current user: public

If you have questions about the server, please let us know.

Query: 3lhl_A mol:protein length:287 Putative agmatinase, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# E-value Template Links and tools%idFirst MSLNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLEDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWDIVGDNKIFQFGIRSGTKEEFKFATEEKHTYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIIKNSNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIKEGLast
1 0.000e+00UniRef50_A0A2G9M2T1 Agmatinase n=3 Tax=Candidatus Woesearchaeota TaxID=1801616 RepID=A0A2G9M2T1_9ARCH  ali  28  18..SSYERAGFVVVPIPYDVTESCIPGARFGPRAIISASRNLELFDEELRVNIGGAGIATL-DEPVISVIPEEMKAIVREMVSPIIADKKIPLVLGGEHSISVGVVEELKEHSKGMