDNKKCITLGGDHSLGIGTVYGHSLVH-DMCVLWIDAHADINTAHTTLTGNIHGMPCSFLITELQKYQNKIPGFGWIKPCVRKSNIAYIGLRDIDAFEKLILTKEEIVHFTMRDIDKLGIFEVTHRALEAINPTGKLSLHVSFDIDSIDKLTTPSTGTPVIGGMTVREALCLAEEIARHGSLQALDVVEVNPMMGSSEQ-VQNTLNVAIMVIKTFMGYSRHG............ 327
107 0.000e+00UniRef50_A0A2R6Y3E8 Arginase n=1 Tax=Candidatus Carbobacillus altaicus TaxID=2163959 RepID=A0A2R6Y3E8_9BACL  ali  38  3.......IAILGVPLDLGAGRRGVDMGPSAIRYAGLNEHLRAIGHAVHDLGNIPVAPPRTSDAGDNIKWLKEVREANISLYEKLLETISDDQFPLVLGGDHSIAIGSLAAHRRHKKRLGVIWFDAHGDVNTPETSPSGNIHGMPLAVALGYGEPSLTAI----GDAPYVHPEDIALIGIRDLDPGEKIFLRKLGIRVFTMHDIDRHGMSRVMEEALDFVTRH-TDGVHLSFDLDALDPLYAPGVGTPVAGGVSYREAHLAMEMLAEADVITSADFVEVNPILDVENRTARATVRLIGSLLG..................... 338
108 0.000e+00UniRef50_P33280 Arginase n=87 Tax=Pezizomycotina TaxID=147538 RepID=ARGI_NEUCR  ali  44  44..SQPRDLGIVAVGFSGGQCKPGVDAAPSALIESGLLTQLR-EELGYRLHGDDEVHLYKEDPPHRNMKNPRAVSNVTKRIAEQVHSHAKEGRLVLTLGGDHSIAIGTIAGSAKAGREIAVIWVDAHADINTPETSGSGNIHGMPVSFLTGLASEDKEEFFGWLKPDHLLSVKKLVYIGLRDVDPGEKRILRENGIKAFSMHDIDKHGIGRVMEMALGHIG--NDTPIHLSFDVDALDPMWAPSTGTPVRGGLTLREGDFICECVHETGSLVAVDLVEVNPTLAPNDVGAHETVRAGCSLVRCALGES............... 356
109 0.000e+00UniRef50_A0A1U7LV01 Arginase n=5 Tax=Fungi TaxID=4751 RepID=A0A1U7LV01_9ASCO  ali  46  11....KRSLSVVGCPFSGGQHRSGVDIGPTTLVERGLINEIRTLGWDVEFTGHQAFAHLKPASDPDKLKNPRYVSSVTRAVADTVGQVCKAGRFPLIIGGDHSLGIGTIVGVMQKYPDACVIWVDAHADINTPETTASGNIHGCPLSFVTGLANPPTES---FAWVPKCLDFSRLAYIGLRDVDFHEKQFILENNIAAFSMHHIDKYGIGKVVDMALARVNPDLSRPIHLSFDVDGMDPSVAPSTGTPVRGGLSWRESMYICEALHETGCLVAMDIMEVNPSLANTPEEAEITISAGLSLARCALG................. 310
110 0.000e+00UniRef50_A0A067RBV6 Arginase n=4 Tax=Termitoidae TaxID=1912919 RepID=A0A067RBV6_ZOONE  ali  40  22LRRSHSKIGVIGVPFDKGQLKGGVGSGPEAFRNLGLIEELQGLGCDVKDFGDVTYEQIEGL-IVKNMTALGHIAACQKEVSDSVIRIINEGRMCLTIGGDHSCSIGTIDGHVKAKGNIALLWVDAHADLNTNATSPTGNVHGMPVALLAKELSDYWPYLPGMDWQQPRLSIRNIAYIGLRDIDSYERLVIDKFAITAFGMEDIERYGIIEVTNMALRRIDPNNNLPLHVSFDIDSLDALEAPSTGTPVRGGLTLREGIQVMEESYRTQRLSAVDLVEVNPGLGSP-TDVKITLEAAKHIIRAASGHSRRG-QSPENVLDLPQ 340
111 0.000e+00UniRef50_A9U7C1 Arginase n=3 Tax=cellular organisms TaxID=131567 RepID=A9U7C1_PHYPA  ali  38  6.......ISIISVPFGYGAGRPGSEQGPDSILKFGLVKKLEQLGYDVDAGRRIQLPTSLTPYPTTRMKHVDQVMAVCSQLAREAASAASAGSIPLMLGGDHSIAMGSLAGLSRHYPNMGVIWVDAHSDLNTEITSPSGNMHGIPLAAALGLTQLKLTQILPGAVQ---LKPENCVIIGARDLDRDEKTLIRSRGITCFTMYEIDRLGIEHVVQEAL-RIAGTGTDGLHVSFDIDSVDPFEAPGTGTPVRGGLSYREAHLAMELMSESGLITSVDMVEVNPSLDRNNQTSKLAV----ELLGSLFGSR............... 297
112 0.000e+00UniRef50_A0A2G8L6H2 Arginase n=2 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8L6H2_STIJA  ali  43  40.KTGKRSVGILGVPINRGQTNPGVLYGPAAIREGDLIKKIKGQWHEIHDHGDLGFDYVPEDDCADQPKNSHSLGRALQ------KTIVSAGEVCIVVGGDHSLSTGSIHGHSLAEPDICLLWIDAHADINLPMTSPSGNMHGMVLSFCVKELREYMPQIPGLEWLKPTISAKNIAFIGLRDLDAGEKYIIDQLNMTAYSIHDVDKHGLPEVLARSMDAINPRGNRPIHLSFDVDSLDPSVTPSTGTRVAGGLTFREGMYIVEEVANTGMMSAMDLVEVNPTIGTQA-DKERTIDCAIRLVGGALGKKREGEYPQNYQLPT.. 353
113 0.000e+00UniRef50_A0A268S6T6 Arginase n=7 Tax=Paenibacillus TaxID=44249 RepID=A0A268S6T6_9BACL  ali  35  5.SKEQRQVAVIKVPFGLAGARGGAELGPDELITAGLKREIARLGLVLTEEVRVDCPLVADTPIERNAKYLREVRQVSERVCTEVSRVVAGGVFPLVLGGDHSVAIGTIAGLTSHYSNLGVIWFDAHADLNTEERSLSGNMHGMSLAAALGHSAFNLSHIPGVG---PFINPSNLVYVGLRDIDEYEKEQIRAHGIKSFTMHDIDRMGIQWVVEQAVA-VAGKGSDGIHLSFDMDCLDPREAPGVGTPVPGGLNYREAHFALELLASTNRITSMELVEVNPLFDHNRHT----ARLGVELIASLLGKR............... 303
114 0.000e+00UniRef50_UPI0009E3E01C arginase-1-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E3E01C  ali  46  25.STKQKELFLIGVPFSGGQPRKGVEEGPARLRKQGLVSKIEKLGYRISDYGELQVPDIKNQYYNTLVKNPLECGAVSEKLSQEIAKASLEGKLSLTIGGDHSIAVGSVYGHASVTKDLGLLWVDAHMDINTSATTKSGNLHGMPLSMLIK-GIPEFQAIPGYEWCSPCLSPKDIAYIGLRDVEPQEREICEQLGIASYTIDDIDKDGIGEIIEKALEKINPNGDRPIHVSYDIDSLDPKETPSTGTPVRGGLTLDEGIYIAQIVAQTGCLSAVDMVEFNPAIG-TEEEVTRTAKNTMKLIQILLGKKSHLDKAPLPPVD... 343
115 0.000e+00UniRef50_A0A1H8FCQ7 Arginase n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1H8FCQ7_9BACL  ali  35  1MSKHRQPVTVLPVPFHHGASRPGADGGPQAVLQAGLMEKLKQLKRSATLLPPLEWQKLKDRRSMERMRNWGRVQTMNEDVAELVLAIAKSGAFPLTIGGDHSISIGTIAGLTQHIQQLGVIWIDAHADMNTPKTTPSGNLHGMALAASLGLGD---TRFTNMYGQNPKLQSKRVVLVGSRELDEGEKRNIYASGISCFTMHDIDRIGMARVMERAIA-IASYGSEGIHVSFDIDCVDPGEAPGTGTPVRGGLNYREAHLAMEMLYDCGRVTSADIVELNPSLDPSGRTARLAV----ELIGSLLGER............... 300
116 0.000e+00UniRef50_A0A136JZT8 Arginase n=11 Tax=Bacteria TaxID=2 RepID=A0A136JZT8_9BACT  ali  37  7....NKKVGIIGFPMDLGADRRGVDMGPSAIRYANLKKKLEALGYVVDDFGDIAVNILETQKIKNILKYLPEIERASKLLSEKVTSILDRKYFPLVLGGDHATAIGSIAGISSYCKKLGVVWIDAHADMNTEETTPSGNIHGMPLAIAMGLGYKSLIKINGFS---PKVDIENIAMIGIRDVDKLEAETIKKLNPIIYTMTDIDKIGIHRVISKVLGDFKKR-VDFIHISFDLDGIDPEYAPGVGTPVHGGLTFREAHLIMEMIAECGCMSSLEMVEVNPILDIKNETAELT----TELILSALGKNTLHR........... 310
117 0.000e+00UniRef50_UPI000B90ABDD arginase, hepatic-like n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90ABDD  ali  45  64......NIGVVGVPIHEGQKNMGVMYGPSVIREAGLMARFKQMGLEVVDHGDLKYESVEDKVQTGVLKSCRTLGRALHKLSDTVCSILKHDQACVALGGDHSLTIGSLHGHAQAEPDMCVVWVDAHADINLPQCSPSGNLHGMVLSFLVHELRDYMPTLAGFEWVKPCMSVKDIAYIGIRDLDECESYIMTQKGITCFTMHDVEKIGVAETLSRSLDKINPKGDRPVHLSFDIDSFDPYVAPSTGTPCSGGLTYREGLYIAEELGKTGLVNMIDMVEVNPELG-SHIEEEKTSKAAVNIICAALGETRMGYVPPDYQLPKP. 379
118 0.000e+00UniRef50_A0A2A4ZWH6 Arginase n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A4ZWH6_9BACT  ali  37  1MSQSGQPVEIIGVPLDHGSGRRGVSMGPSAXRIAGLRESLXRAEIXAHDXGDIDXPIPEVRDPGDSXKYLXVVEAACQLLAQRVXEALXQGRLPLVLGGDHSVAIGTISGVAQHLPRIGVXWFDAHADLNTPATSPTGNIHGMPLACMLGKGPX---SLTGIGFPGAKISSXRVIQIGLRELDPDEKRRINESEITAYTMEDIDRRGLPEVIEEALEKVQED-CDHLHVSFDIDVIDPRWAPGTGTARPGGLTYREAHLAMEMVAETGAVRSFELVEVNPILDEGNRTAEVAVGIIASXLGKSL.................. 309
119 0.000e+00UniRef50_A0A2G7LP63 Arginase n=46 Tax=Paenibacillaceae TaxID=186822 RepID=A0A2G7LP63_9BACL  ali  37  27......DVAIIKVPFGLGGARGGAELGPDELITAGLKREIASLGLNVSKEIRVDCPSESVVPIERNVKYLSEVKQVSERVCSEVSGAIARGSFPLVLGGDHSVAIGSLAGLSGHYSNLGVIWFDAHADLNTEERSLSGNMHGMSVAAALGHSAFNLSHIPGAG---PFVNASNLVYIGLRDLDVYEKEQIRALGIKSFTMHDIDRIGIQQVIEQALAVVGE-GTDGIHISFDMDCLDPREAPGVGTPVPGGLNYREAHFALELLASTNRVTSMDLVEVNPLFDQNRHT----ARLGVELIASLLGKR............... 320
120 0.000e+00UniRef50_UPI000C6C8A86 arginase-1-like isoform X1 n=2 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6C8A86  ali  50  59......NIGVIGMPIAEGQNKMGVEEGPTVLRKFGLIDKLKLLGHDVKDYGNVEVDRNKNVDAFIKNKNAEFVGTANKRLAEKVNKIIQDGKKCLTLGGDHSLAVGSILGHHHSKPNIGVLFVDAHADINTPETSYSGHIHGMPVAFIIKEMQKYIGTFPGFDWIKSCISKNKFVYIALRDVDPLERRFLQNLSIKYYTMREVDKLGIYNVICMALENINPHGNVPLHVSFDIDALDKAIVPCTGTPVSGGLTLREAVVIAEEVAKTGNLSALDIVEVNPKLGTP-QDLEMTVNAAIDIVSAFFYKDRIG............ 363
121 0.000e+00UniRef50_A0A1J1IEW7 Arginase n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1IEW7_9DIPT  ali  44  31.......IGIIGVPFDKGAGKVGTNEGPNALRDAGLIDEIRDINIDVKDYGDVHYETKSSGRRINNLRNLEHVAACNKALAEKIEEITNDNRMPIALGGDHSIAVGSITGLRRKMKDLCVLWVDAHIDLNTSSSSLTGNMHGMPVSLLVKELRKEWPTIPILEWCQAQMSLKNFCWIGLRSTDYYEKLMMEKYGINYFDMRDIERMGIEKVVQRALEKINLDGKKKLHVSFDIDALDPLYANSTGTPVMGGLTLREGVFLMEQAYNTGTLSSLDLVEVNPLLG-NERDVENTVNAAKLIIQAACGSNRTGN........... 338
122 0.000e+00UniRef50_F6X5U2 Arginase n=2 Tax=Ciona intestinalis TaxID=7719 RepID=F6X5U2_CIOIN  ali  43  42.....VKVGVLGVPMHFGQGKPGVRNGPKAIRDAGLLQRLSDHGLEVNDYGDLDIAHGAHVDDVSKIKNSRACGTANKKLADAVYNTLQTNDICVNLGGDHSMAVGSIFGHSQARPNLSVLWVDAHPDLNNPTTSPSGNIHGMPLHFLLKDLENKRTPISDFDWCKSCVSSPNIGFIAIRDIDPGEIAIMKRYNIPHCSIREIDRNGIAHCMEKILDMINPSGNRPLHVSFDIDSVDPGIAPSTGTPVRGGLSYREAMYVTEEVARTGSLSAFDLVEVNPELDPKR--AEATAEVAVDVITHALGLSIR............. 349
123 0.000e+00UniRef50_A0A1V5TJ19 Arginase n=7 Tax=Bacteria TaxID=2 RepID=A0A1V5TJ19_9BACT  ali  36  6....EQTVSIIGFPVDLGAGRRGVDMGPSALRIAGLESKLKALGYKVEDTGDINIEIMRQKIINPKLKYLDEILKTSKKLAARIEKVLEQNKFPLCLGGDHSMALGTLAGIASYCRKLGVIWIDAHADMNTDETTPSGNIHGMPLAASMGLGHPELVDFYGFA---PKLKPENCTIIAARSIDPEERINIKKLNPTVYTMSDVDKLGIHRIISRVLKQFKE-KIDHIHVSFDVDSVDPNFAPGVGTPVPGGLNYREAHLLMESIAECGCMSSLGVAEVNPILDVKNNSAKFAA----DLIASSMGQR............... 305
124 0.000e+00UniRef50_A0A2M4BS87 Arginase n=65 Tax=Neoptera TaxID=33340 RepID=A0A2M4BS87_9DIPT  ali  43  36INYE--RIGIVGVPFDKGQRKKGVGLGPKAIRDAGLIDHIQSPKLDIKDYGDIQYEALNNGRKVGNMKKLEHVASCNRNLSHQVTEVLDDERLCITLGGDHAIAVGSIDGHLHHSKEVAVIWVDAHADLNTNSTSPSGNIHGMPVALLARELSDYWPYIPGMDWQEPIISIKNLAYIGLRSVDPYERVIIEKFGINAFGMREVEKYGIREVMRMALERIDPEGKRSLHVSYDIDSLDVLEAPSTGTSVRGGLTLREGIYIMEEAYNTGRLAAVDLVEVNPAIGTPE-DVRRTVDAAVHLLVAACGHSRKGDIADTLDLIP.. 355
125 0.000e+00UniRef50_A0A1W6BKI3 Arginase n=93 Tax=Bacillales TaxID=1385 RepID=A0A1W6BKI3_9STAP  ali  40  2....DKTIELIGAPTTFGQKKLGVDLGPDAIRYAGALPRLKRIGHQVIDSGNVEAPRVDIESQQEGLQNYEEILTFSKALKDKVSESIRQNHFPVILGGDHSLAIGSISGVAEHYQQLGVIWYDAHGDLNVPEESPSGNVHGMPLRILAGEGDSQLVQLGGF---MPKVKPENIVLIGMRDLDYGERAYIKQHQIRTYTMADIDERGIRPIIEESIAYL-KDKTDGVHLSLDVDALDPNETPGTGTKVSGGLTYRESHYALELLNASGLITSMDIVEVNPLLDRENRTAEQAVAL----LGSFFGET............... 299
126 0.000e+00UniRef50_A0A163A0X4 Uncharacterized protein n=2 Tax=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) Tax  ali  48  8LSSQ--HVAIVGAPFSGGQPRKGVETAPAAMMNFGLANQLKELGWTVE-FQDNEQEIVELEPAQDNLKQPKFVSAVTEMISNQVRERALQGKFVLTLGGDHSIALGTVSGVFSAYPDACLVWVDAHADINTPGTTDSGNIHGCPLSFLAGIAEEH----PDFSWVKPCLKANRLVYIGLRDVDDGEKKILKELGIKAFSMHHVDQLGIGKIVEQALDYVNPDRNLPIHLSFDVDALDPSVAPSTGTPVRGGLSFREGHYICEALVNTGLLVSADIVEVNPVL-LDEESAFQTIQVGCSLARCCL.................. 307
127 0.000e+00UniRef50_UPI000718D7B9 arginase, hepatic isoform X1 n=1 Tax=Polistes canadensis TaxID=91411 RepID=UPI000718D7B9  ali  39  16......KVGLIGVPFEKGQQKKGVALGPKVIRDAGLTKELEVLGLDVKDYGDIIYKTVGTGDI-NNMTHLEDVAACTKLLSEQVQKILKDDRCVLTLGGDHSVSVGTIDGHVQAMEDIAVLWIDAHADLNTNKTSESGNVHGMPVALLTTELSDYWPHLPGMDWQKPRLSIRNVAYIGLRSVDRYERLVIEKFGIPAFGMEDVERFGIHNTISMALDKIDPYGVKSLHVSFDIDSLDPLEAPSTGTAVRGGLSLREAIHIMEEIHRTRRLNAIDLVEVNPHIG-DQRDVKLTVEAAIFIIQAALGYTRRGLKVPKGVTDMP. 357
128 0.000e+00UniRef50_A0A212EZZ8 Arginase n=10 Tax=Obtectomera TaxID=104431 RepID=A0A212EZZ8_DANPL  ali  39  11.....KRVGLIGVPFEKGQKKYGVSIAPAALRSAGLIERLKDIGLDVKDYGDIEVPSSERPVDVDNMAHLPLVSACNKNLSDKVSQVLKDGRVAVTIGGDHSIGVGTVDGHYKVNENMILIWVDAHADINTNKTSESGSVHGMPVALLVKELSDYWPYLPTMDWQVPKFSIKNLGYIGLRSVDKYERLAIEKYDVPAFAMEDIEDYGIHKSIDHVLQRLDPKGNKPIHVSFDIDSLDSLEAPSTGTPVRGGLTLREAIKLMEIIHATGRLRAFDLVEINPALG-NDSDRKRTIEAGMSVMMAALGFSRRGMTP......... 318
129 0.000e+00UniRef50_A0A2E8HX27 Arginase n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E8HX27_9PROT  ali  36  1MNNLXKTIKIIGVPSDLGANMRGSNMGPASLRIANLQXXIKQMGHQVIDLGDLNV-PVRESXPQXIIXNLEPLXXICKSLFKKTQESLQXGHLPLVIGGDHSISIGSISGVSEHYKKIGLIWVDAHADMNTPESSDSGNIHGMPLATILGXGH---SSLXSIGSXXKKVNPENVALIGIRNIDQNEKDVLKKSGIHYFTMREVDERGMYEIMKEAIEY-ASRDTEGXHVSFDIDGVDPLYAPGVSTAVKGGLSFREAHLILEMVAETKKVSSMDFVELNPFTDEGSRT----AELVVELIQSALGKS............... 304
130 0.000e+00UniRef50_E9GYN7 Arginase n=18 Tax=Pancrustacea TaxID=197562 RepID=E9GYN7_DAPPU  ali  47  23.....SKIGVIGAPFDKGQRKEGAALGPSSLRQSGLIKHLESIGCDVHDFGDIDYQPTREEGTVKNVRNMKDVIAFNEKLSQKVSQIIKDGRMCLTLGGDHSIGVGTVHGHLKAQPETSLLWVDAHADINTPVTSNSGNAHGMPLSFHIKELTEYQPEIPGFEWHSPMISARNIAFIGLRDVEPYERLIIEKLGMCALSMEEVHGIGIKEAVKYALSRIDPRNSRHIHVSFDIDALDPLEAPSTGTPVRGGLTLREGTELLRSVHRTGRLSAVDIVEVNPLLGSA..................................... 302
131 0.000e+00UniRef50_U3JRF6 Arginase n=54 Tax=Gnathostomata TaxID=35060 RepID=U3JRF6_FICAL  ali  61  41..........................................PGCQVHDFGDLNFTQVPNDELYNNLIYPRSVGLASQMLADAVSRAVAAGHRCVTLGGDHSLALGSVSGHARQCPHLGVIWVDAHADINTPLTTQSGSLHGQPLSFLLRELRDKVPQLPGFSWLKPCLSASDIVYIGLRDVDPAEYYILKNFDIQYFSMRDIDRLGIQKVMERTFEQLLGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYITEEIHNTGMLSAVDMVEVNPLLGASQEAVKATARLAVDVIATCFGQTREGAHIAFDELPTPS 321
132 0.000e+00UniRef50_A0A1X9M919 Arginase n=340 Tax=cellular organisms TaxID=131567 RepID=A0A1X9M919_9BACI  ali  42  1..............MDLGQVRRGVDMGPSAMRYAGLIEGIKELGFDVVDYGDITIHRSSNGSKEQNLKNLQEVIKTSEELCRDLDQILSKGGFPLVLGGDHSMSIGSIAGISKHYKNLGVIWYDAHTDLNTADTSPSGNIHGMPLAINLGLGHPLLTEIGGYS---PKVKRENIVIIGARSIDEGERELIKQEGIKVFTMHEIDRKGMTAVMEEAISYLKDR-TDGVHLSLDLDALDPVDAPGVGTPVLGGVTYRESHLAMEMLAESGMITSAEFVEVNPILDNKNQT----ADIAVELVASLLGKK............... 286
133 0.000e+00UniRef50_UPI0006B07DA2 arginase-1-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B07DA2  ali  48  59......NIGIIGVPFSKGQRKSGVEKGPLAIRDGGLLEKMQELGLNVKDLGDVEITEVPDENVQQLAIHSPTVGLVAKKVSEKVSQVLRDNYLCVTLGGDHSLGLGTIHGHSCVYPELSVLWIDAHADINTALTSPTGNLHGMSCSFVLHGLEDHKMPLSGFDWLKPCLHPEHLAYIGLRELDPLERLLVDKLGIPYFSMDDIDRLGIHEVIRKALKAINPRKDRSLHVSFDIDALDKFLVPSTGTPVIGGLTVREALCIAEEVAKTGLLKGLDLVEVNPLLGTKDE-VERTVAIAIQVIVAFFGQERLGP........... 363
134 0.000e+00UniRef50_W8ZQD6 Arginase n=16 Tax=Paenibacillaceae TaxID=186822 RepID=W8ZQD6_9BACL  ali  36  12LRSGQRKIQLIKVPFWLGGGRAGTELGPESIIEAGLKRQLKAMELELEWEVDVPGDAAEPAAPGCLMKHKAEVAEMAGLVGEKVYRSVSSGAFPLVLGGDHSVAIGTLAGLSGHYGKLGVIWFDAHGDLNHEGTTPSGNMHGMALAAAVGHGSFTLADIPGAG---PLIRPENVVLVGVRDLDPGEKEFIRSSGMTCFTMHEIDRMGIHAVMEQAIAA-AGRNTDGVHVSFDLDCLDPMQAPGVGTPVPGGLSYREAHYALELLAESGIATSLELVEVNPILDPARRTARAAVELA----ASLLGKR............... 312
135 0.000e+00UniRef50_A0A2U9CQU4 Putative HEAT repeat-containing protein 1 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9CQU4_SCOMX  ali  57 2087...................PRPGVERGPELIRAAGLLLKLQQQGCAVKDYGNLELEEPVDDEPVGRAKHVRAVGGANQRLSEAVQRVKRDGHTCVMLGGDHSLAIGSIHGHAAAVGELSVVWVDAHADINTPLSSPTGNLHGQSMSFLLHELQAKVPVLPNFSWIKPCVRARDLVYIGLRDVDPEEHHILKLLGVKVFSMSQVDQLGVARVMEETCDFLSDKVKKPIHLSYDIDAIDPSVAPATGTSVVGGLTYREGVYITEHLCQTGLLSAVDLVEVNPLRGRTERDVRSTVHTAVDLLLGCFGRRRQGSHPPDYRLPEP. 2388
136 0.000e+00UniRef50_P60086 Arginase n=60 Tax=Staphylococcaceae TaxID=90964 RepID=ARGI_STAAC  ali  39  2..TKTKAIDIIGAPSTFGQRKLGVDLGPTAIRYAGLISRLKQLDLDVYDKGDIKVPAVNIEKFHKGLRNYDEIIDVNQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNLGVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLEL-----NSNVIKPENIVLIGMRDLDKGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPGTGTRVLGGLSYRESHFALELLHQSHLISSMDLVEVNPLIDSNNHTAEQAVSLV----GTFFGET............... 300
137 0.000e+00UniRef50_A0A232EWS0 Arginase n=3 Tax=Neoptera TaxID=33340 RepID=A0A232EWS0_9HYME  ali  40  19.....SKVGIIGVPFDKGQRKAGVGEAPDIIRSAGLVNELQGLGLNVHDYGNVQYETASIN--VDNMPNLGDVAACTQKLSEMVQQSLRDGRRVLTIGGDHSIGIGSIDGHVKVDKDVAILWIDAHADLNTNKTSESGNVHGMPVALLASELADYWPYLPGMDWQQPIVSIRNVGYIGLRSVDRYERLVIEKFGITAFGMEDVERFGIHEVVNMALRKIDPDNNRSLHVSFDIDSLDPLEAPSTGTPVRGGLSLREGIHLMEDLYRTNRLNALDLVEVNPRIG-DKKSVDLTVEAAIHIIQAGFGYSRRGLKVPEGITDLP. 331
138 0.000e+00UniRef50_A0A284RTZ7 Arginase n=3 Tax=Armillaria TaxID=47424 RepID=A0A284RTZ7_9AGAR  ali  48  11...EPQTVAIIGCPFSAGQQRLGVDKGPIHLVEAGLTDQLAELGWRVTFDGHHQFEELSVIDDPPILRNPRFVSRVNESVAKVVGGHAARGELPLTLGGDHSLAMGTISGTLGTYPNACVIWIDAHTDINTPETTDSGNIHGMPVSFLLGLG----AKVPEFGWIKPLLKAERLVYIGLRDIDSGEKRILRENKIKAFSMHEVDKYGIGKVVEMALDHVNPKRDLPIHLSFDIDALDPSVAPSTGTPVRGGLTFREGHYICEAVSETGLLVAFDLVEVNPHL-EDESSVNKTVTVGCSLVRAALGET............... 311
139 0.000e+00UniRef50_S9X949 Arginase n=3 Tax=Euteleostomi TaxID=117571 RepID=S9X949_CAMFR  ali  90  1MSSKSKPIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECNVKDYGDLSFAEVPNDSPFKIVKNPRSVGRANEQLADVVAEVKKSGRTSLVLGGDHSLAIGSISGHARVHPDLCVIWVDAHTDVNTPLTTTTGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCVSAKDIVYIGLRDVDPAE-----------------------------------QKKRPIHLSFDVDGLDPSFTPATGTPVQGGLSYREGLYLTEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAIAVTLACFGVVREGNHKPIDYLDPPK 287
140 0.000e+00UniRef50_A0A0L8HZX3 Arginase n=1 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8HZX3_OCTBM  ali  48  65......KIGVIGVPLNKGQDKQGVELGPKALRDHGLITSLEDLGHRINDYGNIQFENIEEDDKQSLIKNGLFLSHASKKISNAVKKVIQAGEICLTLGGDHSLTTGALHGHVQVQPDLVIVWIDAHADINPPTASLTGHMHGMPLSFLIKEVQPYMNDVGPFDWVEPCLSAHDLVYIGLRDVDAEERWLIEKLGICTFSMQELDALGIAAVLKMALSTIDPEGKRPIHVSFDIDSLDPSVAGSTGTPARGGLTYRESLYIAEVIAQTGRLSALDIVEVNPLLGTQ-MEQEGTISVAKDFALTIFGKQRCGTLPP........ 371
141 0.000e+00UniRef50_A0A1E3PXJ3 Arginase n=17 Tax=Dikarya TaxID=451864 RepID=A0A1E3PXJ3_LIPST  ali  44  17..YGRKNVAILGCPFNGGQARSGVETGPLHVLEHGLEEQLQSLDWTITSCKNLTFTPPASDPDEGKLKRPRFVSESTHKVASEVADIIKSGSFPLTIGGDHSLAIGTVSGVFSQFPDACLIWIDAHADINTPASTPSGNIHGCPVSFVMGLADPCPPQ---FEWVKPLLKANKLAYIGLRDVDSGEREILKKHNIAAYSMHHVDKFGIGKVVEMALERVNPDGSAPIHLSLDIDALDPQHAPATGTPVRGGLSLREACYICEALAETGNLVSMDIMECNPVLGIDERSVTSTISAACSLVRCAMGET............... 318
142 0.000e+00UniRef50_J4GRK7 Arginase n=11 Tax=Fungi TaxID=4751 RepID=J4GRK7_9APHY  ali  51  12..PEPKTLAIVGCPFSGGQAKLGVDRGPIHLVQAGLPEQLSELGWKVLFDGHHQFEEIDADPPIGKLKNPRLVSRVCEAIAKVVGEHAKKGQLPLTLGGDHSLAMGTISGTFEQYPDACVVWVDAHGDINTAETTDSGNIHGMPVSFLLGLG----SKIPEFSWVKPLLKPERLVYIGLRDVDAGEKKILKENGIRAFSMHEVDKYGIGRVVEMALDHVNPKRDRPIHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICEAIYETGCLVALDIMEVNPSL-ADEAEVKQTVAVGCSLARSALGETLLGSP.......... 318
143 0.000e+00UniRef50_P53608 Arginase n=987 Tax=cellular organisms TaxID=131567 RepID=ARGI_BACCD  ali  41  2.....KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKARLHEQGDRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYS---PKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKER-TDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVAL----MGSLFGEK............... 297
144 0.000e+00UniRef50_UPI0009750BD8 arginase, hepatic n=5 Tax=Mollusca TaxID=6447 RepID=UPI0009750BD8  ali  52  37LHFGDRKVGVVGCPVHHGQAKPGTEHGPDALREGGLIKKLMGLGLDVHDYGDVGTPSHEDDHHFDLPKNPKHVATASENIAADVYNVIKSGRTCLALGGDHSMAIGSIFGHSLAEPEHVVVWVDAHADINTPLTSSSGNMHGMPLSFLVKELQPYISKLPGFEFIKPCLSAKNIAYIGLRDVDPGERYIIEKLGIQSFSMSEVDRHGIKDVVEKAMHYLDPEGVKPIHLSFDIDALDPSLAPSTGTPVPGGLSIREGNYICEELAATGRLTCVDIAEVNPSLG-NERDNLITVNSALSIITHCFGGRRQGTYPKNYQIPIP. 357
145 0.000e+00UniRef50_C3Z4T8 Arginase n=2 Tax=Branchiostoma TaxID=7737 RepID=C3Z4T8_BRAFL  ali  49  31....GRDVAIIGAPFKKGQRLAGVEQGPRVMREAGLIEKIRELGHNVEDRGDLNFEVFKD-DPKNYVLNPKAVGAATKKVSAAVEQAVRDNKLTVTLGGDHSISIGTIHGHAQAEPNLCLLWIDAHADINTPLTTPSGNIHGTPLSFLVNQLKDTWTALSPFDWLKPCLNITDIAFVGLRDLDPGERYILQKFNITSFSIHEVDRYGIHEVIARSLDAVNPKGDRPIHMSFDIDSVDPAVTGATGTPVPGGLTFREGMFIAEHVYRTGLLSALDLVEVNPEVGSR-QDKANTVMTAVEVLTACLGKKREGNLQPGYQLPLP. 347
146 0.000e+00UniRef50_H3CD43 Arginase n=3 Tax=Gnathostomata TaxID=35060 RepID=H3CD43_TETNG  ali  61  4...QARKVGLIGAPFAKGQPRSGVERGPDLIRAAGLLHRLQELGEEIHDYGNLTFEDIAEDEPVGGVKHVRAVGRANQTLSEAVRAVKMDGRVSVMLGGDHSLAIGSIHGHAAAVGQLAVVWVDAHADINTPLTTPTGNIHGQAMSYLLHELCSKIPTLPNFSWIKPCVSAKDLVYIGLRDLDAAEHYILKLLGVKVFSMTEVDRLGIARVMEETSEYLCARAKKPIHLSYDIDAIDPSVTPATGTPAAGGLTYREGVYITEHLCQTGLLSGVDLVEVNPFRGQTEHAIQSTVSTAVDLLLGCFGRRREGNHPADFILPEP. 322
147 0.000e+00UniRef50_A0A2K9IZI4 Arginase n=28 Tax=Bacteria TaxID=2 RepID=A0A2K9IZI4_VIRPA  ali  40  2....KSTISIIGVPMDLGQSRRGVDMGPSAMRYAGAVERLEALGYTLHDYGDIGITRPDKQETGRQLKNLPQVVEANEKLATMVDQTIKKGHFPLVFGGDHSIAIGSLAGIAKHYEQLGVIWYDAHGDLNTKETSPSGNIHGMPLAVSLGFGHELLTSIAGYS---PKVKPENIVIIGARSLDPGERELIREKGIQVYTMHEVDRLGMSNVIEKAVAYLSPR-TDGVHVSVDLDGLDPSEAPGVGTPVIGGMTYRESHLAMEMLAEAGIITSAEFVEVNPILDEKNKTATLAVGL----MGSLFGEK............... 298
148 0.000e+00UniRef50_A0A2P6MI27 Arginase n=2 Tax=Bacteria TaxID=2 RepID=A0A2P6MI27_9BACI  ali  38  2.....KKIALIGVPMDLGQMRRGVDMGPSVIRYAGVVERLEALGYEVEDRGDITIDRPGRVDVGDNLKDLQEVVKANERLSDEVARAVSEGKFPLVLGGDHSIAIGTLAGTSQKRKNLGVIWYDAHGDLNTGETSPSGNIHGMPLSVSLGLGHE---SLTGIGGTDAKVKPENVVLIGARSLDQGERDLIKEKGIRVYTMHEIDRLGMSRVMQEAMEYVN-DGTDGVHLSLDLDALDPHDAPGVGTPVVGGPTYRETHLAMEMLAESGMITSAEFVEVNPILDVKNQTAEAAVAL----IGSLFGEK............... 297
149 0.000e+00UniRef50_A0A265N654 Arginase n=3 Tax=Bacillales TaxID=1385 RepID=A0A265N654_9BACI  ali  42  7.........IIGVPMDLGQSRRGVDMGPSAMRYAGAIEKLQELNIDTHDLGDIPIPDQKNIDNDSNLKNLEQVIEANEKLAEMVDQEIEKGQFPLVLGGDHSIAIGSLAGVSKHYDNLGVIWYDAHGDLNSSETSPSGNIHGMPLAASLGIGHEKLTNLYG---NAPKIKPENIVIVGARSLDPGERELIRERGIKVYTMHEIDRMGMSKVIEETIDYLKDR-TDGIHLSLDLDGLDPSEAPGVGTPVIGGITYRESHLAMEMLAEAEVITSAEFVEVNPILDDKNKTATVAVAL----MGSLFGEK............... 298
150 0.000e+00UniRef50_W9BBN1 Arginase n=608 Tax=Bacteria TaxID=2 RepID=W9BBN1_9BACI  ali  41  2....KKDISIIGVPMDLGQSRRGVDMGPSALRYAGAIEKLEELDIKVHDLGDIPINRPSVINAENNLKNLDQVIEANEKLSEMVDKEIQTGNFPLVFGGDHSIAIGSLAGISKHYENLGVIWYDAHGDLNSEDTSPSGNIHGMPLAVSLGIGHDR---LTNIAAYTPKIKPENIVIIGARSLDPGEKGLIKEKGIKVFSMHEIDRMGMPAVMEEAIKYLKE-KTDGVHLSLDLDGLDPSEAPGVGTPVIGGLSYRESHLAMEMLAEAECITSAEFVEVNPILDEKNKTATTAVAL----MGSLFGEK............... 299
151 0.000e+00UniRef50_A0A160FD56 Arginase n=51 Tax=cellular organisms TaxID=131567 RepID=A0A160FD56_9BACI  ali  41  2.....KKISIIGVPMDLGQTRRGVDMGPSAIRYAGVVERLERLSYDIEDLGDISIERIDEEGIKSNLRNLKAVAEANEKLAQAVDEVIKKGHFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWYDAHGDLNTAETSPSGNIHGMPLAASLGFGHQ---ALTGIGGYSPKVKPENIVLIGARALDEGEKQFIREKGIRVYTMHEVDRLGMTKVMEETIAYLKER-TDGVHLSLDLDGLDPHDAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNPILDERNKTASVAVAL----MGSLFGEK............... 298
152 0.000e+00UniRef50_A0A2K6UPL6 Arginase n=17 Tax=Eutheria TaxID=9347 RepID=A0A2K6UPL6_SAIBB  ali  60  15..................TKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDIYNNLINPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYISEEIHNTGLLSALDLVEVNPQLATSEEEAKNTANLAVDVIASSFGQTREGGHIVYDQLPTPS 319
153 0.000e+00UniRef50_F8IL22 Arginase n=21 Tax=Bacteria TaxID=2 RepID=F8IL22_ALIAT  ali  41  2.....KDIHIIGVPSDYGQNRRGVDMGPSAIRYAGLKEKLERLGYEVSDLGDVPVPTPETRRIHQKLKYLREVVSVCEALCEKVEGVLKGGHTPVILGGDHSIAIGSLAGIARAGQPFGVIWFDAHGDMNTDETTPSGNIHGMPLAASLGLGHE---ALTGIGGVCPKVKPKNVVLVGARSIDPEERELIRQSGIHVFTMQDVDRRGMDAVMQEAI-RIASDGTRGIHLSLDLDALDPMFAPGVGTPVNGGFTYREGHLAMELLAASGKLLSVDVVEVNPILDHRNQTGRMAV----ELLESLFGKR............... 296
154 0.000e+00UniRef50_A0A1D5NTP7 Arginase n=74 Tax=Euteleostomi TaxID=117571 RepID=A0A1D5NTP7_CHICK  ali  59  21LSRRAHSVALVGAPFSRGQKRRGVDHGPATLRAAGLVERLAGLGCQLYDFGDLNFTQVPNDELYNNLIYPRSVGLASQVLADAVSRAVAAGHSCVTIGGDHSLALGSVSGHARQCPHLGVIWVDAHADINTPLTTQSGNLHGQPLSFLLRELQDKVPQLPGFSWLKPCLSASDIVYIGLRDVDPAEYYILKNYDIQYFSMRDVDRLGIQKVMERTFEQLMGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYIAEEIHNTGMLSAVDMVEVNPLLGASQEEVNATASLAVDVIATCFGQTREGAHTAFDELPTPS 343
155 0.000e+00UniRef50_O08691 Arginase-2, mitochondrial n=27 Tax=Euteleostomi TaxID=117571 RepID=ARGI2_MOUSE  ali  58  25......SVAIVGAPFSRGQKKLGVEYGPAAIREAGLLKRLSRLGCHLKDFGDLSFTNVPQDDPYNNLVYPRSVGLANQELAEVVSRAVSGGYSCVTMGGDHSLAIGTIIGHARHRPDLCVIWVDAHADINTPLTTVSGNIHGQPLSFLIKELQDKVPQLPGFSWIKPCLSPPNIVYIGLRDVEPPEHFILKNYDIQYFSMREIDRLGIQKVMEQTFDRLIGKRQRPIHLSFDIDAFDPKLAPATGTPVVGGLTYREGVYITEEIHNTGLLSALDLVEVNPHLATSEEEAKATARLAVDVIASSFGQTREGGHIVYDHLPTPS 341
156 0.000e+00UniRef50_P49900 Arginase, hepatic n=40 Tax=Euteleostomi TaxID=117571 RepID=ARGI_LITCT  ali  69  1MSERTKRVGVLGAPFSKGQARGGVEEGPIYIRRAGLIEKLEELEYEVRDYGDLHFPELPCDEPFQNVKNPRTVGQAAEKVANAVSEVKRSGRVCLTLGGDHSLAVGTITGHAKVHPDLCVVWVDAHADINTPITSPSGNLHGQPVSFLIRELQTKVPAIPGFSWVQPSLSAKDIVYIGLRDVDPGEHYILKTLGIKSYSMSDVDRLTINKVMEETIEFLVGKKKRPIHLSFDIDGLDPSVAPATGTPVPGGLTYREGMYITEQLYNTGLLSAVDMMEVNPSRGETERESKLTVNTSLNMILSCFGKAREGFHA......... 314
157 0.000e+00UniRef50_P78540 Arginase-2, mitochondrial n=128 Tax=Euteleostomi TaxID=117571 RepID=ARGI2_HUMAN  ali  60  25......SVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLINPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPS 341
158 0.000e+00UniRef50_A0A1S3G2H4 Arginase n=9 Tax=Bilateria TaxID=33213 RepID=A0A1S3G2H4_DIPOR  ali  82  1MSSKSKSVGIIGAPFSKGQPRGGVEKGPEAMRNAGLLEKLSKEGCDVKDYGDLSFDDVPNDMPFQIVKNPRSVGKATSKLAGVVEEVQRHNRVSVVLGGDHSLAIGSISGHARVHTDLAVIWVDAHTDINTPLTTTSGNLHGQPVSFLMRELSKQMPTVPGFSWVTPCISANDIVYIGLRDVDPGEHYIVKTLGIKCFSMTEVDKLGIGKVMEETLSYLLGRKSRPIHLSFDVDGLDPYYTPATGTPVVGGLSLREGLYIAEEIYKTGLLSGLDIMEVNPCLGKTSEDITRTVNSAVAITKACFGVAREGNHEPINYINPPK 323
159 0.000e+00UniRef50_H0WDG1 Arginase n=8 Tax=Amniota TaxID=32524 RepID=H0WDG1_CAVPO  ali  85  1MSSKSKSMGVIGAPFSKGQPRGGVEQGPSALRRAGLLEKLKEQECDVKDYGDLCFADVPNDAPFGIVKNPRAVGKATEQLASVVAEVQKSGRVGVVLGGDHSLAIGTISGHARVHPDLGVIWVDAHTDINTPVTTTTGNLHGQPVSFLLKELKGKTPEVPGFSWLTPCLSAKDIVYIGLRDVDPGEHYIVKTLGIKYFSMTEVDRLGIGKVMEEALAYLLGRKKRPIHLSFDVDGLDPSITPATGTPVVGGLSLREGIYIAEEIYKTGLLSGLDIMEVNPVLGKTPDEVTRTVNTAVAVTLACFGVARESNHDPENYLSPP. 322
160 0.000e+00UniRef50_F7B5B3 Arginase n=16 Tax=Bilateria TaxID=33213 RepID=F7B5B3_MONDO  ali  86  1MSSKPKSIGIIGAPFSKGQPRGGVEEGPAALRTAGIVERLEERECDVKDYGNLTFVDVPNDTPFQIVKNPRTVGKANEQLAGAVAEVKKNGRTSLVLGGDHSLAIGSISGHAKVHPDLCVIWVDAHSDINTPLTTTSGNLHGQPVSFLMKELKGKIPDVPGLSWVTPCLSAKDIVYIGLRDVDPGEHQILKDLGIKYFSMTEVDKLGIGKVMEETLSYLIGRKKRPIHLSYDVDGLDPSVTPATGTPVPGGLTLREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVNRTVNTAIAITLSCFGVAREGNHSAKR...... 316
161 0.000e+00UniRef50_Q2KJ64 Arginase-1 n=142 Tax=Vertebrata TaxID=1261581 RepID=ARGI1_BOVIN  ali  90  1MSSKPQSIGVIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKELECDVKDYGDLSFADNLDDSPFQIVKNPRCVGKASEKLADVVAEVKKTGRISLVLGGDHSLAIGSISGHARVHPDLCVIWVDAHTDINTPLTTKTGNLHGQPVSFLLKELKEKMPEVPGFYWVAPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVQGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTTVAITMACFGVAREGNHKPIDYLSPPK 322
162 0.000e+00UniRef50_A0A1S3AIV2 Arginase n=11 Tax=Gnathostomata TaxID=35060 RepID=A0A1S3AIV2_ERIEU  ali  93  1MSSKSKPIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKQQDCDVKDYGDLPFADVPNDSPFQIVKNPRAVGKASEQLAEVVAEVKTNGRISLVLGGDHSLAIGSISGHAKVHPDLCVIWVDAHTDINTPQTTSSGNLHGQPVSFLLKELKGKIPDLPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVPGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAVTLACFGVAREGNHKPIDYLNPPK 330
163 0.000e+00UniRef50_P07824 Arginase-1 n=193 Tax=Euteleostomi TaxID=117571 RepID=ARGI1_RAT  ali  87  1MSSKPKPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPTDYLKPPK 323
164 2.000e-98UniRef50_A0A1C3JG26 Guanidinobutyrase n=45 Tax=root TaxID=1 RepID=A0A1C3JG26_9VIBR  ali  25  27...QDVDIALVGVPFDGGTNRTGTRHGPREIRNQSSLMRIINQATGVAPFELCRVADVGDVLPD----SPFELVKAHQSIELFFKQIKASGALPIAAGGDHSISLPILRALAQ-DGPVALIHFDAHCDTGDNYFG-SKFHHGSPFKIAVEE---------------NLIDPKRTIQIGIRGSDKDMWRFSHETGMRVLYMDECVELGVEGILQQIKQTI---GDTPAYVTFDVDCLDPAFAPGTGTPEVGGFTSIEALQLIRGL-QDVNVIGADVVEVSPPFDPTGNTALVGATIMFELLC-IAAQSRQRNTVAKETCH... 319
165 2.000e-98UniRef50_C1AEL9 Arginase n=149 Tax=root TaxID=1 RepID=C1AEL9_GEMAT  ali  33  7.SPDRDAVRIIGVPMDLGASRRGVDMGPSAMRLADVADVIRRLGLSVTDEGNVRVPDRSEVPSSPLGR-IGAIALVAAELAARTANAVRHGTCPLVIGGDHSLSVGSVAGLAERGERVGLIWFDAHADINTPDTTLTGNVHGMPVAHLLGLGDERLSRLASV---TPAVRAEHLVYIGLRDLDEAEKHTIAQLGIRAFTMRDIDERGMRNVMDEAMQ-VVTHGTGGVHVSLDADFIDPREAPGVGTPVRGGVSLREAHLAMEIINDSRVMLAMDLVEINPILDRANAT----AELATDLVASAFGRR............... 307
166 3.000e-98UniRef50_T1FZK4 Arginase n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1FZK4_HELRO  ali  49  10............................................................DDRVSNVKRAKSVGKANEQIAKVVEQSISQNHFCVALGGDHSIAIGTIIGHARAHPNLAVVWIDAHADLNPPLASPSGNSHGMPVSFLLRELVEYIPDLPGFEWAKPCLGVKDIVYIGLRDLDEAEKALIEKHNILAFTMREVTELGVDAVVRAAIKYISPSGTRPIHLSFDIDGLDPTDAASTGTPVPGGLLLREGVYITESLAATGHLQMIDMVEVNPTLGSS-KEQVRTLQSACEIIGACFGKRNRKLMSPGYIIPKP. 270
167 4.000e-98UniRef50_Q12611 Arginase n=254 Tax=Eukaryota TaxID=2759 RepID=ARGI_EMENI  ali  43  13..SKPNQLGVVAVGFNGGQCKLGVEAAPMALVEAGLLDQL-RDDLDYEIHYDNTVHYYEEDPDHRGMKKPRAVSAVTETLSSQVYEHSKEGKFTLTLGGDHSIAIGSISGIAKAGREIGVIWVDAHADINIPEMSPSGNIHGMPMAFLTRLATEEKKDIFGWLQEEHKVNLRKLVYIGLRDVDRGEKKLLREHGIKAFSMHDVDRHGIGRVVEMALAHIG--NDTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLISMDLVEVNPSLEAVG--ASDTIRTGCSLVRSALG................. 320
168 5.000e-98UniRef50_Q90XD2 Agmatinase, mitochondrial n=34 Tax=Euteleostomi TaxID=117571 RepID=SPEB_CHICK  ali  24  55.SAEGLDAAFVGVPLDTGTSRPGARFGPQQIRAESVMVRRYNASTGAAPFDSLLVADVG-----DVNVNLYNLPDSCRRIRESYQKIVASGCVPLTLGGDHSITYPILQAVAEKHGPVGLVHVDAHTDTSDMALGEKIY-HGTPFRRCVDEG---------------LLDCSRVVQIGIRSYAPNPYKYCWDQGFRVVPAEECWMKSLVPLMGEVRQQM---GDGPVYISFDIDGLDPAYAPGTGTPEIAGLTPMQALEIIRGCKGL-NIVGCDLVEVAPIYDVSGNTALLGANLLFEMLCVLPG................. 336
169 6.000e-98UniRef50_A0A1E8Q752 Agmatinase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1E8Q752_9MYCO  ali  27  36......DVAVVGIPFDTGTYRPGARFGPSHIRQASRLLRPYNPELRVSPFAHQQV-----VDAGDMVANPFDIGVAVDQIDAQATELIDAGAKLVTMGGDHTIAYPLLRAHRRRYGPVALLHFDAHLDTWDTYF-DTPVTHGTPFRRAAEEG---------------LFVPGHSAHVGIRGYSPADLDDDAGMGFTVVHCAEFERTSTDAVIERLRAQV---GDRPLYVSVDIDVLDPAHAPATGTPEAGGMTSRELLAILRGLDGT-NLVGADVVEVSPAYDHAEITGVAAANLVYEFVSLLAGAAR.............. 316
170 7.000e-98UniRef50_A0A1Y6CN32 Arginase n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6CN32_9PROT  ali  37  1.........................MGPAALRIAGLKKKIEIQGYKVRDIGDLPVRDSLSQEIQD-EKFLQPLTQICEDLCGKTHNAVQSGNIPLVVGGDHSIAIGTISGIAKHHGELGVVWVDAHADINTPDSSPSGNIHGMPLATLMGDGH---PELCKIGGDGPKLKPENVALIGIRTIDDDEKRVLKASGVNYYSMRDIDERGMFRVMKEAIEKVSA-NTKALHVSFDIDGIDPRYAPGVSTPVSGGLTLREAHLLLEMLYETKKLGSLEFVELNPYTDVGAQSANLTV----DLILSALGKS............... 279
171 7.000e-98UniRef50_I6X7R8 Arginase n=121 Tax=Bacteria TaxID=2 RepID=I6X7R8_PSEPQ  ali  39  2......KLTLIGAPTDIGASVAGCRLGPGALRVAGIGKALRAFGVDVRDAGDVTGPPNPQSPPVDGYRHLPEVIEWNRAVRDAVAAELADGRMPVLMGGDHSLAIGSISAIARAGKKLRVIWVDAHADINTNELTPSGNIHGMPVACLLGDGPE---ELTGMSDRKPAIEVDNIRQVGLRSVDPGEKRVLVDKGLEVFDMRFLDEAGMRHAMERALHDI--DGDTHIHLSLDLDFVDPQVAPGVGTPVVGGPTYREAQLAMEMIADTGRLGSIDLVEINPALDIRNTTAELAVDLV----ESLFGKS............... 297
172 8.000e-98UniRef50_A0A2H5V381 Guanidinobutyrase n=1 Tax=archaeon HR02 TaxID=2035438 RepID=A0A2H5V381_9ARCH  ali  28  38...EGVDALFIGIPFDGGVFRSGARFGPASVRQASLLLRLYNPYLRVRPFDALNVADYGDIDT-----VPGNIEATYQSISRELGPIHARGITPLVCGGDHSITLPLLREASKVYGRLSLIHVDAHLDMVEQHFS-QKYTHGTVFRRAYEEG---------------LIDPYKSVHVGVRGYSEDEISSVESLGFRVIAMMSVEEMGIEAVCSEIKRI---AGGGPVYLSFDIDACDPSCAPGTGTPEVGGLTSREALKLLHGLAGLG-FVGFDLVEVAPPYDHGEITAYLAANIIYNFLC-LKAFTKKG............ 321
173 1.000e-97UniRef50_H3GHQ9 Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GHQ9_PHYRM  ali  43  355.......VSVIGAPMTYGQPLLGTDGGPDLLREAGLHKTLVDLGWSVEETGNLNVAPTRNDPTLDKAKQCFPVGNGTKQLYQVFQQKAGEGKLCLVLGGDHTIGAGSLAGLLSVHPDAGVIWVDAHADINTPTDSDSGNMHGMPIAFLMD-GMVDSSKIPGFEWNGPTMKPDQLVYVGLRDVDNFERRVIREKGIKAFTMQDVDRYGIGKTMEMALDHLCGKKQRPLHMSYDIDAVDPLVAPSTGTRVRGGLTWREAHYVAEAVAETNMLVGLDMVEVNPMLAP-GNGAQITVDMALLLISSALGNR............... 659
174 1.000e-97UniRef50_A0A132A0M6 Arginase n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A132A0M6_SARSC  ali  40  29...KNFHIGVIGVPFWYGQSKLGTNQGPDVLRSHGLINKLSELENRVIDFGNIKLNTLDSINIDRSLKNVLNLQQACLKTSRLVKNLIQNDFIPLMLGGDHSMAIGSVQAISETKQELSVIWIDAHADANTVQSSNSGNLHGMPVSFLVTQNLPTSSNDSPLDRMQPFLNAKNFVYIGLRDVEIQEYRLLKSYNICYYSMGDIDKLGINEVIARAFDAVDPLGKNKLHVSFDVDSVDKLFIPSTGTPVLGGLTIREVFTIAENIWRTKRMVSLDVVEFNPLIGNPNE-VDCSANNIIDIILMFFGKSRLG............ 344
175 1.000e-97UniRef50_UPI00036EC969 arginase n=1 Tax=Sporomusaceae TaxID=1843490 RepID=UPI00036EC969  ali  35  7...NKKGITVLGVPTWLGQEMFGTQLGPDAMRAAGLVRMLRSTGLDVIDAGNLNIKNQAITSCGTGSVNLRAVRDSLELVAIKVSEIVCSGRIPLVLGGDHSVAIGSLAGIARHYRALGLLWYDAHGDSNTPETSPSGYIQGMPVAASLGAGH---PELIAVGGYKHKIRQDHVVLVGVRDLDAGEKKFLREKNIKVYTSEDMYRRGSVAVMEEAVAYLSSR-CDGIHLSCDLDVLDPKEASGVGTPVAGGLPLAQHLEAMRCLASHKVVTSAEFVELNPLLDKDGRTIEAAIAMIRAFLG..................... 301
176 2.000e-97UniRef50_A1WGI6 Arginase n=3 Tax=Proteobacteria TaxID=1224 RepID=A1WGI6_VEREI  ali  35  18.RPAHRPIALIGAPTDIGAGVRGASMGPEALRVAGLQAALQGHGLQSFDRGNLSGPANPWQAPVQGYRHLPEVVQWNQRVFDAVSAELRLGHLPILLGGDHCLGLGSISAVARHGQPLRVLWLDAHADFNTSALTPSGNLHGMPMACLCGLGPGPLTQAGGMPGGGPALRAQQIRLIGVRSVDPGEKRLVHQQGLEVFDMRYIDEAGMRQTMQQALAGLDA--DCHLHVSFDVDFLDPDIAPGVGTPVPGGPGYREAQLCMEMIADSGRLASLDIVELNPALDLRNRTALLAVDLV----ESLFGKSTLMRVPPPE...... 331
177 2.000e-97UniRef50_Q9I3S3 Guanidinobutyrase n=1979 Tax=root TaxID=1 RepID=GBUA_PSEAE  ali  24  39......DAAFVGVPLDIGTSRSGTRFGPREIRAESVMIRPYNMATGAAPFDSLNVADIG-----DVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFGE-KIAHGTTFRRAVEED---------------LLDCDRVVQIGLRGYTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKV---GGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLD-LIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVRR............. 319
178 2.000e-97UniRef50_A0A0D6GSR1 Agmatinase n=182 Tax=cellular organisms TaxID=131567 RepID=A0A0D6GSR1_MYCSM  ali  25  44......DIAVVGVPFDSGTYRPGARFGPSAIREASRLLKPYHPALDVSPFAQAQV-----VDAGDLGVNPFNIDEAVGQIRDGVTELLDRDQRVVLLGGDHTIALPALQAMHAIHGPVALVHFDAHLDTWDTYFGA-PCTHGTPFRRASELG---------------LIVKGHSAHVGIRGYDRADLLDDESLGFTVVHCRDIDRIGVDGVISRIHERVGEY---PVYVSIDIDVLDPAFAPGTGTPEIGGMTSRELVAVLRAMRGL-NIVGADIVEVAPAYDSGDVTAVAAANLAYELITLM................... 319
179 4.000e-97UniRef50_A0A2X0PE90 BQ5605_C021g09361 protein n=2 Tax=Microbotryum TaxID=34416 RepID=A0A2X0PE90_9BASI  ali  47  14........GIVGCPFSGGQPKEGVDTGPRQLIEAGLLDDIKTLGYHVEFEGDQPDPDIGIRSLSDQLINDELHFQVTQELADKVFAHASKGHLTVTLGGDHSLAMGTVSGTFRAYPEAALIWIDAHADINTPLTTPSGNLHGCPVSFLMGLPGTSPQEIPEFGWCKPVLKPSRIVYIGLRDIDSGERKILKENNIKCFSMFHVDKYGIGKVVDMALEHVGR--DRPLHLSFDVDAMDPEVAPSTGTAVRGGLTFREGHYICEGLAETGNLVSLDLMEVNPSLG-DDLSVAQTISVGRSLVRCALGET............... 363
180 4.000e-97UniRef50_D2RZ41 Arginase n=3 Tax=Halobacteria TaxID=183963 RepID=D2RZ41_HALTV  ali  34  13.SAVSSDVAVIGAPIDIGGNCRGADLGPAAIRHAGLEDALSEAGVSVTDVGDVPVSETGTEPV-------DAIQSTTAAIADRVAETLQQGARPLVLGGDHSIAIGTLRGTARNAKS-GVIWFDAHGDYNTPTTSPSGNFHGMPLAAAHGHRDFADADW----SIAPSIPEENTVLVGLRSLDEQERDALRRADVTAYTMVDIDDRGISEIVDEAID-IAASGTDGVHVSLDLDWLDPRAAPGVGTPVPGGATEREAHLALERLAERDALRSMDVVEVNPLLDDENTTAEAA----TDLIASAFGNR............... 305
181 4.000e-97UniRef50_A0A151MJ81 Serine/threonine-protein kinase PINK1, mitochondrial n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151MJ81_ALLMI  ali  26  566.SAEGLDAAFVGVPLDTGTSRPGARFGPRHIRAESVMVRRYNPSTRAAPFHSLMVADLG-----DVNVNLYNLQDSCRQIREAFRKIVATGCIPLVLGGDHTITYPILQAVSEKHGPVGLVHVDAHTDTGDKALGEKIY-HGTPFRRCVDEG---------------LLDCKRVVQIGIRSYSPDPCKYSRDQGFRVVLAEDCWMKSLVPLMGEVRKQM---GDKPIYISFDIDGLDPAFAPGTGTPEIAGLTPAQALEIIRGCKGL-NIVGCDLVEVAPIYDASGNTALTAANLLFEMLCAL................... 845
182 4.000e-97UniRef50_N0DY31 Arginase n=12 Tax=root TaxID=1 RepID=N0DY31_9MICO  ali  35  2.....KPVSLIGAPTDIGASVIGARLGPGALRVAGIQRALENFGNNVVDRGDLTGPDNPMLPPVDGYRHLPEVIAWNQTLHDAVFAELEGDRLPITLGGDHCLAVGSISAVRAAGKKVLVLWFDAHADFNTASITPSGNLHGMPVACLLGHGPDGLTSMAG---ATPAMRHDEVRQVGLRSVDQGEKELLHEVGVECYDMRYIDEKSMRKVMQKALAGVDE--DTHVHVSLDLDFIDPVVAPGVGTPVVGGPTYREAQLCMEMIADTGQLGSIDIVELNPALDQRNATAELAV----DLLESLFGKS............... 297
183 5.000e-97UniRef50_A0A132HTU6 Arginase n=537 Tax=root TaxID=1 RepID=A0A132HTU6_9BURK  ali  34  2.....KPVTLIGAPTDVGASIRGASMGPEALRVADIAGALVRNGLDVTDLGNLVGPGNPNLPPTDGVRHLPEVVAWNRLVMDAAYQALATGQLPLLMGGDHCLAIGSVNAAARQGKKLLVLWLDAHADANTGSTSPTGNTHGMPVACLCGDGPAPLVSL---GGVTPATSPRNIRQIGIRSVDAEEKKRLRELGLTVYDMRYIDENGMRATMEQALAGI--DGDTHLHVSFDVDFLDSQIAPGVGTAVRGGPTYREAHLALEMIEDTGALGSIDVVELNPARDVHNQT----AELVVELLESLFGKS............... 298
184 7.000e-97UniRef50_E1BLC0 Agmatinase n=53 Tax=root TaxID=1 RepID=E1BLC0_BOVIN  ali  23  76.TPEGLDAAFVGVPLDGTSNRPGARFGPRRIREESVLLRTTNPSTGAVPFQFLRVADLG-----DVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDHTITYPILQAIAEKHGPVGLVHVDAHMDMADKALGEKLY-HGTPFRRCVDEG---------------LLDCKRVVQIGIRSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQM---GGRPIYISFDIDGLDPAYAPGTGTPEIAGLTPSQALEIIRGCQGL-NVVGCDLVEVSPPYDPSGNTALVAANLLFEMLC..................... 353
185 7.000e-97UniRef50_UPI000A2A8DAD arginase-1-like n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A8DAD  ali  43  17LSSXGSKAVIINVPFSGGQPKGGVDLAPDFIRDLGFYDRLRNLGLNVSTASDINLDYLDSESHNKMVKNPVTCGNVSKQTAQAVLHALKEGKMPVVIGGDHSIGTGTAFGHHLFNPDTCLLWVDAHADINSPLVTKSGNIHGMSVSWII-TNFPHFPVVPGYEWVHRCISPQKIAYVGLRDVEPQERDLLNKLGIKTFFIEDIDELGIVLTMEQALDYINPRNDCPIHVSFDIDAMDPEIAPTTGTSVRGGLTLSEGLYIAQKISQTGHLQGLDLVEINPKLG-DGIEALQTAKTGMAIVEAMLGK................ 327
186 1.000e-96UniRef50_W4FKT9 Agmatinase n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=W4FKT9_9STRA  ali  23  166......DVAILGLPYDSGTYRPGARFGPSAVRQASRILRPYHTTLKVN-----AFHDQQCVDAGDVCCNPFNVTETMTTVVDHVSELLQLPSRPVAVGGDHSISYPLLKAHCEAYGPVALVHFDAHLDTWDAYFGET-HTHGTPFLRAAEE---------------HLFRPDASMHVGIRGYSSDDYARDATLGFSMLNMDAIEDMGVAGVVKQIRDRV---GQHPIYLSIDIDVLDPAFAPGTGTPEAGGLSTRELFGMLRGLRGL-NVVGADVMEVAPAYDHAEITALAAASIVFELISLM................... 442
187 1.000e-96UniRef50_A0A197K7D3 Arginase n=1 Tax=Mortierella elongata AG-77 TaxID=1314771 RepID=A0A197K7D3_9FUNG  ali  50  11....KQSVGVIPVPFSGGQKREGVDHGPVKIIEFGLLDQLKELGWAVHFDGYRDYTQLRPDPPVGKLLNTRYVSAVTESVAGSVQAQLERGALALTLGGDHSVALGTFSGTARVYPDAALIWVDAHADINTPETTDSGNIHGCPVSFLLG----IAGHVQELSWVKPCLTPDRLVYIGLRDVDAGEKKILKQLGIMAFSTHEVDKFGIAKVVQMAIDHVSPNGSRPIHLSFDVDAMDPSVAPSTGTPVRGGLTFREGHYIWRQFMRRG...................................................... 272
188 1.000e-96UniRef50_A0A2M8PV55 Arginase n=9 Tax=Bacteria TaxID=2 RepID=A0A2M8PV55_9CHLR  ali  34  7.......IKIYGIPMDLGQNRRGVDMGPSAIRYAGLQSRLQRLGCQVIDSGNLTVPVVEEIDANGQAHHLNVIAEVCQRIYETAAHCIEADERAIFLGGDHSIAIGTIAAILERPQKVGIIWVDTHADFNTPQTSPTGNVHGMVVSSLMGLGPDVLH------IGKHHLQTEQIVMIGIRDLDSEERVALRESGIKVQTMRDIDEHGMAAIVQDALNYLGD--VDVIHVSFDMDSLDPSVAGGVGTPVPGGLSYREAHLLMEMLADDGRVQSLDVVEVNPILDEHNHTAEVAV----DMIASLFGQR............... 298
189 1.000e-96UniRef50_Q6WVP6 Arginase n=4 Tax=Schistosoma TaxID=6181 RepID=Q6WVP6_SCHMA  ali  44  26.........FLGIPTNRGQPKIGTYQGPELIRKSNFFQLVAEDGIQLTDCGDIIPVELNEAEDPQGMKWSRSFSLTTLRIAERVEELMKQKSTPLVIGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSASGNMHGMPLSFLVKELQDQIPWLDDFEGIKPCLNASNIAYIGLRDLDAHETHDIRKHGIAYFTMLDVDRMGIEAVIKEALLAVNPRLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATGKLSVVELAELNPLLGSQE-DVLKTQSSAVHILRACLGHCRSGHLP......... 342
190 1.000e-96UniRef50_A0A1Q7L3V1 Agmatinase n=22 Tax=Bacteria TaxID=2 RepID=A0A1Q7L3V1_9BACT  ali  23  39..PRELEVALIGVSFDGGTYRPGPRFGPRHIREQSAIIRPWNPVLKVN-----PFAKHRTADFGDLSVNPLSIEDTFGRIERGIRPLLDAGVRCVCVGGDHSISLPILRAVAKKHGAVSLIQFDAHNDLWDEYFG-SKYSHGTPFRRAFEEG---------------LLQDGDVLQVGLRGYGEEDFDFARVHKVRMVTAEEFHEKGMATV----RSHLRAFRRKPVYVTLDIDVVDPAFAPGTGTPQVGGLTSVQILELVRALRGL-NIVGCDLVEVSPPYDNGEITSLLAANLLFELLC..................... 314
191 2.000e-96UniRef50_A0A174CXY6 Arginase n=10 Tax=Clostridium TaxID=1485 RepID=A0A174CXY6_9CLOT  ali  34  2......NISIIGMPLFYGCDKPGVEKGPEELRKNNL-IDIFEKNHNVYDLGDIEVEKVSEKEKYKGLKYLTQVVNANNGLASKVLEALENDTFPFIVGGDHSLALGSLAGASKYFGDLAVIWIDAHGDINTDKTSPSGNIHGMPLAASMGYGYEKLTSIF---FDKAKIKPENVFILACRDLDKGEVDLINELNMHVWTNEQINNLGTKEVLNQLLSLIKEKNIKNIHLSYDIDCLDPDYVPGTGTPVSDGLSYSQSKELLQGIMSTSLVSSMDFVEYNPDLDKNNKTKETCVELL.......................... 291
192 3.000e-96UniRef50_A0A1E4LJ13 Arginase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1E4LJ13_9CLOT  ali  33  2....KRSIDIIGIQMDLGASKRGVDMGPGAIRHAGLLSKLKLLGYEACDRGDV-IPLRPEHFGSSRMRNCTEISEANARLFHMVRESLQNGAMPIVLGGDHCVAAGSISAVNAEIGPVGVIWIDAHSDFHNADSTPSGNMHGMPLSAVCGLGP---HEMVAFAEPFCPIDPKNVALVATRDMEENEKARLRASGAHVFTMQDIDRLGMAEVMRRAIA-ITSENTRAVHVSVDIDAVTPERAPGVGTPVHSGLTVREAFLAVEMLSESGVVCSMDLVEVNPMLDVCNRTGELA----CELILSVLGKS............... 295
193 3.000e-96UniRef50_A0A2P2BYP6 Guanidinobutyrase n=6 Tax=root TaxID=1 RepID=A0A2P2BYP6_9ZZZZ  ali  23  36.....ADVAVLGVPFDSGSFRPGARFGPGAVRAGSKLLRPYHPHLDVEPWSVLQVA-----DAGDAAVNPFDLDEAIRQIEAAAEATYEHADRLIAIGGDHTIALPLLRAAHRRHGPIAIVHFDAHLDTWDTYFGA-PYTHGTPFRRASEEGLLVLDHASHVGTRGPL-------------YSRTDLEDDRKLGFATVSSEDLARRGVDEAIDRIRERV---GNHPVYLSIDIDVLDPAHAPGTGTPEPGGLTTRELQMILRGLTDL-EIVGADVVEVAPAYDHAELTTIAAANVVYEYLALFALQAEAGRPR......... 321
194 4.000e-96UniRef50_A0A0H3J433 Arginase n=86 Tax=Bacteria TaxID=2 RepID=A0A0H3J433_CLOPA  ali  28  3.......VNMIGVPLFYGSDKKGVDCAPNKLRENNIIDVIHNDNHEIYDCGNIFVPKVDENTYNSRMKYLKPIIDVNTNLAHEVYSSFTSGSFPFIIGGDHSLGLGSISGASKYYKNLAVIWVDAHGDINTDETSISGNVHGMPLAAAMGIGPQSLTDLYFKGI---KVKYKNVFIVGARSLDSGEFSLVQEKGLNVYSMENIKNMGIESILKEIHHKLMENGIEAVHLSFDIDCLDPSIVPGTGTPVTDGMSVEDAKFLLKYLMNTKLIKSMDMVELNTLLDRNDSTTKLVIDLV.......................... 291
195 4.000e-96UniRef50_C9YF30 Uncharacterized protein n=1 Tax=Curvibacter putative symbiont of Hydra magnipapillata TaxID=667019 RepID=C9YF30_9BURK  ali  36  354......KISLIGAPTDIGAGSRGASMGPEALRVANITSVLQSHGLEVLDKGNLSGPSNPWQPPVNGYRHLPEVTAWNRSLHDAVYAELQDGRLPIVLGGDHCLGIGSISAVARHCRDTGVLWLDAHADFNTNTLTPSGNIHGMPVACLCGFGPQ---ELIEIGGQVPAISPKWVRQIGIRSVDEGEKRFVHEQDLEVFDMRYIDEMGMRAAMELALALIDS--NTHLHVSFDVDFLDPDIAPGVGTTVRGGPTYREAQLCMEMIADTGRMASLDVFELNPALDERNRTAEVAV----DLIESLFGKS............... 649
196 6.000e-96UniRef50_C5LR61 Arginase n=2 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5LR61_PERM5  ali  40  21...EPRTLVMIGAPISEGQYDSGVAKAPQALRDGGLSAVVEEVGWGFEDRGDLDLDQLADTPVPNKIKNCEKIGRACGHIFDAVYNAANEGKFVLTVGGDHSLGCPTIAGVMRARPNACVVWVDAHGDCNHPETSPSGNYHGMPAAHAMGWFEKRARGFEWMDHLSHPLKEDRIAFIGLRDIDPEERRLLRQSKVKCFTMTDVDRLGISAVMEEALKQINPRGDRPIHLSLDIDGIDPVIAPGTGTKAKGGLTYRESHYICERLAMTGQLGSMDLVEINPVMD....................................... 319
197 7.000e-96UniRef50_A0A1G9ZRE4 Arginase n=1 Tax=Paenibacillus sp. yr247 TaxID=1761880 RepID=A0A1G9ZRE4_9BACL  ali  30  13...KPKKLSLIQVPFGLGAGRPGSELGPESMLQSGLIRQIRNLGLELAADHQVDCPDHKVPSSGKKVKYISEVKEMSGLVAEQVSQAAAGQTFPLVLGGDHSVSVGVVAGLTSHFSNLGLIWFDAHGGLHTEETTSTGKMNEMSLAAILGEGGSQLADMSGIDAP---IKKEHLVIIGTRELDSCERELIRSKGITCYSMHDIDRMGIQNVIEKALQ-IAGNGTDGIHLSFDADCLDPLEAPGVGSPVLGGLSYREAHFALELLAESGRITSMDVVEINALLDVDRRTARLAVGL----IASLLGKR............... 309
198 7.000e-96UniRef50_G5DZ37 Arginase (Fragment) n=4 Tax=Euteleostomi TaxID=117571 RepID=G5DZ37_9PIPI  ali  70  1........GVIGAPFSKGQPRGGVEEGPKYLRNAGLIEKLEELDYEVRDYSDLEFADVAQDEPFQNVKNPRTVGLATEKLANTVTEVKKAGKTCLVIGGDHSLAVGTIAGHAAVHPDLCVVWVDAHADINTPYSSPSGNLHGQPVSFLMKELKNKVPAVPGFSWVKPCLSAKDIVYIGLRDVDPGEHYILKNLGIKFYSMSEVDNLRIDKVMEETIEYLEG----------------------------------------------KLLSAVDIMEVNPSRGETERDVKLTVKTALDMTLSSFGKAREGFHAAT....... 261
199 8.000e-96UniRef50_A0A1R0GTL0 Arginase n=2 Tax=Smittium TaxID=4888 RepID=A0A1R0GTL0_9FUNG  ali  41  13...NPSSVGIIPTCYDGGQKKSGVDIAPGEMLKAGLATQIEKMGYSVNVLPDEDCPESEISVEGSNVLNLVWTSNVCKAHAARVEEQCRLGNFALSLGGDHSLALGTITGSSRVYGDLCIIWVDAHTDINTLSTTDSGNLHGCPVSFLLG-----IETHPELAWMKPIIRKDRFVYIGLRDIEHKERKIVKDNNIKAFTMHHVDKYGIGAVVQMAIDHINPNLDLPIHLSLDVDAMDPSVAPATGTPVRGGLTFRECHYLCEAIAETNCLVAMDLVEVNPLLG-DESAFNQTVAVGNSVIRCALGET............... 315
200 1.000e-95UniRef50_A0A1V2MY25 Guanidinobutyrase n=1352 Tax=root TaxID=1 RepID=A0A1V2MY25_9ACTN  ali  25  38......DVAVVGVPFDSGSYRPGARFGGNAIREASRLLRPYNPAQDASPFALAQVA-----DAGDIAANPFNINEAVETVEAAADDLLNTGARLMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGA-EYTHGTPFRRAVEEG---------------ILDTSALSHVGTRGYGKQDLTDDEKMGFGIVTSADVMRRGVDEIADQLRQRI---GDRPLYISIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLS-SCHLVSADLVEVAPAYDHAEITSVAASHTAYEL....................... 308
201 1.000e-95UniRef50_A0A174Q308 Arginase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A174Q308_9FIRM  ali  31  3.....RKLDLIGVQSDWGASQRGASMGPAAIRFGGLVEGLERQGHHVRDRGDILAPRTGASR--EKLLHYEQVSEVNRRVYLSVTETLEEGRFPVILGGDHSIAAGSIAAVSKRHGNIGVIWIDAHGDWNSEESTCTGNMHGMPFSAVCGYGPDCMVE---FGQGAAPVNVAHCVQVGGRDIDDLERQRMAQAGVTVFPINMIDKLGMGAVIERAIQ-IAGEGTDGIHLSFDVDAITPEAVPGTGVIVYNGLTPREAFLAAEAIAESRKLISMDMVEVNPFLDTANKSGILAS----ELIQSALGKS............... 295
202 1.000e-95UniRef50_A0A2E7UM23 Arginase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2E7UM23_9DELT  ali  33  2......DIALTNVHLDLGAGRRGTDMGPSALHVAGLVPALRKLGHTVESVNSIGSPSFETRVPGDSMRFLPEVTAVVEALADCTEAAVGAGRFPLVLGGDHSIAIGTIRAMRRKGQRLGVVWVDAHTDMNTPETSPSGNIHGMPVACLLGDGPASLTT--KLLAGEPALRPEDVILVGIRDVDRREAETVRRKGVRAYTMSELDSRGTAVCLREAFAGLVER-TDGIHLSFDLDGVDPAEAPGVGTPVPGGLSLRESHLLCEMAAQTGCLMGMEMVELNPTRDICNKTGELA----RWLIESALGRS............... 300
203 2.000e-95UniRef50_A0A2V8C9B5 Agmatinase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8C9B5_9BACT  ali  25  33......DVAIIGVPFDGGSYRPGSRYGPREIRNQSSLIRSYSYFQRVAPFERLNVADAGDIDAPPV-----SIEKCYAVVEERIGATVEAGARPIVIGGDHSISLPVLRALARRHGPLGLVQFDAHIDTWDEYFGG-KYFHGTPFRRAIEEG---------------LVDGRRFIQVGIRGPMYGEDDFDREHGITVIDIDQLKDRGVAWAIAEIRRVV----TGPAYMTYDIDSVDPAFAPGTGTPEIGGLTSHDAQRLVRGLAGLTLLG-GDIVEVAPVYDPGQITSVLAANLMFEFLCAL................... 307
204 3.000e-95UniRef50_A0A0P9CCP6 Uncharacterized protein n=2 Tax=Bacillales TaxID=1385 RepID=A0A0P9CCP6_9BACL  ali  23  24.SPQPVDVVLLGAPFDTASYRVGARFGPEAIRRVSSLLRPANMYHRIRPDDSLRI-----VDGGDAMVIPGNIERSYASITERVSSWLAEGATPIMLGGDHSIALAELRALAGKYGPVAMIQFDAHGDTSDEYWGE-KDTQATPFRSAVEEG---------------LLNPAKSTQIGMRGYDTNDIEAGRQLGFDVVTMEQVRERGLKPVMQAAQ---LRAGNTPVFVSFDIDCLDPAYAPGTGTPEIGGFTTFEAQHMIHQLVGL-NCVGFDVVEVLPSQDVSEITALAAATVAFEFLTLIAVNNK.............. 308
205 3.000e-95UniRef50_A0A0D2WMM6 Uncharacterized protein n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WMM6_CAPO3  ali  23  462..PASVQAAFVGVPFDLGTSRVGTRYGPRAIRAESVLLRPYNMATRAAPFECLQVA-----DAGDVPINTYNLAESIKIIEQFYSDILQHNCVPMTLGGDHTITLPILRAIVKKHGPVGLVHIDAHSDTNDVMKGE-KIAHGTTFRRCVEEG---------------LLDTKRVVQIGLRGYAADDFDWGRKQGFRVVQAEECWYRSLAPLMAEVRAAM---GSGKVYVSFDIDGLDPSVAPGTGTPEYGGLTAHQGLEIARGVRGL-NIVGCDLVEVAPQYDTSGNTALLGANMLFEMLCSLPG................. 743
206 3.000e-95UniRef50_A0A1Q7N6I7 Arginase n=1 Tax=Acidobacteriales bacterium 13_1_40CM_3_55_5 TaxID=1803468 RepID=A0A1Q7N6I7_9BACT  ali  34  13....PKKIRVIGVPLDLGQSRRGVDMGPSAVRVAGLEARLEALGHMVEDGGNVSVAIAEQKEGHPHAKYLKEITATCVKHAELMIKTLESGKVPIVLGGDHSVAAGTVAGVAEFYRKIGLIWIDAHSDINTPE-------------------------LANILNFSPKVSPENCVLVGVRDIDAVEKENVRQAGIEVFTMRDIDERGMRTVMEEAL-RMAGRGTAGYHISLDMDWVDPEDAPGVGTPVRGGATYREAHLAMEIIADHGRMLSFEIVEVNPVIDEHNRTAELAV----ELTLSAFGKK............... 290
207 3.000e-95UniRef50_A0A1S8LDB3 Arginase n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1S8LDB3_9CLOT  ali  32  2......NIDILGVPIYYGSDRKGVDLGPDKLREKNFKTLITKYNHKVRDMGDIKVPFIPEKDKFPKMKFLKPIVETDTELANKVYESLSLGNFPFIIGGDHSLGLGSIVGASKADENLAVIWIDAHTDINTDKTTESGNVHGMPLAAAMGIGASELTDICHKG---HKLKPENVFIIGARSIDKGELQLINEKNLTFYSTETVKKIGTKTIINEIFEKLAKNNINSVHLSFDIDCLDKSIVPGTGTPVSDGLNIDDTKLLIGAILKSGLVKSMDLVEFNPLLDRNNKTENLVIDFI.......................... 291
208 3.000e-95UniRef50_A0A1D2R7S3 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon WOR_SM1_79 TaxID=1849365 RepID=A0A1D2R7S3_9EURY  ali  25  14.KFEDAEICILGVPFDVTTYRRGARFGPGSIRESSLSVEEYSQGFGL-DLGDLRIADLGDIEAGD-------VKETLKGIEERISEIISKDKLPVVLGGEHLISLGAVRALKKKHEDLKIIQFDAHLDLRDEYEGERL-SHSTVMRRIYDIC-------------------NDLYQIGIRSGSREEFDFAKE-NTRIYGADDI-SASISDVIEKI-------GDKPVYVSIDIDVLDPAYAPGTSNPEPCGISTRELMDAVHKIGKLG-VVGFDVVEVCPGYDKSEVTPITAAKIVREGILSFFG................. 280
209 3.000e-95UniRef50_E0VM11 Arginase n=1 Tax=Pediculus humanus subsp. corporis TaxID=121224 RepID=E0VM11_PEDHC  ali  39  35......KLSIIGVPFGKGQKKQGTEMAPDCLRQTGFIDILKDLGMDVEDLGNITYEP-EVGLQHENMTNLDHFAPCALQVSNCVSSALQDCRACLMMGGDHSLATGSIHGHISVAGPVGVIYIDAHADINTASSSLSGNIHGMTVAMLAEELRKFWPQVPGLEWLTPCLPLGNIAFIGLRSVDPEETVFLDENNVAAYTMEDVENYGLHKVLCEAIKRVDPNGNKSIHLSFDIDSLDPLEAPCTTVPVRGGLTLREGIKIGETLCRTKRLSVVDFVEVNPPLG-SEIQRQTTLDAAFHVLLSVFGYSRRGNPR......... 348
210 6.000e-95UniRef50_A0A0P5JB67 Arginase n=5 Tax=Pancrustacea TaxID=197562 RepID=A0A0P5JB67_9CRUS  ali  46  16...........................................GCDVHDFGDVDYQPSQEDETVKNVRNMKNVIAFNEKLSQKVSKIINEGRMCLTLGGDHSIGVGTVHGHLKAQPETSLLWVDAHADINTPATSNSGNAHGMPLSFHIKELTEYQPELPGFQWHSPMISARNIAFIGLRDVEPYERLIIEKLGMCALSMEEVHGIGIKEAVKYALSRIDPRNTRHLHVSFDIDALDPLEAPSTGTPVRGGLTLREGTELLRSVHRTGRLSAVDIVEVNPLLGSAN.................................... 258
211 6.000e-95UniRef50_A0A021X7H5 Guanidinobutyrase n=673 Tax=root TaxID=1 RepID=A0A021X7H5_9RHIZ  ali  26  36......DIALVGIPWDGGTNRAGARHGPREVRSASSLMRSTHHASKTQPFTIANIADVG-----DLPINPIDLMDALKLIEGGMRTVIEAGALPLAVGGDHLTTLPVLRAVA-ASGPVGLIHFDAHSDTNDTYFGDNPYTHGTPFRRAIEE---------------SLIDPRRTVQIGIRGYAPDEHDWAVKQGIRIIYMEEFVERGVAAVMAEARQIV---GDAPTYVTFDIDSIDPSMAPGTGTPELGGFSTREAQHLVRLLEG-VNIVGADVVEVAPPFDLAGMTSLAGATIMFELLCRLVARRRAGGRA......... 323
212 8.000e-95UniRef50_W7TKG8 Arginase n=2 Tax=Stramenopiles TaxID=33634 RepID=W7TKG8_9STRA  ali  41  53...EPRKVTIVGAPLADGQPLLGVDRGPTFIRKRGLVQRLERDAWRVEDLGDLDFEDFAEGAAHGSTKRAKMVGHANRILYEVTHEHARQDKLVLTLGGDHSIGVGSVAGALKGRPETAIIWVDAHADINSRNTSESGHLHGMVLSFLMNLDNSRNMKGFHWLNDEPVLLPTRLVYVGLRDLDKGEKAFIRSLGIKAYTMHEVDKFGIGKIMEMVLDHILGRTDRPLHLSFDIDAVDPLYAPSTGTRVAGGLSYREAYYICEEVAHSGCLASMDLVEVNPTLTMAGGD-ERTVDMAVGLISSATGNS............... 366
213 8.000e-95UniRef50_A0A078LXZ0 Arginase n=11 Tax=Staphylococcaceae TaxID=90964 RepID=A0A078LXZ0_9STAP  ali  37  5......KIDIIGAPTAFGQPKLGVSLGPDAVRLCGLKARLTALGHEVSDKGNVYGAEYGNHSEEEGLMNFVQVKDFSEVLANTVEASLNDKHFPFIVGGDHSLSIGSISGITKKYSNLGVLWIDAHGDINNSDTSPTGNIHGMPLGVLLGEGSRRLVDIHH---EGAKLKHENIVLIGVRDLDTGEKAYIKEHGIKCYTMSDVKRLGLDAVITKALKHLES--CDGIHLSLDVDSLDPLEIQGTGTKVDGGIFLSDMLSGLNILSSTKRLVSADLVEVNPLIDNCNETAEKAV-ILSEYI...................... 297
214 9.000e-95UniRef50_A0A1G7QVI1 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QVI1_9DELT  ali  24  35......DFAVFGIPFDTGSYRTGSRFGPAAIRNISSMIKPNHVIFEVNILNELRGGDFG-----DVNIVPGYIEPSYAAITEFMTPLLAAGVTPLALGGDHSITLAELRAIAARHGKVSLLHFDSHLDLNTAVFG-QPYNHGTPFRRALEEG---------------LIDPATSIQVGMRGYDPDDFKVAAELGFKVLPAHVMREMGLAEVIKAILERL---GRTKVFCTFDVDFVDPAYAPGTGTPEVGGFTTWEVLRLVRALNE-VHFVGFDIVEVLPAIDPAELTPYVAANLGFEFL-SILAWRKKHG........... 316
215 1.000e-94UniRef50_K0A8T4 Arginase n=33 Tax=Bacillales Family XII. Incertae Sedis TaxID=539742 RepID=K0A8T4_EXIAB  ali  32  2......NIAYISVPYRYGQGKPGTEQGPAAVEQAGLFETLAVHGQEAVRYGEAAVSEDAVREEDPQLKRLEGVVHTTNDLHLIVRDTLTEQRFPLLVGGDHSMAIGTIAGLQQVVPRLGVIWFDAHGDLNTPDTSPSGNIHGMPLAVALGEGHQRLTEIGGSDV---KLQPEHLVFIGLRDVDAGEQELIDRLGIRVYDMEAIRTRGMDTIMEEAIAYLKET-TDAFYLSFDMDGLDPSLVEGTGTRVADGILLDDAKTVLRHCAEQEDFIAAEFVEVNPLLEEGNGTALLANELIGNLLQYM................... 295
216 1.000e-94UniRef50_A0A2D9LMI3 Agmatinase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D9LMI3_9CHLR  ali  27  38LKEQGVEVAIMGAPFDMGVNRPGARFGPRAIRQAGYNDDLYHMGLQVYPTDVLSVADFGDANCP-----PSSLERSHEAIQAKVSQCLKAGALPIVVGGDHSITLPSATAVANHYGPVGIVHFDAHADTAPATYGGVLASHSSPMRRLIEDG---------------IVQGKNFVQVGLRGYWPPHFDWMREQGMRWHQMSEIETRGFDPVLDDAISE-ALDGPELIYLSVDIDVLDPAFAPATGTPEPGGLTSVELLRAVRTIVGSVETVAADVVEVAPDYGPANITAEAALRVILEILSSLANKKK.............. 334
217 1.000e-94UniRef50_A0A162II54 Arginase n=1 Tax=Ascosphaera apis ARSEF 7405 TaxID=392613 RepID=A0A162II54_9EURO  ali  44  41..............FAGGQRKPGVATGPEELLNNGLQEILDERGFQTT-RRDVSAVQIQNDTDVRGMRLPRSVSAFSQALSEQTYQLAKNGRLVLTLGGDHSIAMGSISGMSRAIRDLGVIWVDAHPDINTPETSDSGNVHGMPVAFLSGLVRGESDELFGWIKPEHRINLQKLVYIGIRDADDGEKRIIKENGILTFTMHDVEELGIRAVVDMALKHIGSE--TPIHLSFDVDAIDPVFVPGTGTPVPAGLTLREGQYICRNVHDTGNLVSMDVVEVNPAIDITQKEKCQTLQSANSLIRAALGHK............... 360
218 2.000e-94UniRef50_A0A2C9KMN4 Arginase n=3 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9KMN4_BIOGL  ali  46  55...RPPRVGIIGGPLMYGQPLKGPDTAPDLLRSSYLESRLKKKGASVYDYGNLQFETVRNDEFVKGCKHSRTVGLANSQIAERVEMVLKTERKVLLLGGDHSVAIGSIAGHSNSKRNVAVIWVDAHPDINTPLTSLSGHLHGMPVSFLSREMPHIHPKLPGFEWLNPCISVKNLAYIGLRSIDPEEQDFIEKLNICAFSAKDVRTLGVDFVMSAIMSQIDPWDRLPIHLSFDVDAMDPGIIPATGTPVKCGLNLKEGLDIAKYIFKTGRLSVMDVVELNPKL-SSKAESNWSADVIVEIIVRAF-CGRRGYH----FMSEPK 369
219 2.000e-94UniRef50_A0A075B2U1 Ureohydrolase domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075B2U1_9FUNG  ali  43  8..SNPLKLGLFPAPFNGGQGKSGVEKGPNMILTGDFLSEITSLGWTYYDASNIRFESFKNEDKFKNIKNSKWVGFANSVVYSKLKEVHQNQHFPLLIGGDHSLAVGSVAATADKHKDFCLIWVDAHADINTVDSTLSGNLHGCPVSFLLGL----NGNVPGFEFLKPCLRPDRIVYIGLRDLDNAEKKILKELDIKTFSMHDVDKYGIAKVIEDALNHVNKERNLPIHLSFDIDALDSTIAPSTGTPVLGGLSYREGRYLIETVCETGLLVALDMVEVNPEIG-DQASQIQTIKVAQNLIKSALGYT............... 318
220 3.000e-94UniRef50_UPI000BE1B32D arginase, hepatic-like n=2 Tax=Varroa TaxID=62624 RepID=UPI000BE1B32D  ali  38  17.ASQARSVGVLGIPMWRGQKKLGTDLAPAKIREDGRLISGVETVVGVRDFGDLDLSSYSQCDKN----VTHYMAKTAQSIRKSVIHCLRECEQLITLGGDHSIAIGTVTGHAEQGRDLAVIWMDAHADINTPMTTPSGSWHGMPVSFLMHEMMAHLPRIEDFKDWPSSISAHALVYVGLRDVDPQERWFLEKLQVPNFSMRELDALGIHKVTEIALDKVDPLGRKSLHVSFDIDCLDPLVAPSTGTPVPGGMSLREVAVLAEAIASTHSLTVFDLVEVNSLIG-SYEDASKTIQSAALITRWMFGDGRQGNTSSSGTL.... 334
221 3.000e-94UniRef50_O76895 Arginase n=46 Tax=Holometabola TaxID=33392 RepID=O76895_DROME  ali  38  29....EQSLGIIGVPFAKGQAKQGVELAPDLLRQSSLRQVLQHDGLVIRDYGNLQYAVDEPRVHYHHIRNYADFMACNRALIEQVKLMLVENTQFLAIGGDHAIGFGSVAGHLQHTPNLSLVWIDAHADINLHSTSQSGNIHGMPVSFLLEQLRNTWQHAGLQEIAPNCLPKDQLVYIGLRDIDPYEAFILNKVGIRYYAMDTIDRVGVPKIIEMTLDALNPQN--KIHVSFDIDALDSNVAPSTGTAVRGGLTLREGISIVEALRDTKRVQGVDLVEINPKLG-SERDVRTTVESGLEILKSMFGYRRSGRWSNIDT..... 345
222 4.000e-94UniRef50_A0A1F8TQ94 Arginase n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8TQ94_9CHLR  ali  32  1..............MDLGGNRRGVDMGPSAIRYAGLHQRLEQLGFEVKDRGNIAVADRPRTPLRPPAHHAAEIVRVVSELAASISEIERAGALPIVIGGDHSIGMGTLAGIARAGRRPGVIWMDAHGDINTPETTPSGNVHGMPLAVAVGLAARPFPT-----ELRGSVRGDHTALLATRSLDEGERENIRRAGVTAITMADIDRLGMSAAMERAID--VASKGEGIHLSLDMDAIDPDEAPGVGTPVRGGLTYREAQLAMEMLAASGKLRSIEVAEVNPILDRENRTAQLAV----ELIASALGQT............... 306
223 8.000e-94UniRef50_A0A1G8M7E4 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G8M7E4_9BACI  ali  22  27.TTEGVDFVVAGNPFDTASNRIGARGGPQHIRNFSVLLRPYNPDQGINIFD-----YCSGVDYGDFEIVPQNIHRSYDIVGEQLAPIIEKEITPIILGGDHSVSLGHLRAFAKKYGPVALVHFDSHSDTWDNYFGE-KYMHGTPFRRAVEEG---------------LIDTSHSIQVGLRGYGPEDITDPEELGFKTIPMREVRKLGKDEVLRQIHER---AGNKPVFVSYDIDFVDPAFAPGTGTPEVAGPDSFEALEYVRELYGL-NIKGFDLVEVLPEYDSDDITAALASTIAFEMITLVAMQKR.............. 311
224 9.000e-94UniRef50_A0A2D9KP29 Arginase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D9KP29_9RICK  ali  33  2....KKKIGICGIPSSLGCALPGTKNGPNALRQAGLIGQITLPHH---DFGDVQEPEYPKFNSKDNAKHLDALTAWNTALYEKVEEIINRGYAPLVLGGDHAYAMGSLGAVMKNNKDLLVIWFDAHTDFNTPETSPTGNIHGMPVRVLTGQGPAP---LVNFIKDKGGFLAENIFMIGIRSVDEGEQIAVDQSQMSVFTMADVRQQGIDQVLETIFAKV--TNNTHIHFSFDIDGIDPSLAPGVGTPVEHGLSLEQTQKVFQAIKQSGRLGSMDVVELNPDTDNQDQTAKLAVELVSSL....................... 294
225 9.000e-94UniRef50_A8MKX3 Arginase n=2 Tax=Clostridiaceae TaxID=31979 RepID=A8MKX3_ALKOO  ali  32  2......KINLIGVPLTYGCGKDGAQYGPSVLRENNMIDLIKNNGHTLYDLGDLVIPPASEEDGHENIKYLDLITEVNTNLAHQVYCSLEGESFPFVIGGDHSLGMGSIAGISKHFNEVAVIWIDAHSDINTHLTSPSGNPHGMPLAASMGVGHPKFTDIYFKG---QKVHPKNVYIIGVRDPDAGELALVDDLNLSYYSMKTVREKGLENVLNEVIENIKGSGVDGVHISYDIDVFDKSIVPGTGTPVADGFTLEEGKFTIETLLKEKFVTSMDFVELNPLLDDASKT---TVKTAVEFL...................... 292
226 1.000e-93UniRef50_A0A2M8T879 Arginase n=8 Tax=Clostridiaceae TaxID=31979 RepID=A0A2M8T879_9CLOT  ali  32  2......NIDILGVPIYYGSDKKGVDLAPNKIREDNLKAVITKYNHKVRDMGNVSVPFIPEKDKFNKMKFLKPIMKVNKDVADEVYHSLASGDFPFILGGDHSIGLGSISGASKFDKDLAVIWIDAHTDINTDKTTLSGNVHGMPLAAAMGIGSNELTDI---YYKGQKVKPENVFIIGARDIDDGESKLISEKHLNVYSTETLKKIGVKNIMDEIHKKLLSQNVHSVHLSLDIDCLDKSIVPGTGTPVPNGMSIPDTKFIISYLAKTGLVKSMDLVEFNVLLDKNSETENVVMDFI.......................... 291
227 1.000e-93UniRef50_A0A257B4C9 Arginase n=2 Tax=Bacteria TaxID=2 RepID=A0A257B4C9_9BACT  ali  35  6.SSPPRKVTIVGVPMDLGADRRGVDMGPSVVRIAGLSAKLTELGYAVEDIGNVPVALAEMRRATDADKYLAEVARSNEILAKSVEDILAEGALPIVLGGDHSIAIGSVAGVAAHYKRIGVIWIDAHADINTPESSPSGNIHGMPLATLLGHGPEVLTHIGGFA---PKLLPEDCAVIGARQLDDGERRLARQLGLRIYTMRDLDERGMSAVMDEAIAWVTRH-TIGFHATFDMDFVDPYYAPGVGTPVPGGGTYRESHLAMEKIHDSGKLLSVEMVEINAVLDTHNRTGELGA----ELLLSALGKK............... 310
228 1.000e-93UniRef50_A0A0T8FRU1 Formimidoylglutamase n=136 Tax=Bacteria TaxID=2 RepID=A0A0T8FRU1_STREE  ali  25  27...ENAKVGLVGMPFDTASFRVGARFAPQAIRQASMTLFPYHPVHDVYPFDDTNAIDIG-----DVPVIPHNIHRSYELMEEAVGALMDRGIVPIGIGGDHSVTLASLRAAAKRYGPVAMIHFDSHTDTWDTY-YDEKYWHGSPFIRAYEEG---------------LVDPKKVFQIGIRGTLPGDVQESKDLGYHVVTAGELERQGFSVILEQMKTAI---GETPCFLTFDIDFVDPSCAPGTGTLEVGGFSSRETLQMIRSLTG-FNYVGFDLVEVLPSYDPTQITSLLAATIIHDFASLVAVKTKR............. 310
229 1.000e-93UniRef50_A0A0G3XWG0 Guanidinobutyrase n=83 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0G3XWG0_9BACI  ali  26  27...ENAKLAILGMPFDTASFRVGARFAPQAIRQASMTLFPYHPIHKVYPFEDTNGIDIG-----DVSVIPNNIHKSYELMENAVFDLMKKGIVPIGLGGDHSVTLASLRAAAKVYGPVALIHFDSHTDTWDTYYGE-KYWHGSPFVRAHEEG---------------LLIPDKVFQIGIRGTLPGDIEASLKLGYNVITTQELAKRSLNDIAQEMKETI---GETPCFLSFDIDFVDPSCAPGTGTLEVGGFSSRETLDIVRSLT-DFNYIGFDIVEVLPAYDPAQITALLAATLVHEF....................... 300
230 2.000e-93UniRef50_A0A212K565 Guanidinobutyrase n=44 Tax=Bacteria TaxID=2 RepID=A0A212K565_9DELT  ali  25  31.....ADVSIIGVPFDSGSYRPGTRFGPAAIREASTLLKPYSPELDVDVNESFTIADHGDIDTI-----PGYMEDSFAAITSSLKPFFASKTLPVILGGDHSISLANLRAVHAAHGPVALLHFDAHSDTIPSY-YGKPYNHGTPFYWALKEG---------------LILPQHSTQIGIRGYSRNALDWPRQQGLRIIMGHEAHAMGLEAVIREALARI---GDAPVFLSFDIDFLDAAYAPGTGTPEVEGFTTYEAMSLVRGICSKRRAVGMDLVEVLPDKDVAGITALAGASVI.......................... 300
231 3.000e-93UniRef50_A0A1Y5PFU5 Guanidinobutyrase n=57 Tax=Bacteria TaxID=2 RepID=A0A1Y5PFU5_9MYCO  ali  26  43....GADVRIVGVPFDSGSYRPGARFGPSHVRAASKLLRPFNPALGV-----APFAAQQVADCGDIAVNPFNIDEAIAAIDTAMTDLRKDGSTVLTIGGDHTIALPILRSLARDHGRVAVLHFDAHLDTWDTYFG-SPYTHGTPFRRASEEG---------------LIDMERSLHMGIRGYSKTDLEQDSVLGFQVIRSDDYEFDGVASIVERMRKRLD---GGPVYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLVGLD-IVGADIVEVAPAYDHAEITGIAAAHVGFELLSVLAANR............... 323
232 3.000e-93UniRef50_D7CX25 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D7CX25_TRURR  ali  28  36......DAAIVGAPFDTGTYRVGARFGPAGIRHESMLLRPYHPELRVDVTEQLSLVDYG-----DLPVTPGYLSESHAQLERGAAELVAAGVTPFFLGGDHSVSLPLLRAVAQRHGPVGLVHIDAHSDLWEGYFGG-KDTHGTPFRRALEEG---------------LLEPARSIQIGLRGYSAEDHALSQRLGFEMVTAPELHRVGVQEVARRVRAR---AGTGPLYLSFDIDALDPTFAPGTGTPEVGGLSSVQALALLRALAGLP-FVAYDLVEVMPPYDVAGTTCLLAANLVYEML-ALEACRRLG............ 316
233 3.000e-93UniRef50_A0A0F4X6H6 Arginase n=10 Tax=Saccharomycetales TaxID=4892 RepID=A0A0F4X6H6_HANUV  ali  42  12.NSENRTCKIVLAPFNGGQPHGGVDLGPEYMLKHGLKEQIEELNWKIDPLKNLDLADLKEKELKPKIKRADLVSLANEKIYNACKNEIKKDEFQLTLGGDHSIAIGSIAGLLSRHPDAGIIWIDAHADINTVNTTESGNLHGCPVSFLANMDRQDWPESFKW-IPENLLKTNKIAYIGLRDVDEGEKKILKDNNIKAFSMYHVDRFGINSVVEQALEHVSQGNKDPIMISYDVDAIDPASVKCTGTKVDYGLNNREALFLCERICETGNVVALDVVEVNPSLGADEHEILKTVAIGCSIVRCSLGET............... 328
234 5.000e-93UniRef50_A0A1Y5SQ85 Guanidinobutyrase n=41 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5SQ85_9RHOB  ali  25  35.RYSDVQIGLIGVPWDGTTNRPGPRHGPRQLRDASTMIRAQHPTSGMRPYETVNCADLGDVGP-----NPADILDSMTRITAFYDQVLAAGITPLTAGGDHLTSLPVLRSLAKVHGAMGMIHFDSHTDLFHSYFGGTMYTHGTPFRRAVEEG---------------LLDPKRVVQIGLRGYDTEDRDFAAANGIRLILIEEFHDRGVADVMAEARDI---AGDGSTYISYDIDFVDPTYAPGTGTPEVGGPNSYQALQVVRELEG-VNIIGADMVEVSPPFDPSGGTAFLGMSIMFELLCVMAAQA............... 319
235 5.000e-93UniRef50_A0A2E3UWH8 Arginase n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E3UWH8_9PROT  ali  34  1MVFKKKKIEVIGVSSDLGANIPGASLGPSWLRAASLHEILHAVGLETSDLGDLTVVDRGLVGKEHIAQYRLLLAELLQNLAERTYLSMKNNNKPLILGGDHSLSIGSVGGVQKQGKSLGLVWFDAHADMNRPESSPSGNLHGMPVSVLLGKGHEHFTDII---ARSSFLLPENIVLIGLRDVDNKEQQILEKSGVLYFRMDDVFKLGIESIMSKTVNHLKE-KVDAVHISFDMDAIDPLYAPGVSTPVPNGLMVKDALLALEMLSSAIDVQSMDLVELNPLKDQDQKTAQLAVDLIKSAI...................... 301
236 6.000e-93UniRef50_A0A0J6VZ56 Agmatinase n=98 Tax=root TaxID=1 RepID=A0A0J6VZ56_9MYCO  ali  22  31....KPDVAIVGAPFDITTNRPGARFGPRAIRATAYEPGTYHMDLGLEIFDWLEVVDFGDAYCP-----HGQTEVSHANIKERVHAIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTADEIEGN-LASHGTPMRRLIESG---------------AVPGSHFVQVGLRGYWPPQFEWMQEQKMTWHTMQEIWERGFKAVMADAVGEALAKADK-LYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEHDVAGVDVVEVAPAYDHAELTVNAAHRVVFEALAGMAARRREPGQPARSYLKP.. 334
237 8.000e-93UniRef50_A0A1W7QPZ6 Arginase n=1 Tax=Geobacter pelophilus TaxID=60036 RepID=A0A1W7QPZ6_9DELT  ali  35  2....ESRVRMIGVPLDLGQEQRGVDLGPGALRYAGLSARLAGLGYQVEDIGNLEVPVRDVLTAERERHYLPSIAKVCDTVYQAARAAVADGAIPLFMGGDHSLALGSIGGITD-EQPTAVIWIDAHGDFNTPKSSPTGNIHGMVLAALLGEG---FPELVHLGRPGAKLAGNDVVLIGLRELDPQEKVRLRESCITVYTMRDIDERGIGVIAREALGKLAHR--TRLHVSLDLDGLDPLEVPGVGTTSPGGITYREAQLLMEIIADTKLLRSMDIVEINXILDHGNRT----AKIAVELAASAFGAA............... 294
238 8.000e-93UniRef50_Q8KZT5 Guanidinobutyrase n=458 Tax=Bacteria TaxID=2 RepID=GBH_ARTS8  ali  24  39...SKADVTVVGVPFDSGSYRPGARFGANHVREASRLLRPYNPAWDVSPFENIQVA-----DAGDMAVNPFNINEAIETIQQNALDLTANGSKLVTLGGDHTIALPLLRAAARAGEPIAMLHFDAHLDTWDTYFGA-EYTHGTPFRRAVEEG---------------ILDTEAISHVGTRGYGKKDLDDDHRFGFGIVTSADVYYQGVLETVAKIRDRI---GNRPLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEIIRGFRGM-NLVGADVVEVAPAYDHAEITGVAGSHVAYELVTLMADNAVEGDRAPNGYA.... 334
239 1.000e-92UniRef50_A0A2V9RIE8 Agmatinase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9RIE8_9BACT  ali  23  41..PSELDVALIGIPFDGGTYRPGPRFGPRNVRVQSAMIRPWNPVLKVDPFEKLRVGDFG-----DLSINPLSIEDTYRRITEQLGEVLRADARTICVGGDHSILLPILRAIHRHFGPVAFIQFDAHGDTWGGYFG-SPHSHGTPVKYAVEEG---------------LLEPGCALQVGLRGYSEDDFEFARKHGIAMITSEEFHEGGIE-LMKR---HLRKHRNKNVYVTLDIDVVDPAFAPGTGTPQVGGFSSAQILSAVRALHGLH-IVGCDLVEVSPPYDNGEITSLLAANLIYELLCLF................... 318
240 1.000e-92UniRef50_A0A1G6MW86 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G6MW86_9BACL  ali  23  27LKMDGSDVAVIGLPFDTGSFRAGARFGPAAIREMSVLLRPAHSFHKINPFEHVRCVDYG-----DLPLLPGYMEDSFDIIRDTYRRLAREKVIPVGLGGDHSVTLAELRGLADVYGPLSLVHFDAHGDTWDEYWG-KKYTHGTPFRRALEE---------------EIIDPHHSVQIGLRGYHPDDMDEAAELGFEVIAADELHTLHPTDLRRRIENRV---GDRNAFLTFDIDFFDPAYAPGTGTPEVGGFTSHQGLTFVRHL-PLLNYVGFDLVEVLPAHDHSQNTALLGAAVVYEFLALI................... 307
241 1.000e-92UniRef50_A7RZV8 Arginase n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RZV8_NEMVE  ali  39  22......SVQIIDVPFCGGQPKGGVELAPKFLKELGLVTRVESLGLTVHEHGKVEPNVTDHIDANPVVKNPVVCGGVAKATSEAVLNALNNNRMAITVGGDHSIATGTVFGSWKFDNNTCVIWVDAHADLNSPLITTTGNVHGMPISWLLK-GIPEFPVVPGYEWVNPCLDPNKLAYIGLRDVEPQEAQLLNEIGVTAFTIEDIDEIGIEATMEKALDAINPNREFPIHVSFDIDAMDPDHAPSTGTKVRGGLSNSEGHYICQLLSQTGLLQAIDLVEVNPTLG-TEKEARQTAETALSLLETLLGKRRE............. 327
242 1.000e-92UniRef50_A0A0F5FKK0 Arginase n=18 Tax=Proteobacteria TaxID=1224 RepID=A0A0F5FKK0_9RHIZ  ali  30  5..SRPVRIDLVGVATASGASVRGCGMGPEALRVAGLAEALMDLDHAVADHGDLRRAQTSPSTHPSSARMPEDVLEMAARISDAGHAILQSGHVPVFLGGDHSIAMGTVSAVARRQKPVHVLWIDAHADYNTPQTSPSGNLHGMPLALLCGE---PGFDEAFQGDWLGRIDAHNVTILGARSVDREERRLVQARGIEVIDMRKIDQIGVVAAVQKVIDK-AKAAEAHLHVSLDVDSLDPAIAPGGGTLVPGGLSYREAHLVMEMLHDCGLVGSLDVVELNPFLDHGGKS----ATLLVDLVASLFGRSIMGEEP......... 315
243 2.000e-92UniRef50_A0A265Q369 Arginase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A265Q369_9FIRM  ali  29  2......DINLIGVPLKYGCDRDGAQLGPATLRENGIIDIIKKNGHDVHDMGDIYIPYVVSEDKHPKMKYLNTVAEINSNLANNVYCSLKGQSFPFIIGGDHALGAGSIAGASKFFENMAVIWIDAHGDINTYETSPSGNIHGMPLAASMNVGH---PALTNIYYDGIKVSPQNVYILGGRDIDSGEFALADELNLNMYTMDIVRERGLDNVLKEIVEKIKASNVDGVHISFDIDVLDSSLVPGTGTPVTGGFSIEEGKEIFTTLLGEKFITSMDFVELNPKIDNEDRTTKNCIEMLEHIFSTM................... 299
244 2.000e-92UniRef50_C7D719 Agmatinase n=57 Tax=root TaxID=1 RepID=C7D719_9RHOB  ali  22  28.TPEGLDVGFIGIPMDIGTSRSGTRMGPKQVREQSAMIRPYNIQTGAAPFDALQCADLG-----DVAINTFSLSDSLRIITETYDKHLKHNFIPMTLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVNDEMFGERE-THGTVFRRAYEE---------------NLITPSKVYQIGLRGYTSEDFTEAEGWGFNTVLAKDLWHKSLTPLAKTIKDAI---GDQPCYITYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRGINGL-NIVGCDLVEVSPPYDPSGNTALTGANLMFELLSILPG................. 309
245 3.000e-92UniRef50_A0A1G7QV34 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QV34_9DELT  ali  26  32......DVSIIGVPFDSGSYRPGTRFGPAAVREASTLLKPYSPELDVDVTEAFSIADHGDIDTI-----PGYMEESFTAITAGLLPFFRANTLPVILGGDHSISLANLRAVKEAQGPVALLHFDAHSDTLPSY-YGKPYNHGTPFYWAISEG---------------LILPERSVQIGIRGYSRKALDWPRQQGLRIIMGHEAHALGLEAVIREALARV---GDAPVFLSFDVDFLDAAYAPGTGTPEVEGFTTYEAMTLVRGICSHCRTIGMDLVEVLPDKDAAGITALAGASVIFAFL...................... 304
246 3.000e-92UniRef50_A0A1W6JYS4 Agmatinase n=1 Tax=Acidianus manzaensis TaxID=282676 RepID=A0A1W6JYS4_9CREN  ali  22  25.KEEDVRAVFVGVPFDATTFRPGARFGPSGIRQGSRLLREYNQFLDTYPFEKLNMCDQGDINAI-----PGFLDDTMKIIENGIYEIISKNRVPFIAGGDHSITLPVLRAMRKKYGKVNLIHLDSHYDFWDTYWGNKKYTHGTWLRRALEEGLLNE-----------------VVQAGIRTYSKDDLEDKKKLGIKSFTINEMKEKIEEI------ISIINSLNGNTYISIDIDVVDPAFAPGTGTPEVGGLTSYEIINFIRKLKT--KIIGFDVVEVSPPYDVSELTSMLAANIIYE........................ 294
247 3.000e-92UniRef50_A0A2A5AJ85 Arginase n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2A5AJ85_9BACT  ali  30  19.....................KGASMGPDAIRIGGLYSGLERLQISYKDRGNLSAHPPRKIPVGDI-RYLDLICDFMKDLKQEVTSSLEDGEIPLVLGGDHSLAMASLAAVINFYKKPGVIWFDAHADLNTEETSPSGNIHGMPLAVALGDGNDSLKSLF----EGSFLDPSKVVLLGVRSVDSQEAQMIRKLGVHIFTMKDIDELGMKECVSRSIA-IANKDNSPVHVSFDIDGIDGRFVQGTGTPVNGGITLREAHLFLEMLAAKEIVTSVDLVEVNPLLDDRNKTAEIAVHLIESLFGRVI.................. 303
248 4.000e-92UniRef50_A0A1Y5K807 Arginase n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1Y5K807_9BACL  ali  35  4MNISRDKISVIRVPFGLGGGIAGTEQGPTSILAAGLLDELKHLAPHGVSCDEVRLEPHRDADSEDIIKYEPQVRAMSERTADRVARAALYGSFPLVLGGDHSVAIGTLAGMSRVYDKLGVIWVDAHGDLNTEHTSSSGNANGMVLAIATGLAAFKQTDI---GQTRRLLRNRNIVLVGIRQLDDGEKTLIRSHGIHCFTIMDIDRLGIQEVIERAL-LLAGNDSDGIHLSLDMDALDPGEAPGVGTPVHGGLTFREARLAMEGLAASPSIASMDIVGVNPLKDKESRTSGLAVALA----AAFMGKR............... 325
249 4.000e-92UniRef50_A0A2E6VUY7 Agmatinase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VUY7_9DELT  ali  29  34.SLQAADVALLGAPFDGGSYRPGARFGPEKIRSMSSLGRGHHPEHDVNIFKGMKV-----GDAGDCPVTPQDISKTHAQIKERVAEVLKAGTFPMVVGGDHSTTIGTLDALVAHHGPLGIIHFDAHTDTYPAAWGCDVH-HGTFMR---------------LGKERGWFRENAVVQVGIRGPFSTEQDIHTQYGYRVFTVDDVKQQGVGAVV----QHIQQLDDGPFFISFDIDCLDPSCAPGTGTPVPGGLSTWEAQQILRA-TSHINVVGADLVEVSPPYDHHDITALTGVTVIWEILSAVAAR................ 315
250 4.000e-92UniRef50_UPI000A07371A agmatinase n=1 Tax=Streptosporangium amethystogenes TaxID=2002 RepID=UPI000A07371A  ali  24  8.APQGADLVIVGAPYDGGSYRPGARFGPRAIREESALLHGTGLDRGPSVFGAI-----GAVDAGDLDLNRFSMESAMSTATERLTELAERNQALLMLGGDHSMTLAALRAAHKVHGPVAVLHLDAHSDTYPPVDGG-RYHHGTPFRWAI---------------WEKLVDPARMIQVGIRGHVPGALEFARARGVRIVTAPDIDRIGVGSLMSMIQECV---GDGPLYVSCDIDVVDPAFAPGTGTPSPGGLSSRELLAILRGIGDLQPI-GCDVVEVAPAYDHGGATALLAAEIGYELIYQ-YARSRRGR........... 294
251 5.000e-92UniRef50_M2SP37 Uncharacterized protein n=6 Tax=leotiomyceta TaxID=716546 RepID=M2SP37_COCSN  ali  27  56...KPLDIAILGFPYDTTSYRPGARFGPRGIRAGSARERSYNTVWEVDPYE----EGLAIVDCGDVPITPFDAAHAFKQMEQGYRQVLWEHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHASREG---------------CISKGTSVHGGLRTFSPKDYEIDKDVGFGIIEAHEIDDIGMNGIIEKTLSFV---KDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGLEGI-NLVGADVVEVSPPYDTAEITSIAAADLIVDIM-AAMAKSKKGP........... 362
252 5.000e-92UniRef50_B5YMM5 Arginase (Fragment) n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B5YMM5_THAPS  ali  42  9...........................PALLRQLGLLKDLSTLGWRVEDNPDLDFNTIKNSNISPNAKHSHQVGAGSKALAELVETKLRLGRFPLILGGDHSIGIGSLAGIMRAKPETGVIWVDAHADLNTPEMSESGNMHGMPLGIMMKELVPDRRTIPGLEWMEPRLAPDSLVYVGLRDIDKEERRCIRELGIKTFTMYDIDHLGIGRVMDLALEHLLRKNDRPIHLSYDIDAVDPLHAPATGTAVRGGLTWREAHFVAEHVVKSGSLASAEIVELNPTL-SDGQGADETLELGHKLVTALCGES............... 297
253 5.000e-92UniRef50_A0A1B8EI92 Uncharacterized protein n=168 Tax=Fungi TaxID=4751 RepID=A0A1B8EI92_9PEZI  ali  23  75.....YDIAIIGSPFDTASYRPGARFGPRAIRAASARFNPYTSWATILDCGDIPI------NPFDNELAYRQMTEAFSELAHRPSKSGSQKPRLITLGGDHSLALPALRALNELYGPVAVLHFDAHLDTWHPAKYPSAWT--------SEQSHFNHGSMYWIASNEGLIANGSSVHAGLRGSGWDDYEDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGT--DIPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVEAL-NVVGADIVEVAPAYDRGEQTALVAAQVVYEILTSMV---KRGLPVAK....... 383
254 7.000e-92UniRef50_A0A2D5AZF1 Arginase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5AZF1_9BACT  ali  33  19.....RRVGLLGVPMDLGGGLRGVDMGPSAIRIAGIGKAIAGHGDGFVDFGNVPVLRPETRVPRDRARFVGSIAHCCERLRKRVGRLLDESIFPLIVGGDHSIACGTVAGHADRGEKVGLIWFDAHADMNTPATTPSGNVHGMPLAACLGQGEDR---LVNLATRVPMVDPANACLIGIREVDPGERELISKTGVHVFTMREIDMHGMHHVMSKALD-IATQGTAGFHLSFDLDGLDPGAAPGVGTPVGGGVTQREAHLLLEHAAASGKLLGLEMTEINPILDESNRTAELAVQLV----LSGLGKR............... 317
255 7.000e-92UniRef50_A0A1Y2NJ92 Guanidinobutyrase n=132 Tax=root TaxID=1 RepID=A0A1Y2NJ92_STRPT  ali  26  52..YAGADVVILGAPFDGTTSRPGTRFGPQAIRRTDYLPHPYRPHLG---LGVDPFTELKIVDAGDVPTPPGETERAHQLLERTVSEVVAAGAIPFTLGGDHSIAWPTMRGIAGRRGPFSVVHFDAHADIGDTSDFGAEYGHGTVMRRLLESGT---------------VPGDRFTQIGLRGYWPGPRQWAAGLGVRSITMSELRSRGLDTCLDDVLDQI---GPGPLYLTIDIDVVDPGMAPATGTPEPGGLTSRELLDAVRTCAQRVDLVGAEIVELSPPYDPGEITAYLANRIVLEVL-SGMAWKRRAASAGNEGLP... 353
256 7.000e-92UniRef50_UPI000852C38D agmatinase n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000852C38D  ali  24  41........VFLGVPFDGGTFYVGARFGPQYIRSESRILRPYNAELDVYPFKVLRAVDYGDVDVIPV-----SITKTLDGIEEVVKDVINQGATLFIAGGDHSITLGVLRAIGKMFKPI-LLHFDSHLDYWDEYWGE-KYTHGTWVRRAIEEGLIA-----------------QVVQVGIRGYDKSDFNYPRESPIRVIMMREVEERGIEWLISELR-----SLEGNVYVSFDIDVVDPAYAPGTGTREPGGFTSNEVLRIIRSLADAKNLVGFDVVEVAPPLDVANITSLLAANILYQAM...................... 309
257 8.000e-92UniRef50_A0A1Y4NS07 Agmatinase n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NS07_9FIRM  ali  21  43...EDVDYVVVGIPFDTTSNRPGTRFGPKAIREAYGGIN-YVYGTDVY-----AAETLSGVDYGDIQVQNGDTKQSFENIKAEIGKILEAGVIPVALGGDHSITYAELLAYRDVYGPVSLIHFDSHTDTWGGEESLDFPTHANPFRNAI---------------LTGCIDPKTSIQVGMRGIMKSEYDFAHENGLEQIFATDLHKMGVYEAAKKIREKV---GNNKVMVTFDIDFVDPAIAPGTGTPVPGGFTSWETLELVRTAITGLDVVGFDLVEVAPNYDPTENTQLLANKLVGEFITAIAAKK............... 325
258 8.000e-92UniRef50_Q7N122 Agmatinase n=533 Tax=root TaxID=1 RepID=SPEB_PHOLL  ali  23  32..SSDAEWVITGVPFDMTSGRAGSRHGPAAIRQVSTNLAWESRRWPW----DFKLHNLKVVDCGDVVFNFGDAQDMSDKLQAHAEKVLASGKRMLSFGGDHFITLPLLRAHAKHFGKMALVHFDAHADT---YPNGSQFDHGTMFYHAPNEG---------------LIDPHHSVQIGIRT------EHGRDNGFTVLDADQVNDRSVDDLLAQIKETV---GDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTTDRALKLLRGL-QPLNIVGMDVVEVAPAYDQSEITALAGATIALEMLYLQASKKR.............. 307
259 9.000e-92UniRef50_A0A268K8G3 Agmatinase n=7 Tax=Bacillus TaxID=55087 RepID=A0A268K8G3_9BACI  ali  24  27...ENAKLAIVGLPFDTASFRVGARFAPQAIRQASMTLFPYHPIHKVYPFD-----ACNAIDIGDVSVIPHNIHRSYEVMEKAVMELMEQGIIPIGLGGDHSVTLANLRAAAKIHGPVALIHFDSHTDTWDTY-YEEKYWHGSPFIRAYEE---------------NLLIPDKVFQVGIRGTLPGDIDSSSDLGYHVITTPELKDRGFENVVKEMKEKI---GDTPCFLSFDIDFVDPSCAPGTGTLEVGGLNSFETLQIIRSLT-DFNFIGFDLVEVLPPYDPTQITSLLAATIIHDF-ASLVALKIK............. 309
260 1.000e-91UniRef50_Q1I7X5 Agmatinase n=507 Tax=root TaxID=1 RepID=Q1I7X5_PSEE4  ali  24  41...RGVDVVVSGVPFDTTSNRPGARFGPRAIRTASVQQAWARHWPWAFD----PFDHLAVIDYGDCAFDNGTPESVPDSIQAHAERILDAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEEG-KRIDHGTMFWHAAREG---------------LVDPAHSVQIGLRTT------NDDSQGFAILDARQVHRQGTEAIVAAIRQRV---GERPVYLTFDIDCLDPAYAPGTGTPVCGGLSTLQALEILGGLRGI-NLVGMDLVEVAPAYDHADITALAGATLAMEMLCLYAARHK.............. 316
261 1.000e-91UniRef50_T4VDL2 Arginase n=40 Tax=Clostridiales TaxID=186802 RepID=T4VDL2_PARBF  ali  30  2......NINIIGVPTFYGCDKLGPQLGPDKLREKGIIQTIKKYNHQVYDLGNLYVESVDESEKHSDMKYFKPLLDINTNLAHAVNTSLKTGYFPLIVGGDHSIALGSISGVSEYFKKFAVVWFDAHGDINTFETSESKNVHGMPLASLMGYGH---SELKNLYTENIKISEDNVYHIGGRDIDSGEKEFIQNTNMNMYYPEDLTNKGVDSVISCILSSLHSKNIQAIHISFDLDFIDSQYVPGTGTRVENGFTVDESKYLLAKLLESGLVKSMDLVELNPALDKDDITADIAIDIV.......................... 292
262 1.000e-91UniRef50_K2SF00 Arginase n=3 Tax=saccharomyceta TaxID=716545 RepID=K2SF00_MACPH  ali  51  1..................................................................MKCPRAVSAVTRKLSEQVYEHARQGRCVLTLGGDHSIAIGSISGTAKAGREIAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLAKEDREDIFGWIKEDQMISVKKLVYIGLRDVDKGEKKILRENGIKAFSMHDIDRHGIGKVMDMALGWIGS--DTPIHLSFDVDSLDPQFAPSTGTPVRGGLTLREGDYIAECVAETGSLIALDLVEVNPSLESAG--ASETVRAGCSIVRCALG................. 240
263 1.000e-91UniRef50_UPI0002658A1B arginase, hepatic n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI0002658A1B  ali  37  19.TAIPKTVGVLGLPFWRGQRKNGTELAPEELRRRGLLDEI-SNTSEPRDFGDVDFDQCGETD------QLRYMAESAKLVRRSVKASLERCAVLVNIGGDHSVGMGTVAGHADFGKDVAVLWVDAHADINTPSTSLTGSWHGMPLSFTLHQMTKYLPPLKEFSGWTPTVAAESIAFIGLRDLDPSERLFLDRLRITSFSIRDVDSLGMKRVAEMALQAVNSRGDKSLHVSFDIDALDPTQARSTGTPVAGGLTLREAAVLAETVVSTQTLRVLDMVEVNPRLGSP-TDVESTMDAAKKVITWMLGHRREGRQP......... 326
264 3.000e-91UniRef50_A0A225AKU7 Putative agmatinase 2 n=3 Tax=Dikarya TaxID=451864 RepID=A0A225AKU7_9EURO  ali  26  59...EPLDIAILGFPYDTTSYRPGARFGPRGIRAGSSREKPYEQGLQIIDCGDVPIT------PFDAAHAFKQMEQAYRQIHQTSEQNAWKHPRILSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHASREG---------------CISKGTSVHGGLRTFSPRDYEIDRDVGFTLIEAHEIDEIGVHGIVEKVRKAV---GDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKAFLKGLEGI-NLVGADVVEVSPPYDVAETTSVAAADLLVDILAGMTKSTTEPSISRPDIKDEL. 377
265 4.000e-91UniRef50_UPI000B8F2160 arginase, hepatic-like n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B8F2160  ali  39  36.......VGLQGLPFGRGNPRPGTETGPMYLRNGGIIEYLKDEGVDVKDYGDM-IFDVGPRVRTPVVWNIVDVAKAAKKISDQTEAIAKDGRIVLSVGGDHSITIGTINGISNVHPNVAILYLDAHADINTVKTSPSGNLHGMTIPFAVKELSPDMPEMKDFDFIQPRVAAENVAHIGLRSVDPGETEIITKFKTNSFGVRDIDRLGIMEVTKRALAKISPNGERPVHLSFDVDVLDDLEIGGTGTPEPGGLTLREAMTFFEVVQETVNIVSMEFIEVNTALGTSSN-PKRMATLVKYMMGCAFGYCRGGLARA........ 354
266 5.000e-91UniRef50_Q6CIB4 Guanidinobutyrase n=10 Tax=Saccharomycetales TaxID=4892 RepID=GBU1_KLULA  ali  26  59...KKFDIGVIGVPFDTASFRGGARFGPQAIRKASQRINPYQDWASVVDCGDVPVTPMDNC------LALKMMTAAYENLLSHESQTSDNNLPPVTLGGDHSIILPALRALRKTYGRLAVIHFDSHLDTWAPSKYPSEFTHGSMLWIAHNEG---------------LLTENNNIHAGLRGSSFEDYDDDDKVGFHRIEADEIMDGGIKSIVEKIKSKIPS--DVPVYISVDIDVLDPSAAPGTGTMEVGGWMTRELIRIIREL-EDLNLVGADIVEVSPPFDPTEITSLAGAQIAYELITNMV---KKGPIDPE....... 369
267 5.000e-91UniRef50_A0A093YKB5 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A093YKB5_9PEZI  ali  24 1219.....YDIAIIGSPFDTASYRPGARFGPRAIRAASARFNPYTSWATIKDCGDIPI------NPFDNELALRQMTEAFAELAHRPSKSGSQNPRLITLGGDHSLALPALRALNQIYGPVAVLHFDAHLDTWHPAKYPSAWT--------SEQSHFNHGSMYWIASNEGLVANGSSVHAGLRSGDWEDYEDDTRQGFFRISADDIDDIGPAGVAKLILEKIGTEI--PVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVEGL-NVVGADIVEVAPAYDRGEQTALVAAQVAYEILTSMV---KRGLPVAK....... 1527
268 6.000e-91UniRef50_I4Z1N8 Arginase n=1 Tax=Microvirga lotononidis TaxID=864069 RepID=I4Z1N8_9RHIZ  ali  32  20.......VGLIGVPFGLAASVPGTCLGPAAARIVGLAEALSGLGHEVVDRGDLAPVRSHSRTSRDISRHAEAVSHWVEAIHDETLAALTEGQRPLIIGGDHSVSMGSVSAVARHGKRVAVLWIDAHPDFNTPQSSPSGNMHGMSLAFLAG---DEDLAEIMRGRAFPAILPTDISVIGARSIDQEEQEAIAAAGVRCHDMRAVDEHGIRYLVEDVLGSIDPT-TTHLHVSFDLDVVDPALAPGVGTPVPGGLNYREAHYIMELLHDSGLVGSLDVVELNPMRDIQGQT----ASLMVDLVGSLFGKA............... 318
269 6.000e-91UniRef50_A0A068XCA7 Arginase n=12 Tax=Eucestoda TaxID=6200 RepID=A0A068XCA7_HYMMI  ali  41  9....PSSVGLIEAAINKGQPKEGVEKAPKEIRSAGLDHLINSLNAKVSYYGEVRQPEDREPDIVANCLNQRALIKATLELTELVEKSVAENEITLIIGGDHSSGIGAIEGHFKAFPDSFVVWVDAHGDINTPDSSVSKHTHGMPVSFVMRETYKQIPHTMGFEKIQPVLDPNQIIYIGLRDLDPPELNTLKEFSVPYFSMDDVRQLGIEKVLETTLRIIEKTKPHKIHLSFDIDSLDPKFAPSTGTPVPGGLTLKEGKYICRTLAQTGQLRSMLMAEVNTALG-SEEDAKMTLSSANEILKSAL.................. 308
270 7.000e-91UniRef50_D5DRS1 Agmatinase n=130 Tax=cellular organisms TaxID=131567 RepID=D5DRS1_BACMQ  ali  23  35......DFIVTGIPFDSGSFRTGARFGPEAIRDFSILLRPYNPEQKINIFDYISGVDYG-----DLSVVPGYILETYKKIEEGLTPVVNEGIIPISLGGDHSMTLGELRAIAKKHGPVALLQFDAHSDTWDSYF-EQKYNHGTVFRRAIEEG---------------LIDVSRSIQIGMRGYGIEDLEDAKNLGLALYATNEYKKLGVERMLDIIHERV---GEGPVFLSFDIDFLDPVYAPGTGTPEVSGASIDDALQFVRGLTNID-FVGFDLVEVLPAYDHGQITAAAAANIVYEFI-TLIALRKK............. 314
271 1.000e-90UniRef50_R1D0R8 Arginase n=2 Tax=Emiliania huxleyi TaxID=2903 RepID=R1D0R8_EMIHU  ali  42  2.....RTIRFIGAPFCEGQNLDGADLGPTALREAGLQPLAEMLGWSWEDAGDLDFAAALEEEAEPPPKEE--------------------GRFALTCGGDHSIAAGSICAL--VYPDLGVIWIDAHADANTPRTSPSAHYHGMPAAHLLGWFDNGIDGFEWF--EPGCLSENRLAYIGLRDIDAEEGRMLRASNVHVFTMREVDKHGIAKVMEMALSAIDPNGFRPLHLSLDIDAVDPHFAPGTGTAARGGLSYREIHYIAEEMAETRRLVGMDLVEINPGLDEAPQRSSMTVQLGVEVALSALGKR............... 291
272 1.000e-90UniRef50_A0A1W9HT52 Agmatinase n=1 Tax=Proteobacteria bacterium SG_bin7 TaxID=1827384 RepID=A0A1W9HT52_9PROT  ali  27  31....DYDVGIFGIPFDGASYRSGCRFGPSKIREVSSLGRGYHWGREINFFEKIKVADIGDSPTVPVDQKL-----CFERVEKFVADVLKNKKKFISVGGDHSTTLPILRQLKKKYKPLRLVHFDAHLDSYPAAWGF-EYHHGTFVRHAVEE---------------KLIDPKISHQIGIRGPLAGDLDFVKKTKINVHTVDDIRDD-----FKKVLKDLDKFGDEPTYISFDIDCLDPAYAPGTGTPVIGGLTTYETQKILRNF-KIKNLVGADIVEVSPPYDHADITALAAVDTMFEIL...................... 303
273 1.000e-90UniRef50_A0A1I1HD76 Guanidinopropionase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I1HD76_9RHOB  ali  25  38....EVQVGLIGVPWDGTTNRPGPRHGPRQLRDMSTMIRAQNGATGVRPFERINCADLGDVSP-----NPADIQDSMARITTFYDAVREAGVLPLTAGGDHLTSLPVLRALSK-PAPLGMIHFDSHTDLFKDYFGGTQYTHGTPFRRAVEEG---------------LLEPKRVVQIGIRGYDDEDRDFADAVGIRVIPIEEFHARGPEDVMTEAKEIV---GTSPTYISYDIDFVDPAFAPGTGTPEVGGPNSHQAL-LVARLLEGVNIAGADLVEVSPPFDPSGGTAFLAVSIMFEILCNM................... 314
274 1.000e-90UniRef50_A0A2H0WI42 Agmatinase n=2 Tax=Bdellovibrionales TaxID=213481 RepID=A0A2H0WI42_9PROT  ali  24  34...EKFDVALFGIPYDGGSYRPGARFAPTEVRNASSLGRGFHWNRELNIFEQLKIADVGDCPTVPIDQN-----QTYEKIEKFVGSILKTNKKFVAVGGDHSTTLPVLRALKKHYKPLAFVHFDAHLDTYPAAWG-CEYHHGAFARHAVEEG---------------LVDPKKMLQIGIRGPSKEDLAFVKKHKVQVKTVDDVR----AGSLDQFLKTLPTFDNTPTYISFDVDCLDPAFAPGTGTPVVGGLTSYETQRILRAL-KIPNLVGGDVVEICPPADHADITSLVGVDVMFEMLCLM................... 311
275 1.000e-90UniRef50_A1CGK0 Arginase family protein n=64 Tax=Dikarya TaxID=451864 RepID=A1CGK0_ASPCL  ali  25  62......DIAILGFPYDTTSYRPGARFGPRGIRAGSSRERSYNTVWGVDPFE----EELSIVDCGDIPITPFDAAHAFKQMEQGYRQVLWKHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHAAREG---------------CINKGASVHGGLRTFSPKDYEIDEQVGFHRIEAHEIDIIGVEGIIKRTVDVV---GDNPVYLSIDIDVLDPSIAPATGTPESGGWTTRELKRYIKGL-ENLNLVGADVVEVSPPYDSTAETTSVAAADLIIDILAAMAKNKKGLPAA........ 369
276 1.000e-90UniRef50_A0A2H3JBH6 Arginase/deacetylase n=3 Tax=Agaricomycetes TaxID=155619 RepID=A0A2H3JBH6_WOLCO  ali  23  78.TTAGFDIALLGMPFDTGTYRPGARFGPYAIRSGSRRQRPYELGSKIIDCGDVPVSPFDNALAVDQMEVAYSSLLARPVIGRATSKFAKDGKRIITLGGDHTIVLPILRALHKVYGPVSVIHFDAHLDTWASYPGQSRVTHGTFFYLAQEEGLMTNT----------------SIHAGIRCKLAGDLENDKAVGFQLISTDDIDDLGVAEIIKRIRARI---GDSPVYLSLDIDVIDPGLAPATGTPEAGGWTTREVKRIIRGLAGL-NFVGADIVEVAPAYDNAEITAIAAADIVHDFLSMFL.................. 389
277 2.000e-90UniRef50_A0A2K6GHV6 Arginase n=5 Tax=Amniota TaxID=32524 RepID=A0A2K6GHV6_PROCO  ali  89  1MSSKFRTIGVIGAPFSKGQPRGGVEEGPRALRKAGLLEKLNEQECDVKDYGDLTFDDVPNDSPFGIVKNPRTVGKATEQLASKVAEVKRNGRVSLVLGGDHSLAIGSICGHASVHPDLGVIWVDAHTDINTPLTTTTGNLHGQPVSFLLKELKGKVPDVPGFSWVTPCISAKDIVYIGLRDVDPGE-----------------------------------QKKRPIHLSFDVDGLDPSFTPATGTPVMGGLSYREGRYITEEI.......................................................... 229
278 2.000e-90UniRef50_A0A1Q3MJQ6 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium 55-13 TaxID=1895717 RepID=A0A1Q3MJQ6_9BACT  ali  34  2.......IDIIGVPFDLCGKRLGSRLGPAALRLAGLNQVLHDLHVEVNDMGDL---DSGVESTPGGLRNFEPLLGCLKELKARVRESLQSHSIPVVLGGDHSLPIASVAAALEVYGDIALLWIDAHADLNTPGTSSTGNIHGMPVAALLESGDVQWSQLLSSVVPHQALSPERCAWYGLRDVDPLEGLRIRQTGDLAITMHDVDRRGVVETIAWFDQWMKESGARHLWISFDVDALDPILAPGTGTAVRGGLSYRESHLVAELLRECLRLIGLDLVETNPLFDSNNET----AKMAVEWVGSLFGKTILGGKSPQG...... 320
279 2.000e-90UniRef50_A0A1C5VFB2 Guanidinobutyrase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5VFB2_9FIRM  ali  21  29.TTDDVDFVVVGIPFDTATFRVGTRFGPAAIREMSAVVKPYNPILEVGIFD-----YCSGVDYGDVGSVPGYVEESFEVITEGMLPIFEKGVIPIAMGGDHSVTLPELRACAKVNGPVALIHFDAHFDTIDQYFG-KPYTHGTPFYHAAKEG---------------LVDTSKSIQVGIREYSIEDTKNSSDLGYDYIYAADCHKMTCEEIIKRIKDRV---GDAKAFLTFDIDFLDPSCAPGTGTPIPGGFTTAQALEIIRGL-KDLNIIGYDVVEVSQPYDPNGITAIAAAGLMQEFM-SHIAWKKKHN........... 316
280 2.000e-90UniRef50_A0A254WWD7 Agmatinase n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WWD7_9CYAN  ali  22  72..PKKARYAILPLPYDGTSYQTGTRNGPRAIITASQQVELFDEEYCKE------FTAAGVMTCDPVAPEMAGPKEMHESVYQAARQVLAKKKFLIALGGEHSLTSGLVRAVKQKHKKLSVLQIDAHADLRAEYEG-TPYSHAAVMRRVVEMGIP-------------------VVAVGIRNYSLGEHQFMKKHGIKPVSVREVRTN------ADWLQQVVERLTDNVYVTIDIDGFDPAYAPGTGTPEPGGLDWFQVTDLLKATAMFRNIVAADVVEVLPQPG-TAQTEFLAAKLVYKLIAHIEANRRR............. 346
281 2.000e-90UniRef50_A0A2I0N2Z6 Arginase n=17 Tax=Clostridiaceae TaxID=31979 RepID=A0A2I0N2Z6_9CLOT  ali  31  2......KIDLINIPLFYGCDRPGVEEGPKVLSDNGLKNLLTEYGNEVVREETIDVPPCSEEDAHPQIKYLESVKTTNEALAQRVEAALKEGLLPFNIGGDHALGMGSLAGISCALGNVGVLWIDAHADINTPQTSPSGNSHGMPLAVSMGEG---LEELCNLHFKGQKVHPNNCFIIGARSVDDGEVALIDRLGINVWYMEELRERGMAAIIRELFTILDQRGLKDLHLSYDIDSLDMSLVPGTGTPVPNGMNLDESQELISAILQSGKVRSIDFVEFNPKRDHEDQVTLHSCLTMLRAFAQALG................. 301
282 3.000e-90UniRef50_A0A2T9XAG4 Agmatinase n=1 Tax=Acidianus hospitalis TaxID=563177 RepID=A0A2T9XAG4_9CREN  ali  26  30...SDANIAIIGVPWDLATSRPGARYGPLGIRNASSFILPYNYVLDINPFEVTKIVDYG-----DVEVHAGYIEDMFNEVEKEVKEMLKKNSIPVVLGGDHSISLPIIRGLSSKYKKVAVIHVDAHHDSLDIL-YGKKYDHGTIFRRGVEEG---------------VIIGESSVHYGVRVFSKEDMESVRALGYDLLTMKIIDEEGLSKTVEQLKRKV---GDQPVYLSIDIDVMDPAYAPGTGYPDPGGLTSREILEFVRKLYGL-NIIGMDVVEVSPPYDVAEITSTLAASIVFE........................ 306
283 3.000e-90UniRef50_I2JQM8 Arginase family protein n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JQM8_DEKBR  ali  24  42LSPESYDIGIIGVPFDTTSYRPGARFGPQAIRLASQRINPYQNWASLVDCGDIPVTPMDNKVALDQM------TAAFEELLLRRNSSLGDAHPPVALGGDHSIILPHLRALHEVYGKIAVIHFDAHLDTWTPXKYPSFWS--------SEQSKFTHGSMLWMAKKEGILSDDYNVHVGIRGVSWEDFDEDDDQGWLRFSADDVWKQSLDQIVASIKKRIPAHY--PVYISVDVDCMDPGFTPGTGTIEPGGMMPREVIYLLRHL--DLDLVGADVVEVAPAYDQAEITATNAAQVVFELVTTMV---KRGKPLPVR...... 359
284 4.000e-90UniRef50_A0A235E5Y8 Agmatinase n=2 Tax=Sphingobacterium cellulitidis TaxID=1768011 RepID=A0A235E5Y8_9SPHI  ali  25  79...SKYDVAFVGAPFDGTTFRPGTRFGPEAMRQISKLYRTYHFEAGIDLAESISMCDLGD------IYSIHNLEKHNAQLEKALHHIISNGVFPVVLGGDHSIAYGTLRGVAKAEGKVGVIQLDRHLDMQPSEMDEK--MHDTPLFHASKL---------------PNIDGKNIVQIGIGGWQNDVKGSIKKNGNTILTMADVDEYGIAKIAEIALEKAWADGVKAVYLTVDIDSVDSGISMGTGWPEPGGFLPREILQLVKKLAE-PGLIGMELVEVSPPYDHHNQTALMGTRIICDTLSSLVVNKRLGK........... 366
285 4.000e-90UniRef50_A0A0L0D619 Arginase n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D619_THETB  ali  37  1................MGAGRRGVDMGPSALRLADLFTKLAELVSSVTDTGNIHVPTREEDDKVVNARNHRPIGAAVASLTEVVEDIVTRGSVPLVLGGDHSLAAGSMSGTQRARAKAGLLWIDAHMDMNTPETSPSGNLHGMPLAALLGLEVPGLS--AAVGGPDGMFDPSRVACVGIRDVDPAERDNMAKLGLNVFTMSSIDRHGMANVMERALNIIAPGVADSFAVSFDADSLDPSVAPGVGTPVPGGISFREGHLIMEMLARHGGMCGLDVVEVNPVLDTRNATAKVAVQ----MVLSAFGQT............... 303
286 6.000e-90UniRef50_A0A1Y1N607 Arginase n=2 Tax=Photinus pyralis TaxID=7054 RepID=A0A1Y1N607_PHOPY  ali  42  1..................................................................MLMYEHMVACTKVLSKQVTRVLNDGRICLTLGGDHSIALATVDGHLQAKSDVAVLWIDAHADINTNLTSDSGNLHGMPVALLAKELSDYWPYLPGMDWQKPVMSIRNIGYIGLRSVDSFERLLIDNLGITAFGMEEIEKYGIHQCVHMALDRIDPTHTKSLHVSFDIDSIDSLEAPSTGTPVRGGLTLREGIHLMEIVHKTGRLNAIDLVEVNPSIG-TGHDVALTVSAATHIITAAFGYSRKGLRPKVHDLPPPS 258
287 7.000e-90UniRef50_A0A1M5C026 Arginase n=6 Tax=Rhizobiales TaxID=356 RepID=A0A1M5C026_9RHIZ  ali  32  9.....RSIDIFGIPTDAGASCRGDGMGPEALRVAGLLDTLAALGHTVSDHGDIVWHERPAPNAQSPWRRQADVLALAAQSCQRAQASLQAGHLPVFLGGDHSLSMGTLGGVARHGKPLFVLWVDAHGDFNTPETSTTGNLHGMPLALLCGE---PDFGPEFDGPWRGAIDPRNVTIFGARSIDRPERTLLEARGVDVMDMRRIDEMGAVALMRGVIERVEAV-DGHLHVSLDVDVMDPSIAPGAGTPVAGGLTFREGHLAMEMLHDSGCVSSVDIVELNPFLDHAGMS----ARLLVDLAASLFGR................ 309
288 8.000e-90UniRef50_A0A076K4V5 Agmatinase SpeB n=32 Tax=cellular organisms TaxID=131567 RepID=A0A076K4V5_9RHOB  ali  22  65......DVVIMGIPMDIGTSRSGTRFGPKQIRQESAMIRPYNLQTGAAPFDSLQVADMG-----DVAINTFSLAESLRIIESAYDGLHDYPVVPATLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVNDEMFGERE-THGTVFRRAYEEG---------------LLVPDLVYQIGLRGYTAEDFSEAAGWGFNMITAPEIWHKSLTPLGQEIRQAI---GDHPCYLTYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRALRGL-NIVGFDMVEVSPMYDTSGNTALTAANLMFEILSILPG................. 341
289 9.000e-90UniRef50_H2C483 Agmatinase n=2 Tax=Metallosphaera TaxID=41980 RepID=H2C483_9CREN  ali  26  39...ERPKAVFIGIPFDATTYRPGARFGPMGVRDGSRLLRPYNPFQGVYPFDELNACDAGDVDT-----VPGHIEDTMKKVEEGLLNILVF-STPFIVGGDHSITLPVLRAVHKVHGRVNLIHMDSHYDFWDSHWG-KKYDHGTWLRRALEEGLL-----------------EEVVQIGIRGFSHEDVEDSKRLGITSFSIREVKKN-WGEVMDRVKA-----LRGPTYVSFDIDVVDPAFAPGTGTPEVGGLTSFEALELVRGLP--VELVGFDVVEVSPPYDVSELTTMLASNLIYEAMSLKARLERRGS........... 317
290 1.000e-89UniRef50_A0A2W4KHT1 Arginase n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4KHT1_9BACT  ali  34  41.....RPVSLIYVPLHLGGSHRGASMGPAAMKVAELPERIKALGFAVAEEIDIEVHSVCWWDNETQSKCVPEIYQVSEAVADAVEAAMEAGNLPITIGGDHSLAIGSIAGAASYYRKFGLVWFDAHGDINTPDTTASGNVHGMPFAVSLGLGDEKLVNLKGFS---PKVPAKRSSLIGIRDVDPPERDMITQTGITAFTMKEIDHLGLGRVTDMALGAVGAD-VNGIHVSFDIDVIDPDVAPGVSTASRGGLSYRESHLALELLAESDLVRSIDIVELNPAFDVRNKTAELAV----ELILSALGKR............... 339
291 3.000e-89UniRef50_A0A225B0U1 Putative agmatinase 2 n=10 Tax=Pezizomycotina TaxID=147538 RepID=A0A225B0U1_9EURO  ali  26  77.....YDIAIIGAPFDTASYRPGARFGPRAIRAASARINPYLSWATLLDCGDIPIT------PFDNALASRQMYEAFLELGTRPVASSKNNQRPVTLGGDHSVALPALRALYQIYKPITVLHFDAHLDTWNPVRYASYW--------LSEQSRFNHGSFFHIASSEGLISNTTSAHAGIRGVDDSDYTTPGEQGFMRIHADDIDDIGTRGVIDAIIERIGLDSEQPVYLSVDIDVLDPATAPGTGTPEPGGWTTREMIRILRGIEKL-NVVGADIVEVSPSYDNVGETTALAAQVAFEIITSMVKAGVEGPGEQLGGW.... 397
292 3.000e-89UniRef50_Q4WHD9 Agmatinase, putative n=118 Tax=Pezizomycotina TaxID=147538 RepID=Q4WHD9_ASPFU  ali  26  65...ERYDIAVIGAPFDTASYRPGARFGPRAIRAASARINPYSSWATVKDCGDIPITPFDNGLAERQMYEAFLELGSRPAVTPAAKGISAGKAKLVTLGGDHSIALPALRALYQIYKPITVLHFDAHLDTWNPWTSESHFNHGSFFHKASREG---------------LICNSTSAHAGLRGVDDSDYTAPNEQGFMRIHADDIDELGPMGIVDKIIERIGRDPEQPVYLSVDIDVLDPSTAPGTGTPEPGGWTTREFIRILRGIEKL-NIVGADIVEVSPSYDNKGETTALAAQVAFEIITSIV.................. 382
293 4.000e-89UniRef50_A0A1H9BWP0 Agmatinase n=5 Tax=Streptomyces TaxID=1883 RepID=A0A1H9BWP0_9ACTN  ali  25  45....GRDVVVVGAPYDGGSYRPGARFAPRAIRHESCLI----HGTGI-DRGPNVFELIDVVDGGDIDLSPFSMDLAMETATEALTALLDDNAAFLMLGGDHSLSLAALRAVRHKHGKVAVLHLDAHSDTNPPVYGGT-YHHGTPFRWAIEEG---------------LIEPAHMVQLGIRGHNPDSLDYARGHGVRVITAQECADRPLADVAAEIRAVV---GDLPLYVSVDIDVVDPAHAPGTGTPAPGGLTSREVLSLL-TLVGDLNPVGFDVVEVSPPYDHSGITALLAAEIGAELLYYARGTGRTRTPAPPRKKPEPK 341
294 5.000e-89UniRef50_U1MUQ6 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=U1MUQ6_9MICO  ali  23  72...EHADVAVVGIPFDGTSFRPGARFGPAHVREHSRQLHPYHQVHESFPFRDQQV-----VDGGDLRVGPYDIEAAVEAIHEQARALVQGGTTVVAIGGDHTIALPLLRAAAERHGPLAVLHFDAHLDTWDTLHGAS-IWHGSPFRRAAEEG---------------LLDLERCQHVGIRGYDPSELDDDARVGFAIIRSDDFARHSPEQLAERIRDRL---GTGQVYVSIDIDVLDPAHAPGTGTPEVAGISTRELFGVLRELRGLD-IVGGDVVEVLPAHDHAGITGLAAAHTVWELLALI................... 349
295 5.000e-89UniRef50_Q10088 Putative agmatinase 1 n=319 Tax=Eukaryota TaxID=2759 RepID=SPEB1_SCHPO  ali  22  70.KSQSFDIAFLGAPFDTGSYRPGARFGPSGIREGSRRLNLYNNWAKIVDCGDIPLTSYDNAVAIKQIENGHFELLTRKPTSEKDGYALDGSVLPITLGGDHTIVLPILRSVSRAYGPVSIIHFDSHLDSWKPKVFGGGINHGTYFYHASQEG---------------LVSNDSNIHAGIRTTLSGDYDNDADCGFEIIEAREIDTIGIDAIIKRIRDRV---GDGIAYLSIDIDVLDPAYAPATGTPESAGWTTRELRTILRGLDGI-KLVGADIVEVAPAYDFAEVTTLAAADILFEVMSIMV.................. 378
296 6.000e-89UniRef50_A0A168NCE5 Uncharacterized protein n=11 Tax=Mucorales TaxID=4827 RepID=A0A168NCE5_ABSGL  ali  22  81...EDYDIAVIGAPYDIGTFRTGARFGPSAIREGSKRIKGFNYEIKVNPFK----SWAKLVDCGDIPFEPFDAEHAMGQIEAHAKYVLQRPPKPVTLGGDHTILLPVLRAMHAAYKPITVIHFDSHLDTWAPEIYNSRFNHGNPLYHAAKEGLTTNGT---------------SMHVGIRSYDEEDIQRDEALGFRMVKANDIFTMGVEGMVERIKEVIGPKEDTLLYLSIDIDVIDPSMAPATGTPESGGLLTRELKYILRGLNGYD-IVGMDVVEVAPAYDTQAQTSFLAADLIYEIM-SMMVKR............... 383
297 7.000e-89UniRef50_A0A2D6RQ66 Arginase n=3 Tax=Bacteria TaxID=2 RepID=A0A2D6RQ66_9BURK  ali  34  2.......ISLIGAPCDAGANMAGAALGPCALRRAGVQQGLQKIGCKVIDRGDLKIPTSEPHVEVQGYRNFHEVLAWNRAVYAAVADALNVGDIPVLLGGDHSLAMGSISAVARQNKELRVLWLDAHADFNTANTSITGNMHGMPLTALCGQGPSELTELAGFA---PALRASQIRLLGVRSVDPEERRAVRRAALPMLTMRHIQGRGIIQAMNIALSDIEP--GTHLHVSFDVDCLDPLVLPGVSTPEDGGLQLDSLRYCMARIAQTGCVGSVDLVELNPAADPTGSSAQRAVELLTVLL...................... 293
298 8.000e-89UniRef50_A0A1Z5HDB5 Guanidinopropionase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z5HDB5_9GAMM  ali  24  38..AEYVDIGLIGVPWDGGTYRSGARLAPRQVRDASTFMRNMHNTLKIKPYELCNCADLG-----DANINAVNLLESLQWVEDFYHQVLSKDIVPLSVGGDHLVSLPILRALAK-NQPVGMVHFDAHTDMFSGFSGNSSFSHGTPFYHAINEG---------------LLDPKRIVQIGIRGYTEEDRLWGLEKGVRIIDMEECTDLGTEGILIEIKKVI---GDDETYLSFDIDCLDPAFASGTGTPEIGGFTSIEAQHLIRGLHGS-NLIGADLVEISPPYDQSSNTALVGATLLFE-ILCLLADRKQKR........... 323
299 8.000e-89UniRef50_A0A255I8J2 Arginase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A255I8J2_9FIRM  ali  31  2......RINLIGVPIYYGCDREGVQYGPKKLRENNISDIFREAGLNVIDLGDIQVDKIKNEDRFKDDKNIKSIYKVNNNLAQVTYDSVKSGNIPIILGGDHSIALGSISGVSRNFKNLGVVWVDAHGDFNTEEISESKNYHGMPLASLAGFGKKNLVDL---YYEGKKIKEENIFHIGARDLNIKEEELIRSTKVNLYDKVMIDNKGFDFVLEDIVKKCIEQKIDAIHISLDIDFMDKDLVPGTGTRVEGGYTLEDTKHILDRIMSTNIVKSMDFVEFNPIIDEENTTLDVCIDLLNHIALLFSLEKRLSNEVQ........ 309
300 1.000e-88UniRef50_V5FMH2 Uncharacterized protein n=1 Tax=Byssochlamys spectabilis (strain No. 5 / NBRC 109023) TaxID=1356009 RepID=V5FMH2_BYSSN  ali  24  65..SEPLDIAILGFPYDTTSYRPGARFGPRGIRAASSRERSYNSPWGVDPFE----QGLSIIDCGDIPITPFDAEHAFKQMEQGYRQILYHGPRVLSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHASREG---------------CISKGTSVHGGLRTFSSKDYEIDQDVGFTLIEAQEIDEIGMEGIINKVRATV---GDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGLEG-VHLVGADVVEVSPPYDTAETTSIAAADLLVDILALMV.................. 367
301 1.000e-88UniRef50_I2K389 Arginase family protein n=20 Tax=saccharomyceta TaxID=716545 RepID=I2K389_DEKBR  ali  21  149...EKFDIAVVGAPFDTGSYRPGTRFGPTGIRMGSRRLNPYSNWAKIVDCGDPPVTPLDNRIALDQIYRAERAIRNHK----TTGKSKQKAPKVFTLGGDHTITLPAVKAAYEKYGKISVIHFDSHLDTWNPYTSYQAMNHGTYLHWAHEKGYXS----------------DNCIHAAIRGPYPGDVQHDIDCGFDRILARDIDKIGADGIIKKIKERIGST-DAPVYITVDVDSMDPAFTPATGTVEPGGWSSRELLTVLDGLEGL-NVVGGDVVEVSPPYDSAEITSLAAAQVADSIISLMV.................. 446
302 2.000e-88UniRef50_A0A0N0NHT7 Arginase n=1 Tax=Phialophora attae TaxID=1664694 RepID=A0A0N0NHT7_9EURO  ali  48  986..............................................VEDCHESRPSWSWEDAPHRGMKNPRSVSAVTKELAGKVYEQAKEGRMVVTLGGDHSIAVGTVAGTSKAGKEVAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLAREDREDVFGWLGEKPALSVSKLVYIGLRDVDRGEKRILRENGIKAFSMHDVDRHGIGRVVEMALAHIGT--DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDYIAECVHETGQLIAMDLVEVNPSLEVAG--ASETVRAGVSLVRCALG................. 1252
303 2.000e-88UniRef50_UPI0005D25114 agmatinase, mitochondrial n=1 Tax=Takifugu rubripes TaxID=31033 RepID=UPI0005D25114  ali  26  73.TADGLDAAFVGVPIDTGTSRPGARFGPRQIRVESAMLRAYNSGTRAAPYQSIRVADIG-----DVNVNLYDLQDTCRRIRDAYRTILAAGCTPLTLGGDHTIAYPILQAVAERHGPVGLVHVDAHADTSDLLLGE-KIAHGTPFRRCMEEG---------------LLDRERVVQIGLRGYSADAYEWSRAQGFRVVPVEECWYRSLTPLMAEVRSQM---GAGPVYLSFDIDALDPGFAPGTGTPEIAGLTPIQGVEIIRGCRGL-SLVGCDLVEVSPAYDT---TVPAAAR............................ 340
304 2.000e-88UniRef50_Q9I6K2 Guanidinopropionase n=69 Tax=Proteobacteria TaxID=1224 RepID=GPUA_PSEAE  ali  25  37.......VGLIGVPWDGGTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLG-----DAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGR-ERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEG---------------LLDPLRTVQIGIRGYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVV---GAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLD-LVGADVVEVSPPFDVGGATALVGATMMFELLCLL................... 310
305 2.000e-88UniRef50_UPI000688AB93 agmatinase n=1 Tax=Ensifer aridi TaxID=1708715 RepID=UPI000688AB93  ali  27  33..SSELDIAISGVPFDLGTFRIGSRFGPACVREQSRHVRRIHQTFGFSPFDLCRVADVG-----DAPVRSFSIRDSLALIEDHFRKIKDLEITPLTIGGDHTISLPILRGIVQ-HGPIGLIHIDAHSDTLDSIQGEQ-YCNGTPFRRAVEEG---------------LVDPKRLVQIGIREFDKDDHDWAKANGIRMISMNEIDQRGLEAIVEETRSIVAE---RPCYLTLDIDSLDPSVAPGTGAVEPGGFTVREMERLLEGLMG-VDLIGADIPEVSPLYDEGGRTGRVAATLAFDLL-CLLAKAHAARQR......... 319
306 2.000e-88UniRef50_A0A0T5ZHV7 Agmatinase, agmatinase n=11 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0T5ZHV7_9CHLR  ali  27  54......DVAIVGAPFDDASHRSGARFGPRAIRQATYTDGEHSLQLDVEPW-----AELDVVDAGDANIVPAWLERAHAVIYRKVRDVAACGAVPIVLGGDHSITWPSVTAVAEAVRRIGIVHFDAHADTAPDDWGV-LAGHGTPMRRLIESG---------------AVLGKNFVQVGLRGYWPEVFAWMQAQGMRWHKMREIEERGAEAVIDDAIAE-ALDGPDMIYLSLDVDVVDPGMAPGTGTPEPGGLLSRELLRAVRRIVGRVELAGMDIVEVSPPYDHAEITAMLGHRAALEAISALAVKKRDGRRV......... 343
307 2.000e-88UniRef50_A0A1V6JGP7 N(1)-aminopropylagmatine ureohydrolase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V6JGP7_9BACT  ali  26  15...KSSKIVVLPIPYDGTSTWKGSDKGPEALLEASANMELYDIETDSEVYLH------GIHTAPAVSEN-KSPEDMVQAAEKEALKYIDSGKFLVTIGGEHSVSIGPIQAHAKRYKNLSVLQIDAHTDLRDSYQG-SKNNHACVMARAQELCP--------------------IVQVGIRSMDSGEMERLDRN--RVFWAHHIARG--DEWMDKAIDLL----TDNVYLTVDLDGFDPSILPSTGTPEPGGLQWYQALSFLKKLVERKNLVGFDIVELCPNPYEKSSDF-LAAKLLYKILSYKFAKA............... 282
308 2.000e-88UniRef50_UPI0006D78523 arginase n=2 Tax=Clostridium sp. ND2 TaxID=1347366 RepID=UPI0006D78523  ali  31  5.........IVGIPLHYGCDRFGVEKGPNKLRENGLIEIFEKNGNEVYDLGNLIVPERPASEKGTHMKWVTPIVKCNEELAEVVYSSHKAGAFPFSVGGDHAMGLGTVAGSSKAFGDFGVVWIDAHGDINTEESSPSGNIHGMPLASSMGFGSER---LKNIFFEGKKVDPSKVFLICQRDLDPGEVDMIKEYNINYWSSADIRERGMDVIMKEVVARMEKVGVNNFHLSFDIDSMDANLVPGTGTPVYDGINVHDTEYMLQQLFKTGKIKAMDFSEYNPGLEYT-VTTDNCIKIL.......................... 291
309 3.000e-88UniRef50_Q81JT1 Agmatinase n=646 Tax=cellular organisms TaxID=131567 RepID=SPEB_BACAN  ali  23  18.SFEESEVVIYGMPMDWTSYRPGSRFGPARIREVSIGLEEYSPYLDRE------LEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDAGKFPLGLGGEHLVSWPIFKAMAKKYPDLAIIHMDAHTDLRESYEGE-PLSHSTPIRKVCD-----------------LIGPENVYSFGIRSGMKEEFEWAKEVGMNLYKFD---------VLEPLKEVLPKLEGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKELLDSIVAIANSNNVVGADLVEVAPVYDHSDQTPVAASKFVREMLL..................... 286
310 3.000e-88UniRef50_A0A088U2K6 Agmatinase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A088U2K6_9BURK  ali  24  37.......IALVGVPWDGGTNRAGARHGPREVRNQSSLMRRVHHVSRIAPYDLVRVGDLGDAPT-----NPIDLLDSLARIERFFRRIDAAGAVPLSVGGDHLVTLPIFRALAAR-RPIGMVHFDAHSDTNDRYFGDNRYTHGTPFRRAIEEG---------------LLDPQRTVQIGIRGYSADDEAFARDCGIRVIAMEEFTALGVAATLAEARRVV---GSGPTYVSFDVDVLDPAFAPGTGTPEIGGMTTLEAQHLVRGLQGL-NLVGADVVEVSPPFDAGGATALVGATMMFELLC..................... 308
311 3.000e-88UniRef50_L9WF24 Arginase n=2 Tax=Natronorubrum sulfidifaciens TaxID=388259 RepID=L9WF24_9EURY  ali  35  1..............MDYGADRRGVDMGPSAIRYAGLADGLSDAGVEPVDAGDLSIPRAEERDPDGTAKFLREVEDVCTRLADQVQATLEAGEFPLVLGGDHSVSIGSMQGSARR-ADLGVIWFDAHADLNTPETSPSGNVHGMPLAATLGRGAFDESAWAHAPRVRPRVRETSIAYVGLRSIDERERTLLRDSEMTAFTMADIDDRGMTSVVDDALD-IATTGTDGVHVSLDLDWLDPKTAPGVGTPVRGGVTYREAHAALEAVSRRHLLRSMDVVEVNPILDEGNETATLAA----ELSASAFGNR............... 326
312 4.000e-88UniRef50_A0A125STW8 Guanidinobutyrase n=9 Tax=Bacteria TaxID=2 RepID=A0A125STW8_9CYAN  ali  26  35..PADVDVAIVGLPFDTGTFKVGARFGPEAVRGASALLRPYNPELDVMVFETLSCVDYG-----DAPVVPGFIEDSLDAIARTIQPLAEAGVIPLSIGGDHSVALGELRALAAVHGPLALVHFDAHGDYWDSYFGH-KYTHGTPFRRAVEEG---------------LIVPEASVQLGMRGYDSDDLDTPRRAGFTVLTTTQLMRHTPEEIGALVREKV---GDRKAFLSFDVDFFDPAFAPGTGTPEVGGPTSFQGLGYLRACTGL-TWVGGDVVEVLPAMDHSQVTAHLGAQIGYEFL-SLVALSKR............. 318
313 5.000e-88UniRef50_A0A0M9VQ94 Agmatinase n=1 Tax=Malassezia pachydermatis TaxID=77020 RepID=A0A0M9VQ94_9BASI  ali  23  53....DFDVAVLGVPLDTASYRPGARFGPRAIRAGSARFRSFNPALGVNPY----VSKTKFLDCGDIPVTPFDNELAFQQIEDAYDDLLKQHPRMAVMGGDHSIALPILRSLNKVYGPVSVLHFDSHLDTWAPNTGISGYTHGTMLYHASQEGLVSNTSM----------------HVGLRGLDFEDYRRDASLGFTYLETWEVDQLGLDGTVAAIRERL---GDSPVYLSIDIDVLDPSIAPGTGTPVSGGLTSRELRSIIRMLSGI-NLVGCEVVEVSPPYDTNGETALAAAELLYELM-SVMAIHPLDKVTVEPQARPPR 392
314 5.000e-88UniRef50_A0A094IAD1 Uncharacterized protein n=4 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094IAD1_9PEZI  ali  23  629.....YDIAVIGSPFDTASYRPGARFGPRAIRAASARFNPYTSWATIKDCGDIPI------NPFDNELALRQMTEAFVELAHRPSKSGTQKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHPAKYPS--------AWSSEQSQFNHGSMYWIASNEGLIANGSSVHAGLRTRLSGDYDDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGTEI--PVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVDGL-NVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMV---KRGLTVAK....... 937
315 7.000e-88UniRef50_A0A2T7NAZ9 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NAZ9_POMCA  ali  23  56.TTQGLDACFVGVPLDGTSNRSGARLGPRHIRQESSLLRQANPMLGTIPFDSIQVADVG-----DVCMNIYDLPTAVKQIKAAFDKLIVNGCVPLTMGGDHTISYPILQAIKDKYGPVGLVHVDAHADVNDTMLGA-KIAHGTPFRRAFEYGS---------------LDGRRVIQIGLRGYDLDGYKWSTEQGFRVVPASDCWNKSLKPLMTEVRSMM---GSGPVYLSFDIDSLDPCFAPGTGTPEIAGLTIYQALEIIHGCQGL-NIVGADLVEVSPPYDVGSMTSLTAANLLFEMLC..................... 333
316 7.000e-88UniRef50_A0A2C9T1L7 Agmatinase n=14 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A2C9T1L7_9MYCO  ali  22  49......DVAIVGAPFDATTNRPGARFGPRAIRSTAYEPGTYHMDLGLEIFDWLEVVDFGDAWCPHGL-----TEQSHANIRERVHTIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTADIIDGN-LASHGTPMRRLIESG---------------AVPGTHFVQVGLRGYWPPQFEWMQEQGMVWHTMQEIWDLGFKEVMRRAVGEALAKADK-LYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEHDVAGVDVVEVAPAYDHAELTVNAAHRVVFEALAGMAARRRDAANAKPGPPSPL. 346
317 8.000e-88UniRef50_A0BHR2 Arginase n=2 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0BHR2_PARTE  ali  33  11.......VGLFGSAVHEGQTKTGTELAPRALREGGLISALYNLGWEINDMGDIQGKNYRLHNVSQQFRNSQQIGVINGEINKKSFDIAKQNKFMLNIGGDHSVASGSIHGLLQHYGDLRVVWVDAHADCN-YEIGPNRNYHGMPLAHLYG----------SIVEPIKRLDPKNLIYVAIRDIDPMEREFIRDQKIVYYGMDEIIELGIGQVMNRILKQFE---GKPIHVSFDVDSIDPEFAHGTGTLVDGGITYREAHYLLRKLASSKQLVGMDLVEVNPQLETTRIQGTQTVALGIELIASALGRT............... 313
318 8.000e-88UniRef50_O42887 Putative agmatinase 2 n=13 Tax=Dikarya TaxID=451864 RepID=SPEB2_SCHPO  ali  23  86..SEDFDIAIIGVPFDTASHRPGARFGPKGIRSASLNVNPYESWAKILDCGDIPVSSYDNQLAVRQMTEGYIDLLSRKATASKTAGLAKDGIFLITLGGDHSIGLASLRALGHFYGNVSVIHFDSHLDTWNPKRYYPSYWH-------SDRADFTHGTMFWMASKEGLINNGTSIHAGLRGTDYYDYEEDNRVGFTFIEAQEIDEIGVNGIVERIKQVV---GDTLVYLSIDIDVVDPGLAPGTGTPETGGWTTREMKSILRKLDGHLNLVGAEVVEVSPPYDDRAESTSLAADFIFEILSSMV.................. 404
319 9.000e-88UniRef50_A0A1G7URZ5 Arginase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1G7URZ5_9PROT  ali  34  7...DHRSIALIGAPGDVAAAHRGASMGPEALRVAGMTEALAEIAGEVVDWGNLTGPSHPGHAPVDGLRHLPETATWCRGVRDTVGEALATGRIPVLMGGDHALSMGSLAHCRAAGKPLRVLWLDAHADFNTPETSVSGNLHGMPVAVAAGLGP---PELTGLSDATPMVPAARFHQIGVRAIDRLEKRTVAAHGLPVADMREIDERSIRPVMEEALAHATAEG-AHLHVSFDVDMLDSSVAPGVGTRVKGGPTYREAQLCMEMIHDTGLLASLDVVELNPAFDVHNATAETAV----EMVKSLFGERILSRRPQ........ 313
320 1.000e-87UniRef50_A0A060T991 ARAD1C42174p n=8 Tax=Saccharomycetales TaxID=4892 RepID=A0A060T991_BLAAD  ali  22  50...ESFDIGVIGVPFDTASYRPGARFGPRAIRAASMRINPYANWAKIIDCMDMPVTPV------DNKIALTQMTAGYKELLKRPVAYTANGPRLITLGGDHSIVLPALRAYHEVYGPITVIHFDAHLDTWLPSWGDTEFTHGSMFWMAAQEG---------------LLDKDHCVHAGLRGVDWADYESDDQSGFARIGSDEI--MGVQGVVSKILDRV--PKDVPVYISVDIDVIDPGMAPGTGTPEAGGWLTRELIQVIRGLSGL-NIIGADVVEVSPAYDHAEITALAGAQIAYELITSMV.................. 351
321 1.000e-87UniRef50_A0A2M7T598 Agmatinase n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T598_9ACTN  ali  23  28.SFEESKVVVVPIPYDSTSYRAGTREAPVAVINASRQVEFYDEELETEIYDKV-----GIHTLNEIMPNMEGPRHQIEVVRRVLLDMMEAGKFPVTIGGEHSITLGAVQAVKDFFPQVSVLQLDAHTDLRKEYE-DTQYSHACVMRRIFDEGV-------------------RIAQVGIRNSSKEETRFIKANNIFSVSARQ-YRYGYYG-IEEIVDALSDD----VYITIDMDVFDPSEVPAVGTPEPGGLSWYEVLDILREVTFHKRVVGFDVVELCPIPGNPASDF-LTAKLIYKLIGYCF.................. 299
322 1.000e-87UniRef50_A0A0J6NP84 Agmatinase n=43 Tax=Proteobacteria TaxID=1224 RepID=A0A0J6NP84_9NEIS  ali  23  42....GADVVVSGIPLDLTTFRSGARLGPQAIRAASVQLA----ELSPFPWGFNPFDELAVVDYGDCWFDAHNPLTIKPSIIEHARTILASGAKMLTFGGDHFITYPLLIAHAEKYGPLALLHFDAHCDTWPDDEPDSLN-HGTMFYKAVKEG---------------LVDPRKSVQVGIRTWND---DFM---GMNVLDAPWVHDNGVDVAIARIKEVI---GDSPVYLTFDIDCLDPAFAPGTGTPVPGGLSSAQALKIVRNLGDL-NIVGMDVVEVAPAYDNSELTAIAAAHLACDMLCLM................... 312
323 2.000e-87UniRef50_A0A094GW84 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094GW84_9PEZI  ali  23  417.....YDIAVIGSPFDTASYRPGARFGPRAIRAASARFNPYTSWATIKDCGDIPI------NPFDNELALRQMTEAFVELAHRPSKSGTQKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHPAKYPS--------AWSSEQSQFNHGSMYWIASNEGLIANGSSVHAGLRTDGWDDYDDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGTEI--PVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNVDGL-NVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMV---KRGLTVAK--VPSPK 730
324 2.000e-87UniRef50_K4Z987 Agmatinase SpeB n=58 Tax=Firmicutes TaxID=1239 RepID=K4Z987_PAEAL  ali  22  19..YEGAKAVIYGMPMDYTSFRPGSRFGPGRIREASVGLEEYSPYL------DRSIEELNYFDAGDLLLPFGNAAKSLDIIGEFVGKLLSDGKFPIGLGGEHLVTWPVLQEVYKKYPDLAIIHIDAHADLREQYEGE-PLSHSTPIRKAAEM-----------------IGGKNVYQFGIRSGSREEWTYARE-NINFFPFD---------VAEPLKKVLPELAGRPVYVTIDIDVLDPSCAPGTGTAEAGGITSKELLEAVHSIARSDNVIGCDLVEVAPIYDPTEQTPITASKIIREMLLGFV.................. 288
325 2.000e-87UniRef50_A0A0K2SLE4 Guanidinobutyrase n=2 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SLE4_9FIRM  ali  24  29..TDGVDVAIVGLPFDTGTYRVGARFGPAAIRAASQMLHPYNPATGVDLTERLSAVDYG-----DLRVVPGAVERSHALLADGLEPLHRNGLRVIGLGGDHSVSLPHLQAAASVHGPLALIQFDSHSDLWDEFWGERRN-HGTVIRRALEEG---------------FIDPSASIQVGLRGSNRAESAFSREFGFAVLSTADLRHRPLREAPRKIRERV---GERRSFVTFDVDFVDPAFAPGTGTPEVGGFSSWETLELLRGLSGI-EFVGFDVVEVIPAYDHASITALLAATVVHEMLGLV................... 309
326 2.000e-87UniRef50_A0A160F3E1 Agmatinase n=23 Tax=Bacillaceae TaxID=186817 RepID=A0A160F3E1_9BACI  ali  22  18.NFEESEAVIYGMPMDWTSYRPGSRFGPARIREVSIGLEEYSPYLDRE------LEEVKYFDAGDIPLPFGNAQRSLDMIEEFVDRILTAGKFPLGLGGEHLVSWPVMKAVYKKYPDLAIIHMDAHTDLREHYEGE-PLSHSTPIRKIAE-----------------LIGPKNVYSFGIRSGMKEEFEWAKQNGM------YIAKF---EVLEPLKEVLPTLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLAAIHEIARSDHVVGADLVEVAPVYDHSEQTANTASKLVREMLLGWVQKRK.............. 293
327 2.000e-87UniRef50_R5W6S2 Agmatinase n=1 Tax=Clostridium sp. CAG:167 TaxID=1262777 RepID=R5W6S2_9CLOT  ali  22  26..AKDADVALYGMPFDITTNRTGCRFGPEGIRQYGQC-KPYHEELDINIFDD-----FKAVDTGDFAIPLSYVDRDMDAVENQLYELLEKGVKTIGVGGDHTLSYPELLALKRKFGKVAFVHFDSHTDTWDDENGNTLINHGTPFRLAIQHD---------------CIDMDHAIQIGMRGGTLEDHDFALEHGMQIIFGNELHEMGMSACAKRIREVV---GDTPVFVTFDIDFLDPAVAPGTGTPIVGGFTTAEALQILREGLTRLNIVAMDLVEVAPAYDPTGQTQVVANEILREFL-SILSYNKK............. 312
328 2.000e-87UniRef50_A0A2I0QP90 Agmatinase n=8 Tax=root TaxID=1 RepID=A0A2I0QP90_9EURY  ali  22  13...EDADVCIFGMPFDTTSFKPGTRLGPRAIRDASYNLEFYSMALER------NIRDIKIFDAGDTGFY-TNPQHAISEISEQTRELLKSDKFIVGLGGEHTVSYGIAHAMKEIYKDVAVIQFDAHADLRTVYDFE-KFSHACVM-----------------NLIGNDIGFENIYQFGIRSGEEEELKFAEKTNF--FP---LHKYDTAQILE-ILDELNI--DKKVYLTIDIDVLDPAYAPGVGTPEPGGITSNEMFKILNSL-KKFDIVGFDVVEVNPMVDMSGITAMLAAKIIREGIL..................... 277
329 2.000e-87UniRef50_D7G6A2 Arginase n=3 Tax=Stramenopiles TaxID=33634 RepID=D7G6A2_ECTSI  ali  38  62..TSPRTAAVIGAPAMFGQPLAGTDKSPQLLREAGLHQNLAALGWRVEEMGDVDMTGPPGGADPAAARHSLAVGAGCRRLSEAVFEKAAEGKFVLTLGGDHSIALGTLAGVLRARPDTRVLWCDAHADINSPKGSPSGNMHGMPLSFVMGLSDPSTVRGLEWETDVPVLRPERIAYVGLRDVDVYERKILQEHGLFASTMQDVDRLGIGRVMELALEALGVTGNGPLHLSFDIDAVDPKVAPATGTVVRGGLNYREAMYVAESCVETGRLGSMDMVEVN--ADLTEPSAAATVQLGLVAVASAMGSR............... 381
330 2.000e-87UniRef50_A0A059WYQ4 Arginase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A059WYQ4_9BACT  ali  35  1...................................................................................VKNILANNELPIILGGDHSIALPTFSAIQSHFREVGLIWFDAHADMNTPETSPSGNLHGMPLAHILGFGLSQLVNLEGFA---PKLNPKYFAHIGARDLDNGEKKLIRELGINCWTMHEIDRYGMNYCIEKALE-VVSQAPSGFAVTFDVDALDPLDAPGSGTLVRGGISYREAHLALERIAETNKMKSFEIVEVNPMLDRDNRTSELAV----ELILSVLGKR............... 220
331 3.000e-87UniRef50_A0A0S4J155 Arginase n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4J155_BODSA  ali  40  112.......................................................PSPKIVEKGVNCYEPFSVFATCENVRQKVAAAHDAGAFPMLVGGDHCLAMGSIAASLERQPNLGVIWFDAHADINTPLTSPSGNMHGMPLAALMNL--RDIQKAPGFEHRYPILKPERVAYIGLRDVDDGEKRLINEMGLSCFNMDDLKRYGMKELVKQVLKKLCPTGTEPIHLSFDVDGMDPAEAPSTGTPVADGVRLHEALEMIQYIRATGCLYSMDVVEVNPSLG-TEEDAEVTITNAQLVMAHTLGYT............... 361
332 3.000e-87UniRef50_D3F8N5 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D3F8N5_CONWI  ali  24  37....NADVAVLGVPFDTTSYRPGARFGPAAIRDQSQLIRPWHAALEVDVF-----ATLSVLDGGDLTVTPGNAARTAEQIHAGLRPVLEAGATPLVLGGDHSIVLGELRAQAERHGPVGVVLLDAHADTWDEYYGE-RYFHGTPFRRALEEG---------------LIDPRRSLLAGMRGYAASDLDTPREWGFEIVTCDELRTLTPAEYGRRVRERI---GDGPTFLSFDIDVLDPAFAPGTGTPEIAGLLPHEAVAFLRALAGI-RFTGFDVVEVSPQFDPGQVTALHAASIGFELLALC................... 314
333 3.000e-87UniRef50_A0A2H6EN77 N(1)-aminopropylagmatine ureohydrolase n=17 Tax=Bacteria TaxID=2 RepID=A0A2H6EN77_9BACT  ali  23  20.SFNNSKIVILSVPLEKTSYGKGTAKGPREILKASHFVEFYDEELGKELC-----FSKGICTLKPLDFENQRIETALQKIYKTVKFLINENKFVVTLGGEHSLSISPIKAYLEAYTNLSVLQIDAHSDLRDTYE-NSKHSHACVMARVAELT-------------------KNIVQVGIRAQSKEEAEFVKKNKINTFYARDICTKKFR---KDWQKKAVSKLKKNVYITFDLDGFDPSLLPATGTPEPGGLFWNETMSLLKLVGKEKNIVGFDVVELAPSKYHPASNF-VAAKLVYKILNYAF.................. 294
334 3.000e-87UniRef50_UPI000C7A8967 agmatinase n=1 Tax=Nonomuraea indica TaxID=1581193 RepID=UPI000C7A8967  ali  23  20...RPSDVVVLGVPIDSGTGRPGARFGPAAIREASALINLYHVGLETEVFEHLRIVDVG-----DVPVTPGQHERNLDAAEKWARELMSVTDRVVVLGGDHSVLLPVLRAVADKHGPVSFVHWDAHADTWDGGP-EHLLTHATAVRRVIEEGLT-----------------NQVFQIGLRGYSRETFAWAGEHGVEHWTMMDVDEAGLTDIVQQVIASV----TGKVYISIDIDVLDPSYAPGTGTPEPGGLTSRELLAGIRDLARNTDVVGLDVVEVAPPYDHADVTALVANRCVLEFLSATAQRKAAG............ 304
335 3.000e-87UniRef50_UPI00041583B9 agmatinase n=1 Tax=Thermodesulfatator atlanticus TaxID=501497 RepID=UPI00041583B9  ali  24  11.NPAKARVVFCPAPYDTTSYLPGTRFGPRRIIEASPYLEFYDEEKDCEVYQKAPFLTLPEEEL------PVDPEKMLKTLKSRLDPYVNAGLFPVTLGGEHTVSLAPMALLKEKYGRLCVIQIDAHADLRNEYQG-TPFSHACTMRRALELGIELYP-------------------IGIRAISREEIVFAREKGLKIHWARELVSK-LSEVVNEILTRI---GKRPVYVTIDLDGFDPAEVPGVGTPEPGGLKWYEGLFILQAVSSL-NVVGFDVVELLP---KDDRSAYFAARLIYKFLSYLF.................. 280
336 3.000e-87UniRef50_A0A0N0K6Q4 Uncharacterized protein n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0N0K6Q4_9PROT  ali  30  5.......YGFIGVPTDVGNKACGAAEGPAALRAIGLPRR-----MGMVDRGDVQGPAYDGTRDETGSRSVRETAAWCTAVRNAVSGVFADGGLPVMMGGDHAMALGSVAAAAEHGKNFFVLWFDAHPDFNTPETSPSGNTHGYPAALACGIGH---PALLRVGAFTPLLRPDRLVQFGIRDIDEGERANLRRSGIEFHEMPAVRERGLATLVAHTISRIQAAGGGHVHVSFDIDALDPSVAPGVGTPVPDGLTLDEAVDALRLLGASGLVQSLDIVEYAATQDQGNRTAH-----VVEHLLAGLMAGREGQTA......... 301
337 3.000e-87UniRef50_B9WIN5 Arginase, putative n=4 Tax=Saccharomycetales TaxID=4892 RepID=B9WIN5_CANDC  ali  25  46.SEKQFDIGIIGVPFDTASYRPGARFGPRAIRDASQRFDPYQSWAKIIDCGDIPVTPMDNSAAY------KQMSEAFKDLTN--KKSLNNTEIPIALGGDHSVLLPHLRALHRIYGPLNVIHFDAHLDTWKPNKYPTSINHGSMLWKAYEEG----------------LTTKHNIHVGVRTRLSEDLQDDDEQNFVRIEADDIWLKGPQWVVDKILTTI--PKDTATYISVDVDVLDPGFTSGTGTQEPGGFLPRELIYLLRSIEGL-TVVGADVVEVSPAYDIAEITATNGAQIAYEILTSMV---KRGNVDKS....... 351
338 4.000e-87UniRef50_A0A1Y0H6G4 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium Uphvl-Ar2 TaxID=2004468 RepID=A0A1Y0H6G4_9BACT  ali  37  2.......IELIGSPFDGCGRRTGSRLGPAALRMAGMPEALARLD-EVMDSGDT--IPLDTHPLPGWAETAQLAIRAYQALAPRVEASIRAGHIPLMMGGDHSLSMGSLAGALRAEGDLAVVWIDAHMDLNTPATSPSGNLHGMPLAAALRMVDDAPNPHIPDARRAPAYTPKAVAWIGLRDVDPGEAANL--MNIRAITMQEIDDKSIGNVMDELEAWLSARNVKNVWLSFDVDALDPIYAPGTGTAVRGGLTYREGHLVAERFCRQFRLVGLDLVEVNPLADMNNETAAVAVEWACSLFGRTVLHQYKGDAAP........ 328
339 4.000e-87UniRef50_A0A1Y0EBE9 Agmatinase n=13 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y0EBE9_9RHOB  ali  24  44...SGVDLAVTGIPFDQATHRPGARFGPRAIREASC-LQPYDPPYGWD--GFDPLSEFSIVDYGDMAFDYASVAGVPALVEAHIARILAAGAASITLGGDHFITLPILRAYAAKYGPLSVIQFDAHSDLW-PDEDMARIDHGTFMYKAVKLG---------------LVDPARSVQIGIRTQCDDY------LGMRYIDARSCHARGVADVVAEMRGIV---GDHPTYVTFDIDALDPAFAPGTGTPVWGGLASWQAAALLRDLAGI-NMVGGDIVEVSPPYDTTGATAIAGAHVAMELCCLALWNKRKKG........... 323
340 4.000e-87UniRef50_A9GKY1 Agmatinase n=11 Tax=Myxococcales TaxID=29 RepID=A9GKY1_SORC5  ali  25  32.AYSGADAVLLGVPWDGSTYRPGARFAPYELRRVSALVQSYHPGHGVDVFRAIHVLDGGNVPFP-----PFHADSVRELIQASVDEVLAAGAVPFVVGGDHSIALPVLRALSRRHGPVTVVHVDAHLDTSTSEVWGEPFHHGTPFRNAIEEG---------------LIGRSALHQIGIRATWPEEGAFAAHAGATLYGMDRIDRDGASAIA---AAIRAAAGESPVYVSFDIDGVDPAYAPGTGTPVPGGLTSREAIQLLRGLAGI-NLVGMDLVEVCPALDHADITLHLGAHLLFEGL-ALLATRKGDKRDQPR...... 324
341 4.000e-87UniRef50_A0A1Y5R7U2 Guanidinobutyrase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1Y5R7U2_9PROT  ali  26  36......DIGLIGVPFDGGTNRPGARHGPREIRNQSSLIRRINHATKIDPYALCRIADLGDA----WVEQPFELKGAHDEIAAFYKAVQAAGIVPVSAGGDHSVTLPIFRAIA-ADRPVGMVHFDAHCDTGDDYLG-SKFHHGAPFRRAVEEG---------------LLDPKRTIQIGIRGSDLGIWSFSHESGMRVIYIEEFHEIGVKGAIAEARRVV---GDGPVYVSFDVDGLDPVYAPGTGTPEVGGFSTLEAQLMIRALGDLD-IIGGDVVEVAPPFDPSGNTALVGATIMYEILCAAAAHARRNG........... 319
342 4.000e-87UniRef50_A0A1V6TPE8 Arginase n=1 Tax=Penicillium steckii TaxID=303698 RepID=A0A1V6TPE8_9EURO  ali  34  4..SNNSELTIVLAESSAGAPQMGSELGSRAILNSGLLKALRDHFKQVHICEISAKPSLEEDHDHAGMKRPRTVSKATQSIHELVYSHTQQGRLVLTLGGDHSNAIGTLTATSKHDRRPAVICVDAHVSINPPEASPSGNIHGMPLAFATGLATSQEKGIFDWIQQNHLIDMKKMVYIGTRDVDDEERKLIQQNGIKFFDMNDIKKHGIDSVASMALEYVGEQ--TPIHLSCDIDALDPEWAPSAGHLVPGGLSLQEGELVVRRVHETGNLIAMDLVEVNPTINVDG--VERTVNSACALVRGAFGLS............... 309
343 4.000e-87UniRef50_A0A166S1B9 Arginase/deacetylase n=3 Tax=Fibularhizoctonia sp. CBS 109695 TaxID=436010 RepID=A0A166S1B9_9HOMO  ali  21  69..SARFDIAILGFPFDTASYRPGARFGPFAIRAGSRRMNPFDSEATVIDCGDIPISPFDNALALDQMEVAYSTLLNRPIVGASAGKNTREHARIVSLGGDHTIVLPILRSLNKIYGPISVIHFDAHLDTWPGYDGQSRINHGTFFAVAQEEGLISNT----------------SIHVGVRCKMAGDVEHDQSVGFELITTDDIDDLGIPEIIRRVRARI---GDSPVYLSFDIDVIDPGLAPATGTPEAGGFTTREVKRIIRGLAGL-NFVGADIVEVAPAYDHADITGIAAADLVSDFLSMFLSETAPKPYSPRR...... 388
344 5.000e-87UniRef50_A0A1S7HLM1 (ZYRO0G05610g) n=17 Tax=saccharomyceta TaxID=716545 RepID=A0A1S7HLM1_9SACH  ali  22  51..PTEFDIAIIGVPFDTATFRPGARFGPQAIRRASQRINPYQDWATVVDCGDVPVTPM------DNQLALKQMNEAYKELEERWPQQSQAPPRFMTLGGDHSVILPVLRALHAHYGPIAVVHLDSHLDTWSPSSYPSYWTHGSMLWLAAREG---------------LLAKGHCVHAGIRGNGWDDYKEDDRVGFHRIHADEMMDLTPRGVARKIKSFI--PKGMPVYLSVDIDVLDPSAAPGTGTVEPGGWLTRELIAVLRNLEDLP-LVGADVVEVSPPFDHADVTAMAAAQVAYEIVTSMV.................. 357
345 7.000e-87UniRef50_A0A2E2E306 Agmatinase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2E2E306_9PROT  ali  24  65..FGDLQVAMVGVPMDLGTNRPGARFGPRAVRTI-ERIGPYNHVLKCAPVSELRVADIGDVPF----RSRFSLNSCHEDIEDYLAKIVAAGVIPLSIGGDHSVTLPIMKAIGKK-APIGMIHFDAHCDTG-GEFDNSKFHHGGPFREAVLEG---------------VLDPERCIQIGIRGPAEYLWEFSVDSGMTVIHAEDVAEMGPAAVIKKARDVVR---DGPVYVTFDVDCLDPAFAPGTGTPEIGGVTSREAMTMLRGLAGL-NIIGGDVVEVAPQYDSTTNTAQVGAQILFEILCLM................... 340
346 7.000e-87UniRef50_A0A2N2DFA7 Agmatinase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A2N2DFA7_9FIRM  ali  22  6.TYESADTVIVGVPMDFTSYRPGSRFAPQAVRNVSYVLEEYSFYL------DRDLADYRFYDWGDINLPIGNVGESLNRINRVAARLFADGKFPVFIGGEHLISYPVISEACKKNPGLAVIQFDAHADLRSDYLGE-GNSHATVMRKACE-----------------VIGSGNLYQFGIRSGTREELEYAK-TNTNLYT---------DAVLEPLMEVAKTLAGRPVYVTVDIDVADPAFAPGTGTPEPGGISSRELISAVHALRDLD-IIGMDVVEIIPSIDPSERTAVLGAKIIREAILGF................... 273
347 7.000e-87UniRef50_L0DI55 Agmatinase n=5 Tax=Bacteria TaxID=2 RepID=L0DI55_SINAD  ali  25  41...EGVDIALIGVPTDAGSHRPGARYGPQAVRAQSGLIRYINPYTGVIPYEHGRVVDAGDVPFQNTLV----LDDIVREIFSYYTQVVAAGVVPLSVGGDHSITYPILKAVASR-GPVGLIHFDSHHDTAPPMKG-SRFHHGAPFRNAVEDG---------------LIDPRRTVQIAIRDYRQAARPYAEAHGFTVLDMPLILREGLDAVVATTRKTI---GDGPVYITFDVDALDPAFAPGTGTPVVGGLSSREAMILLQGLRGL-NIVGADVVEVSPPYDPTGMTALAGAQILMELLCLASSLAKKGNQSA........ 329
348 8.000e-87UniRef50_A0A1W9MI09 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon A3 TaxID=1933927 RepID=A0A1W9MI09_9EURY  ali  22  13...EDADVCIFGMPFDTTSFKPGTRFGPNAIRDASYNLEFYSMALERNI-GDIKIFDAGNIGFHTK------PQDAISEISKRTNDLLKNDKFIVGLGGEHTVSYGIAHAMKEIYKDIAVIHFDAHADLRTEYDSE-KFSHACVM-----------------NLIGSEIGFENIYQFGIRSGEEEELKFAEKTNF--YPLHKYDT-------TQILEILDDLNSKRTYLTIDIDVLDPAFAPGVGTPEPGGITSNDMFKILNSL-KKFDVVGFDVVEVNPMIDVSGITAMAAAKIVREGILNFI.................. 280
349 1.000e-86UniRef50_C3MMG9 Agmatinase n=45 Tax=TACK group TaxID=1783275 RepID=C3MMG9_SULIL  ali  24  31......KAAFLGIPFDDATYRPGARFGPMGIRQGSRLLRPYNQFLDTYPFDKLNACDMG-----DINIIPGYIEDTMNIIQTNLYEIISKNLVPFIAGGDHSITLPVLRALHKKYGKINIIHLDSHYDFWDSYWG-KKHTHGTWLRRAIEEGLIKEA-----------------IQGGIRTFSKEDLKDKERLGVKSFTIRDL-KYNLDSVIREI-----NSLSGPTHVSIDIDVVDPAFAPGTGTPEVGGLTSFEIIEIIRKL-RFDKLVGFDVVEVAPPYDVSEITTMLAANIIYE........................ 296
350 1.000e-86UniRef50_A0A2J6W559 Agmatinase n=1 Tax=Caldisphaera sp. TaxID=2060322 RepID=A0A2J6W559_9CREN  ali  25  22...KKSKYVIFGVPFDSTSYKPGTRFGPDSIRQAASSLESNSY------FSDIYLEDIGIDDEGDITPVIGDINETMNRVTSITSEIVKENKIPIVLGGEHTITYGVLRGIKKALNSPCLIVIDAHYDLRDDYLGL-KLGHASVMRRNLE-----------------ILGLTKINYLGVRAYSKEERNYLSKNNINTLKPSDIYRLGILNTINTIKRFLSD--CKYIYLSIDMDGFDPSFAPGVGNPEPGGINNVEGLSIVNQLV-DKRLIGADVVEVSPPYDSNDITAALGAKLINEIIMKNYIENKENNT.......... 306
351 1.000e-86UniRef50_H2KUZ4 Arginase n=2 Tax=Opisthorchiidae TaxID=6196 RepID=H2KUZ4_CLOSI  ali  45  34.....SQVNMIGAPVNKGQPKPGTELGPNLIRNSNIFEFLEAYGVTLRDCGDVHLDSVEETDKVFNMSNCQSFIKATYSIAQRVEELLKESKPLLIVGGDHSIATGSILGHKRAKPDAAVIWVDAHADITTPLSAEYSNIHGMPVAFLLEELQEEVPYLEEMDAIEPCLKATDIVYIGLRDLEQHEVYDLRRNGIPHFTMVDVDQMGIEAVIHKAIEFVNPRLERPIHLSFDIDAIDPTLAPSTGTPVPGGLTLREGLRICEVVHATGL..................................................... 306
352 1.000e-86UniRef50_Q6MHV0 Agmatinase n=16 Tax=Proteobacteria TaxID=1224 RepID=Q6MHV0_BDEBA  ali  26  35....DYEVGIFGIPYDGGSYRPGGRFAPAKVREVSSLGRGFHMTRMENFFENLKVADIGDCPTVPIDQ-----KQTYEKIEKFVGEVLSHNKRFLAVGGDHSTTLPVLRALRKKYGPLAFIHFDAHLDTYPAAWG-QEYHHGAFARHAVEEG---------------LVDPKKMVQIGIRGPLAGDLNFVNKHGIRVITVDEIRNQPI----TEFLKTLPTFDETPTYISYDIDNLDPSCAPGTGTPVPGGLTTYEVQRIFRAL-KIPNLVGGDVVEISPPFDHADITALAGMDALFEML...................... 308
353 1.000e-86UniRef50_A0A1V6TMC2 Arginase n=2 Tax=Aspergillaceae TaxID=1131492 RepID=A0A1V6TMC2_9EURO  ali  37  14...NPSQLAVVAAKYSCGAPRSGAEYGPDVLINSGIFSDIQS-ETDYKLTIDHKVEANDADPDTNNMKLPRTVSLASKQVSECVYAHARQGKFVMTLGGDHSIGMGTVTGVARAGSELSVLWIDAHADINTPEPSPSGRIHGMPVAFASGLAR---HGIFDWITASHLINLKRFVYIGLRDVDEAEERVIAEKGIKAFSMEDVRQHGIEKVMDLALEYLGDE--TPIHVSYDIDSLDPEWAPSTGFPVSPGLSLEEGIHVSRRLQATQNLVAMDLVEVNPLIESERLET--TVESARSVIHAALGVER.............. 325
354 1.000e-86UniRef50_Q5WB32 Agmatinase n=349 Tax=Bacteria TaxID=2 RepID=Q5WB32_BACSK  ali  24  18.SYEEADAVIYGMPMDWTSFRPGSRFGPARIREASLGLEEYS------PYADKHLEEINYFDAGDIPLPFGNAARSLDIVEEYVDSLLADGKFPLGLGGEHLLSWPIFKAMYRKYPDLAIIHIDAHADLREQYEGE-ALSHSTPIRKACE-----------------LIGAENVYSFGIRSGMREEFAYAKEAGMHLYKFD---------VAEPLKNVLPHLSGRPVYITIDIDVLDPAHAPGTGTAEAGGITSKELLEAQMLLSQADQIVGADLVEVAPAYDPTEQTAIAASKFVREMLLGWVHKR............... 292
355 2.000e-86UniRef50_A0A2H0SIE7 Agmatinase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H0SIE7_9BACT  ali  23  14.SYKKAKVVVLPISLEKTSYMPGTKFGPRAIINASRYIELFDIEMGR------DLSQIGIFTLPELLFAKKSLEESIKEIKQAALNLLKDKKFILSLGGEHTISYGLISAFKEKYKDFSVLQIDAHSDLRDEYEG-TKFSHACVMRRVRDLGISVTG-------------------VGIRSQDETEIGYMKKKKIKIFYAPMIP-----------LKKIISSLSKNVYITFDVDGLDPSIMPSTGTPEPGGLGWYEVLSLIKQVAKERKIVGADIVELSPLKGIIFPDF-LAAKLAYKIIGYSL.................. 280
356 2.000e-86UniRef50_A0A1E3QKG1 Uncharacterized protein n=8 Tax=saccharomyceta TaxID=716545 RepID=A0A1E3QKG1_9ASCO  ali  25  78....DFDIGIIGVPFDTTTYRTGARFGPKGIRAASARINPYNDWAKVIDCGDIPVTPMDNNLALRQMTVGFEELLIKRNVTEA-GASRTQFPRLVAMGGDHSILLPHLRALKKAYQEIHVIHFDAHLDTWSPSKYPSEFTHGSMLWMAAKEG---------------LINANNNVHLGLRTRLNGEEDNDEDLGFTRISADDIHQSGVNYVVDKILETI--PKNKPVYLSVDIDCLDPGFAPGTGTIESGGLLPRELIYILRKLEGL-NLVGADVVEVNPAFDHSEVTTTNGAQVVYELVTSMVKRGKLSFLSQNEQTIESK 404
357 2.000e-86UniRef50_UPI000C0793F7 agmatinase n=1 Tax=Bacillus sp. Marseille-P3800 TaxID=2014782 RepID=UPI000C0793F7  ali  26  81....EYDVAFIGAPFDGTTFRPGTRFGPEAMRSISKLYNSYHFESGVDLKEQLKMADLGD------IYSVHHLEKQFDQLSKAINHVVSHQTFPVILGGDHSIAYGTIRGLAEAEGKVGIIQLDRHLDLQEKEMDER--MHDTPLFHASQL---------------PNVDPKNMVHIGIGGWDIQGAITAKKQGHTVLTMDDVDDLGIDRIIEIALEKAWADGVQAVYLTVDVDCMDSGVSMGTGWPEPGGFLPREVLKLVRGLAKKG-LAGLEVVEVSPPYDHNSQTALMGTRIICDVLSSLVKHKHLG............ 366
358 2.000e-86UniRef50_A0A2D6Z000 Arginase n=7 Tax=Rhizobiales TaxID=356 RepID=A0A2D6Z000_9BRAD  ali  32  1MTESSATVSLLGVPIEVGASQKGALMGPAALRTAGIAQLLESLDFKVEDHGDIAPRELSFSDPPANAKHYREIKAWIGETSRRAYAMARSGAIPIFLGGDHSLSMGSVNGVARHWRELFVLWLDAHADYNTPATTITGNMHGMSGAFLCGE--PGLDDLLPQSERSSIV-TRQLGLFGLRSVDKKEKELLAQRDVWIADMRRIDEFGVSVLMREFIERVRAR-SGILHVSLDVDFLDPVSAPGVGTTVSGGATYREAHLVMEMLQDSGLVRSLDLVELNPFLDNRG----LTARTVVELVGSLFGQQIHDRPTPSN...... 317
359 2.000e-86UniRef50_UPI000DBDBA26 arginase n=1 Tax=Aspergillus aculeatinus CBS 121060 TaxID=1448322 RepID=UPI000DBDBA26  ali  35  5..ADGTHLAIIAAKFSCGAPRAGAEKGPEAIMQTGVFQEIATKANLAISFDMLAAEPAPADQIGLGLKRPREVSAAVQRVSSAVYRHARRGRFVLTVGGDHSIGAGTVTGTAKALRDLGVLWIDAHADINTPETSRSGRFHGMPVAFASGLAPSPQRGVFDWLEPSHRINLRRFVYIGLRDVDEAEKELIARHQVKAFTMEDVNRLGIDKIMDAALDHLGP--DTPIHASYDIDSLDPEWAPSTGFPVPAGLSLEEGVRVARRLHESGNLIALDLVEINPDIAPSLLD--LTVNAGCRLIKTALG................. 327
360 2.000e-86UniRef50_A0A1B0DJM6 Arginase n=2 Tax=Neoptera TaxID=33340 RepID=A0A1B0DJM6_PHLPP  ali  42  1..................................................................MLGYDDVVACNQRLSEKVFEILSDDRMCITLGGDHAIGIGSVDGHVRQRKNIAIVWVDAHADLNTNTSSTSGNVHGMPLALLAEEFAGMWPYLPNMDWQVPRVSTKNIAYIGLRSVDDFEKDMIARYNITAFGMRDVDKYGIHDVINMALEAIDPTADRSIHLSFDIDALNPLEAPSTGTSVPGGLALREGIHIVEEVHKTRRLSVMDLVEVNPQIG-NEQQVKDTVNAAIEIIKAACGNYR.............. 241
361 2.000e-86UniRef50_A0A0S8CKT0 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0S8CKT0_9CHLR  ali  23  17...QKAKAVILPVPYDSTSWRGGSRHGPQAIIDASEYLELYDLELDREIY------RAGICTLPRVEPLLGSPQGMIDRVYQVVGDLVQKGKFVVLLGGEHSLSLGAVRAFKEAFPTLSVLQLDAHADLRDQYLG-TKYGQACVMRRILEVCP--------------------ICQVGVRSLSWEEKQFSAEKQLKVFYMTDFASNGAE------IDRITESLSRDVYITIDVDVLDPSIMPAVGTPEPDGMSWRQILDTVKSVMIHKHVVGFDLMEFCPVEGSSSC-AFLLAKLAYRLIGYAVSQERR............. 289
362 2.000e-86UniRef50_A0A1V4SXN2 Arginase n=4 Tax=Clostridium TaxID=1485 RepID=A0A1V4SXN2_9CLOT  ali  32  2......KINVIGMPIFYGCDNPGVDQGPTVMRESGTIGLLHKPGNEVVDLGDIDMVYASQNEKYEHAKFLSYVLDASEKLAKKVDSSISEGSFPLTIGGDHSLGLGSVAGASKACGDLALIWFDAHADINTIQTSPSGNVHGMPIA----GGIGIDDKLSHVYFDGIKVRPENVHIIAARDIDEGEVKIIADNNIDVYDMKKVREIGVQKTVKEVLEKIKAKGIKNIHLSYDIDGIDPEFIEGTGTRVPGGFNMEEAQYVIKEIIGSGLVKSMDLVEFNPRL-EKGITLAHCLELT-DTIAKSIAK................ 301
363 2.000e-86UniRef50_A0A1C5VKZ9 Guanidinobutyrase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C5VKZ9_9FIRM  ali  21  38......DFVVLGVPYDTSTNRTGCRFGPRAIRNAGAGRLSYEQDNSY------KVANLKGMDMGDIGVVLGYVEETMELIRESVRKVLDAGAVPIVLGGDHLIAYAELKAYSEKYGKVAMVHFDTHEDTWD-YGDRIKYNHGTPFRNAIEDD---------------ILDTEHSIQVGIRSGDTYRIKYAQDHGMKVITARELHKIGIKETCRRIKEQV---GDAKVFITFDIDFLDPVYAPGTGTPMPGGFSTYEACEIIRNGLAGLDIVGFDLVEVMENYDPAGITAINAVAILKQFVILLSKKKAE............. 318
364 2.000e-86UniRef50_A0A2A5FLD2 Arginase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2A5FLD2_9FLAO  ali  30  12...............EFGAGTKGASLGIDAIKTAAA--ERKSDFFIRHESENVEVNSLNNSHLLEHAKRIESVYGVCSKLAAHVEKTLKQDLFPLVLSGDHSIAGGTILGLKLAYPDIGVIWIDAHADIHSPYTTPSGNMHGMPLAFLLNEDNEQWDLLKNIGSIVPKITYENIVFIGLREYEDEERSLIEKNNIKVLTVEQINEIGTEQTAKETLNYL--SGCDMIYISFDVDSMDPSVSVGTGTPVPNGLSDEATSSLLKFLVQDEKVCALEVVEVNPLLDDDNKMAKTTFKIIEEAAAVIEG................. 314
365 2.000e-86UniRef50_A0A160T3Q5 Proclavaminate amidinohydrolase n=45 Tax=Bacteria TaxID=2 RepID=A0A160T3Q5_9CHLR  ali  25  32...SGVDVAIVGVPFDSGSFRGGTRFGPRHIRAASLALWGTHHIHGVAPTDALTIVDYG-----DVEIEMAYIEKSMDFITTEVGAALAQGAMVVALGGDHSISLPLLRAQAAAHGPLAVVHFDAHTD-----VEPGGYEHGTVFRHAIEEG---------------LIDPTAYIQVGIRGFFPDDLNVARRLGARVLTIDDCFEMGIPAVIEAIRETV---GDRRVYVTLDIDATDPAFAPGTGTPEPGGFSSYQMLQLMRGLKGL-NLVGMDLVEVSPPYDQSDVTAILAANLVFEYLC-LVALRRAGEQ.......... 319
366 2.000e-86UniRef50_A0A2H5XU44 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5XU44_9BACT  ali  23  19.STNTAAIAIQPIPLETTSYGKGTKDGPREILRASHYVEFYDDEFDRELC-----FERGIATLEPLPLKKLPIEEALALVEARASAILQAGKFCVGLGGEHSITAPLVRAHAQKVPDLTILQFDAHADLRIEYDG-TPYSHACVMARIAE-----------------FLDPSRITQVGIRALSKEEASFIRSAGVRTFFAHAIRR-GDAQWMDRVLEGL----SEHVYITFDVDALDPSIMPATGTPEPEGLTYSECIAIVKRLIETGRIVGFDVVELAPILHHPNLT---AARLVYKLLNLAFAHDRSGKRA......... 303
367 2.000e-86UniRef50_H3NM56 Arginase n=6 Tax=Firmicutes TaxID=1239 RepID=H3NM56_9FIRM  ali  29  2......KIDFIKVPMYYGSDRPGVEFGPDKIIQEGIEDIFNKNGIITEVKEDTKVEIISEKEKHESIKYLSPVTNAVEDLADKVHDSLSKGNMPFVIGGDHALAIGSLAGVSSILGDFAIVWVDAHADINDTETSPSGNIHGMPLAASFGLGDDK---LTNVYFKGHKIKPENIYILGARSVDEGEYDIIDKYGVNVWYMDDVHTKGVNKCLNEIIDDINNKGINKVHFSYDIDSMDISLVPGTGTPVEDGFDHEQSEIIIRKLIQTKLIKSIDFVEYNPKKDIENITLNSVLKML.......................... 292
368 3.000e-86UniRef50_A0A1C6F2L2 Proclavaminate amidinohydrolase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C6F2L2_9FIRM  ali  22  23..TSGADYTIIGIPFDITTYRPGTRFGPDGIRRA-FSTDSVNEAVGIDTSKYVKGVDYGNLDIWNAEK------AYLGSIPQEMKAILETGTIPIVLGGDHSITFPELLAYKDVYGPVSIIHFDSHTDTWGSDTDKEHHDHSTPFRRAIEYD---------------CIDPKTSIQVGMRGFEKSDFDFANNAGLEHIYAVDIHHMGIEKTAELIREKV---GNNKVMVTFDIDFVDPAFAPGTGTPVSCGFTSRQALELIRHALIGLDIVGFDLVEVAPNYDAGGITSILASRIVKEFI-TCVACKKAG............ 307
369 3.000e-86UniRef50_A0A1V9X957 Arginase n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9X957_9ACAR  ali  37  16...RSYSVGVLGIPMWRGQKKPGTDVAPLKFRKDSRLITGIESTTGVHDFGDVDLSSCGQYECDGT----KFMALASQLIRMSVVRSLNESSRLVVLGGDHSMAIGTVRGHAQHGRELAVLWIDAHADINTPKTSRSGSWHGMAVSLILHEMAAHLPPMKEFSNWKSSVSATSLVYIGLRDVEPDERWFLENLRIPHFSMRELDSLGIHKVTEMALDKIDPQGRKALHVSFDIDALDPIVAPSTGTPVPGGMTVQEAAVFSEAIASTQRLGVLDVVEVNPLISNSGESASLIARLML......................... 317
370 3.000e-86UniRef50_T1IIL6 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1IIL6_STRMM  ali  44  27......RLGVLGVKLSKGQSKSGVDNGPEVIRSTNFIKTLEKDRYTVTDYGNIQAHYPEKDLIVKKIRNPHAIGDTCKQVSLKVQDILQNGDPVFTLGGDHSVAIGTIHGHAQVQPDMCLIWVDAHADINTATTTNSGSMHGMVNSFHLHELEPFKVDLPGFDWIKPSLRAKDIVYIGLRDVEPLERLILEKYGIRVFAMHDVDRLGILEVTKRALDVVNPRLARPIHVSFDIDAYDSTVAPSTGT--------------------SGLLTGLDLVEVNTAIGSP-LDQQKTLFAANQTLLAFCGNNRAGNLP......... 317
371 3.000e-86UniRef50_A0A2C5YQ83 Uncharacterized protein n=1 Tax=Ophiocordyceps camponoti-rufipedis TaxID=2004952 RepID=A0A2C5YQ83_9HYPO  ali  24  68.....FDIAVIGVPFDTASFRPGARFGPRAIRHSSARINPYQDWAKIIDCGDMPIT------PFDNQIALEQMTQAFRELKRKASKTSNPRPRLVTLGGDHSLALPALRALKEIYGPVRVLHFDAHLDTWDPYSYPTQFTHGSMFWMASQEGLLSNSSSSPS------------VHAGLRGTSWADNESDGSQNWVRFSADDMDEKGTSGIIDGIVKTLGTE--DPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGIEGL-NLVGADVVEVSPAYGRGEETALAAAQVVYEMVTSMVKRGSKGQAVVRDELTPL. 387
372 3.000e-86UniRef50_A0A2G4JFS7 Agmatinase n=3 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2G4JFS7_9ARCH  ali  24  40....KPDVAIIGEPFDFGTTRPGARYGPRAIRAASTIYERFNIETGADPFG-----TFRTVDYGDVQVSPGDVIESHKRMTKKVKEVLDEQGIPVMLGGDHSITFANVRAFAKKYKNIGMIHFDTHADCAPQGLTGYKYDHGAHIRRIMEMG---------------CLRGKNYTLVGPRGYWPGLYKWMADQDFQWFTMLDVEELGIDMIAKEIADR-ANDGTDAVYLSWDIDSFDPSYAPGTGEPEPNGLTSREGMRMVRLLSKSPNRFAMDLVEVAPAYDVSGITSGLGQRLIIELL-AGLSLTKRGNGDPVRPHN... 350
373 3.000e-86UniRef50_A0A285EI99 Agmatinase n=2 Tax=Geodermatophilus sabuli TaxID=1564158 RepID=A0A285EI99_9ACTN  ali  26  2..........LGAPFDWGSYRPGARFGPRAIREA-----DYLPPDGRRPHGIDPLFELPVVDAGDIPVVGGHIEPSLELIESWVHTVAAAGAIPIVLGGDHTITYPDATGVARHHGNVALIHFDAHADTA-PHQWGHLYGHGTPMRRLIESG---------------AVPGHRFVQIGLRGYWPEVVAWMEEQRMRTFFMDEINERGLDPVVDEAVDHALTGGAEAVFLSLDIDVVDPGMAPGTGTPEPGGILAREFLPTVRRLARELNVVGADIVEVAPHYDPMNITAALANRVVLEMTTGMVERRR.............. 287
374 3.000e-86UniRef50_A0A251VWR2 Arginase n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A251VWR2_9CHLR  ali  32  8......RLRILGIPMDLGQQRRGVDMGPSAVRYAGLYERLRGLGHQVEDAGNVPVARSWTETPEGGLHHLPAVVQACQQIFDAAQASAASQEIPIFLGGDHSXXXXXXXXXXXXXXXXXXX-XDAHGDFNTPASSPSGNIHGMPVAVLTGRGH---PDLVDLGYPGAKLLPQHIVLVGVRSLDPEERVALAGSGINVYTMRDIDELGMATVARRALSRLSSLA--RIHVSIDMDAIEPAVAPGVGTPVAGGLTFREAHLLMEILAESEKVRSVDVVEINPILDEGNRTAELAV----ELIASLLGQR............... 307
375 3.000e-86UniRef50_H8I4U2 Agmatinase n=6 Tax=Euryarchaeota TaxID=28890 RepID=H8I4U2_METCZ  ali  26  12.SFDDATFVLFGVPFDGTSFRTGSRWAPMEMRKASYNFETYNGDLDV-DLVDVPVHDMGDIEAY------CSVDDTLDAVYDVASGIVKAGKLPIMMGGEHSLTYPCVKA----CGKVGFVVMDAHHDLRQEY-GGLRNNHACVSRHIIEDL------------------ADRYVSIGIRSGTKEEYEYVRNKGIMSFTANDVDAMGIDAVLRETEAYL--RGCDRIYLSLDMDAIDPAYAPGLGTPEPFGMTPRQVREVIRRLA--PKTVGFDVVEISPVYDH-GVTAILGAKLIRDFIAA.................... 278
376 3.000e-86UniRef50_A0A2H9Q9M0 Agmatinase n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9Q9M0_9ARCH  ali  26  18..FKKSKYVILPVPYDGTSYRSGAREGPFEIINASRNLETYDSEFG--DVSNL------IYTLPELQPNLNSVEEMMLRIEETALDQLTQGKYLITLGGEHSITYGVLRAFRKCYPKLSVLHIDAHADLREDYEG-SRLNHACVMSHARELYP-------------------DTVSVGVRSVCEEEAKCISSEKLDVYPMSE----DIESRFDEIVSKL----GKNVYLTFDIDALDPSIMPATGTPEPGGLLWYQALRLLRKVFEKKNVVGFDLMELCPIPGMHAPNFT-AAKLLYKMIG..................... 282
377 4.000e-86UniRef50_A0A2C9SRP5 Agmatinase n=34 Tax=Actinobacteria TaxID=201174 RepID=A0A2C9SRP5_9MYCO  ali  26  24.SYAGADIVILGAPLDGGTYRSGARFGPSALRQACYLPQRPSLALRVDGLKDLRV-----YDAGDVMLYSGNIEQAVAMITEEVYKISAAGAIPIILGGDHTIAWPDHTGVARQHGKVSMIHFDAHADTGDIHNG-SLVGHGTPMRRLIESG---------------ALRGDRFLQLGLRGYWPDELQWMAAHGLRSYEMTEIVARGLSTCLTEAFE-IATADCEGVFLSVDIDVCDPGHAPGTGTPEPGGFSARELLDAVRRICYELPVLGVDIVEVAPPYDHADITALLGNRVVLEVISAI--ARRRRDHADGTTWDP.. 326
378 4.000e-86UniRef50_Q1QR10 Arginase n=15 Tax=root TaxID=1 RepID=Q1QR10_NITHX  ali  32  11......RVALLGVPIDMGAAQRGTLMGPAALRIAGIKPVLESLSIDVLDHGDISIAQVAPATIPANANHYRDIQAWTRTLSPRAYDLAKSGAIPIFLGGDHSLSMGSINGVARYWRELFVLWLDAHADYNTPLTTMTANMHGMSAAFVCGE-----PGLDDLLGEEPRITSAHLDLFGIHSIDPLEKKLVHERRIAIADMRAIDEFGVAVLMHSVIERVRARNGV-LHVSFDLDVLDPGIAPGVGTTVPGGATYREAHLVMELLYDSGLVGSVDIVELNPFLDERGRTARVAV----ELIASLFGQQITDRPTPSNTLMP.. 322
379 4.000e-86UniRef50_A0A0U3B3E2 Uncharacterized protein n=3 Tax=Lacimicrobium TaxID=1751872 RepID=A0A0U3B3E2_9ALTE  ali  23  29.......VVIAGIPFDLTSGRPGARFGPAAIRQASVNLGW---EKKRHPWPFALRDALNIADIGDLAFSHGDARGAMEAVREHVSQVVRSGAIPFMLGGDHLITLPALQAVHAKHGPVAVVHFDAHSD---DYAGGSEFDHGSVFYHARKQG---------------LLQDEKVIQIGIRT----------EQGFKVLCADELWHSKAEEVVARIKNTV---GDAPVYLTFDIDCLDPVYAPGTGTPVSGGLSGPFVLELLRKLHGL-NWVGMDLVEVSPPYDQSQITSLLAATMMTDMLCLL................... 293
380 4.000e-86UniRef50_A2QBG2 Aspergillus niger contig An01c0490, genomic contig n=149 Tax=Eukaryota TaxID=2759 RepID=A2QBG2_ASPNC  ali  23  60....PFDIGIIGTPFDTASYRPGARMGPRAIRTASAQINPYQSWAKVLDCGDIPVT------PFDNAVAIHQMTEAYRELGSRRTTTGTGKPKLITLGGDHLVALPALRALRESYGPMALLHFDSHLDSLHPDRYPSAWNHGSVFWNAMKEGLISNSSSLHAGINTRL--SGNSFQ---------DLDDDDKQGFLRIAADEVDSIGAAGIIDRIHQHI--PKDQPVYMSIDIDVLDPAFAPGTGAPEPGGWTTREMIKILRGVMDL-NIVGADIVEVAPAYDPGGETAYLAANLAYELVTGMVARRAGGRQVPVGMMQEP. 384
381 4.000e-86UniRef50_A1HTD3 Arginase n=4 Tax=Firmicutes TaxID=1239 RepID=A1HTD3_9FIRM  ali  41  1.................................................................MLKNLQPIVAASEKVAAKVSRTVAAGRFPLILGGDHSIAIGTLAGISRHYANLGVIWYDAHGDLNTPETTPSGNIHGMPLAASMGLGH---PALTGIGGYVGKVKAENIVMIGIRDLDPGERLLIAERKIRVYTADDVSRLGIARVIAETVDYLSAR-CDGVHLSFDLDGIDPLEVPGVGTPVAGGISYSDSLAALVLLHQSGIITSAEFVEVNPLLDRDDRTV................................. 220
382 4.000e-86UniRef50_A0A106BN98 Arginase n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A106BN98_THIDE  ali  30  5.SSSPRSIIVIGAASCAGAPDPGCAEGPDALR----RYRVFH----ATPLQHVAWDAILRVPREARDTPLHAVAALSARLAAEVEAVLQTGNFPLVVGGDHSCAIGTWSGVHRARGPIGLIWIDAHMDSHTFATTPSGQIHGMPLAALLGHGDAALTAI---DGPEAKLRPEHVCLIGVRSFEAGEAVLLQQLGVRVFDMDEIRRRGLAEVFDEALAIVR-QGTVGFGVSVDLDALDPEEEPGVGTPVPGGLRRAELAAALSQLRGDPAFVAMEIVEYNPRRDRGHATADAAGALV.......................... 290
383 4.000e-86UniRef50_A0A2D4CCV3 Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CCV3_PYTIN  ali  47  452....PQTVAIIGAPMTYGQPLLGTDGGPDLLRDAGLHKQLVGDRLNSFPVGN-----------------------GLKQISDVFSEKAGEGKFCLVLGGDHTIGAGSLAGMLSVYPDAGFIWVDAHADINTPQLSGSGNMHGMPIAFLM-EGLVDATKVPGFEWIAPKMKPEQLVYIGLRDVDPPERRIIRELGIKAFTMQEVDRFGIGKTMEMALDHLCGKKERPLHMSYDIDAVDPVLAPSTGTKVRGGLTWREANYVAEAAAETNLLCGLDMVEVNPSLAP-GHGAQLTHKRV.......................... 720
384 4.000e-86UniRef50_A0A2H9QTK7 Agmatinase n=4 Tax=Euryarchaeota TaxID=28890 RepID=A0A2H9QTK7_9EURY  ali  26  12.SFNDAKFVIFGVPFDSTSFRSGSRFAPNRIREASYNFETYLMEQDV-DLIDIPFHDAGNLDEY------GNVDEMTGAVEDAVKKILP--KFPILIGGEHSLTIGAV----KTLKNVSVVFIDAHLDFREEYLGI-KNSHACVSRRVSE-----------------IVGIENVFSIGVRSFSREEKNDAEKLGLKYVSSFDVKEKGIEKSIR------NLNLKKKIYLSLDMDGVDPAFAPGVGNPEPFGLTPLDVVKCIKIL--SDRLVGFDVAEVCPPYD-NGNTSLLGARIIRDLIGCA-GKYR.............. 278
385 5.000e-86UniRef50_A0A0P1INP9 Guanidinobutyrase n=33 Tax=Bacteria TaxID=2 RepID=A0A0P1INP9_9RHOB  ali  24  38....EVELGLIGIPWDGGTNRPGARHGPRQLRDFSTMIRAMNPVTGVAPFSLVNCADLG-----DVAPNPVDIGDTLERVTAFYADIHDRGIAPLTAGGDHLTTLPVLRALAKS-GPLGLIQFDSHTDLFDTYFGGHKFTHGTPFRRAVEEG---------------LVDPKRFVQVGIRGYNTEDIEWGEAQGIRIIRIEELFDRGIDDVLAEVRSIV---GTAPTYCTYDIDFVDPTYAPGTGTPEIGGPNSFQAQQVIRKMAG-VNLVGADLVEVAPPFDPEGGTAWLGISLMFELLC..................... 312
386 6.000e-86UniRef50_A0A2V6T5F6 Agmatinase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6T5F6_9BACT  ali  21  30..TRELDVAFVGVPFDTAAYRVGARLAPRAIRNASSQVRIHHPIYDLTVHKAIRIADYG-----DVRTTPFEIERTFAWITEEFDAIYGNGCRTIAVGGDHGITYPILRAVARRHGPLAIVHIDAHTDTHDTQF-AHKLTHATTFRRAHEDG---------------LLQPGKVVQMGIRGFYPDDLKWSKEH-YRMMPAHELHRRDMDGVVAEVREIV---GAAPVYFTFDIDGMDPSCAPGTGVPEIGGLTNWQVMQIIRGLVGL-NLVGADLVEVSPPCDTNDITSITAAHMLFE-IASVFAANKAGR........... 314
387 7.000e-86UniRef50_A0A2S6UJB0 Proclavaminate amidinohydrolase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A2S6UJB0_9PROT  ali  22  80....NYEAAFVGVPFDTGTYRPGARFGPQAVRRISALYDGYCVDGAVDLFEELDL-----CDAGDIFVIPGNIEKTFDQVSKGISHVFTSGAFPIIVGGDHSLGYPNVRGVAQISGNVGIIHFDRHLDTQDIDMDER--MHTTPWYWSVDHSKAHQHHSHMHDVGLSNCPPKNLVQVGIGGWNRPGSEVARDRGTSVITMKDFEELGIQGTASLALE-LAWKDADAVYLSFDIDSIDPAFAPGTGTPEPGGFMPREALEMVRLIAREG-LCAMEVVEVSPPYDVNDNTSQLACRVILDVIGTMVSVGKLGHRDQ........ 390
388 7.000e-86UniRef50_U4LG95 Similar to Putative agmatinase 2 acc. no. O42887 n=2 Tax=Pezizomycotina TaxID=147538 RepID=U4LG95_PYROM  ali  27  73..SETFDIALIGAPFDTTSYRPGARFGPRALRAGSQRVNPYASWAKITDCGDIPLTS------FSSELALAQMTSAFEEI--MTHKTPSGGSLLVTLGGDHSIILGALRAVNKIHGQVAVLHFDAHLDTWDPRFYGTPFTHGTML---------------NLAGREGLISNNSNVHAGLRTVGMGDYRDDTEQGWLRIGSEDIDDLGAKGVVEKIVQRL---KGKKVYLSFDIDTLDPAVAPGTGTPEVGGWTMREVKRILRGIAEDVELVGMDIVEVAPAYDNQGITALAGAQVVFEVLS---GYVKKGELA......... 374
389 8.000e-86UniRef50_A0A2E7XHY4 Arginase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E7XHY4_9GAMM  ali  27  85LKAGKVDVAMMGAPLDTGSGMRGAAWGPRHFRIANNYLSTEHLHTMVNWREDLVVVDYG-----DAAIDNLSGERSMKPVREIVRQIAATGAIPIIIGGDHSLEYPNVAGVADVHGKVGVIHFDAHFDAGLFGNGH-LITHGKPIRRLIEEGH---------------VLGRNYIQVGLRGYWPGGFEWMREQGMRYHTMAEVEQDGWPAVMASVLKE-AREGTKYLYISLDIDVLDPAYAPGTGTPEPGGLTSRELFPLIRGLCSDNHLVGFDLVEFNPLVDPGYITGLNAERAVRE-CLTGIAMNRRG--LKSGYLSPL. 389
390 8.000e-86UniRef50_A0A2A5NX52 Agmatinase n=1 Tax=Candidatus Geothermarchaeota archaeon ex4572_27 TaxID=2012530 RepID=A0A2A5NX52_9ARCH  ali  21  23..FATSTFVVLGVPFDSTSYRPGSRFAPYAIREASINIEGYSWRYGV-DVGEVKVHDLG-----DLLVALGDIRETISRVERVVRALRGAGKLPILLGGEHTITYGAVRGL----GGAAIVCFDAHLDMRDEYPQGVRLSHATFMRRLIEDY-----------------GPDSVVMVGVRAACREEVEYARREGVEVITSRECLREGPSRVAERVRGRVEGH--DKVYISVDIDVLDPSYAPGVANPEPMGLSLEGVLEVLSPIL-DGRVVGLDVVEVCPPYD-NGLAAIHAAKLLFEELASL................... 293
391 8.000e-86UniRef50_F0T7F0 Agmatinase n=2 Tax=Methanobacterium lacus (strain AL-21) TaxID=877455 RepID=F0T7F0_METLA  ali  22  31......DVAIVGVPFDGTTNRPGARFGPRSIRTASQNYGIYLNEFGAFDSELKRLGGVNIVDYGDVPILPTHTKTNMKMINSTFKKIVDAGVFPVAFGGDHTVTYPIVKAFKK---PLDIVHFDTHLDFVD-GTENLKFSHSNPLKRVSEIENI-----------------NNITQIGIRGFTDENYDESKNYGSKIITASEVMDRGTAWVLDQIPE------SDNIYVTLDIDVLDPSIAPGTGTPEPGGLTYNQLKDILTNLTNKGEILGFDLVEVNPLFDLSEITSLTAARLCFDFLGSIF.................. 306
392 9.000e-86UniRef50_P70999 Agmatinase n=355 Tax=Bacteria TaxID=2 RepID=SPEB_BACSU  ali  22  20...EEADAILYGMPMDWTSYRPGSRFGPSRIREVSIGLEEYSPYL------DRDLADLNFFDAGDIPLPFGNPQRSLDMIEEYVDSILEKGKFPMGMGGEHLVSWPVIKAMYKKYPDLAIIHFDAHTDLRVDYEGE-PLSHSTPIRKAAE-----------------LIGPHNVYSFGIRSGMKEEFEWAKENGMHIF-----------EVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLASVHEIARSENVKGADLVEVAPVYDHSEQTANTASKIIREMLLGFV.................. 289
393 9.000e-86UniRef50_A0A256Z2Z8 Agmatinase n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256Z2Z8_9CREN  ali  21  21...EDSIFSLIGVPFDSTSYRPGSRFAPQRVREASQNIELYSLRSG------LDMERVPIYDEGDLAVVHGDVYEVMKRLEYVVEDIVNEGKVLIALGGEHIITYGILRGFKK---PTCVLYFDAHADLRDEYLGY-KLSHACTLRRLVE-----------------IVGPDKVFIIGLRALCSEEVDYIRKSGIKYLTSLMCQGLSFMDVVNNVRKFL--RGCENVYVSIDIDVIDPAYAPGVANPEPEGLSPTYLLNLLSEVI-NESVWGFDIVEVVPPIDPSGITSVLAAKIINELASYIIAKGKGG............ 299
394 1.000e-85UniRef50_A0A2E2UA25 Arginase n=2 Tax=Halobacteriovoraceae bacterium TaxID=2026745 RepID=A0A2E2UA25_9PROT  ali  34  13.........LITAATHMGQKKPGTELAGDWLKVRGLSEKISEFFSDFRDIGNVHEKEYELSDELSITKKLKKLSHYSERLSEVIFRELSQDRFVLTIGGDHSIAAGTLAASLQFDENIKVLWVDAHADLNTPRTSPSHNTHGMPVAIAMDLVNEVSEN--NLFSFLPKLKPQNIAYIGLRDVDPGERAFLDRFNIKSYDAQDVHRLGIEQVLTECKQYLDPDSTNNIHLSFDVDAIDPLYFPATGTPVPEGLSLKDGRRIIEFLNSETNLISFDLVEINPLLGGKEELDQTFASTM--ELLSALKRTRK............. 313
395 1.000e-85UniRef50_A6NUU0 Agmatinase n=16 Tax=Bacteria TaxID=2 RepID=A6NUU0_9FIRM  ali  22  16..FEQAETVLFGAPFDTTSNRPGTRFGPSALRRESYGLELYS------PYQDKDLSDCAVLDSGDLELSMGSSELALADIEARAEEILSAGKRPFLIGGEHLVTLGAFRAVHRKYPDVAIIHFDAHTDLREDYLGV-PLSHACVIRRCWELTGD-----------------GKIFQFGIRSGDREEWRWGRDH----VTCHPFDLEGLEDVVERL-------GDAPVYFTVDLDVMDPSVFPGTGTPEPGGVSFDALRRAATLVCSRCNVVGCDVNELCPPFDQSGVSNAVAAKVVREMLLAL................... 282
396 1.000e-85UniRef50_A0A0H4W4P5 Guanidinobutyrase n=48 Tax=cellular organisms TaxID=131567 RepID=A0A0H4W4P5_9BORD  ali  24  29...DDFDIALAGVPFDGGTLRPGARFGPREIRNMSSMTRAIHHVTGFNPFAVCKVADIGDVPFTG----FGQLEAAHADIRRFFAPLFAAGKKVLVAGGDHSITFPIFQAIAPR-QPLGMVHIDAHTDTWDEHAG-SKFSHGSPFRRAVEAG---------------LLDPRRTIQIGIRGATDEGWRYSLDHGMRVVFIEEFDAAGVQAIVREARRVV---GPGPAYLSVDVDGLDPVYAPGTGTPEIGGLSTR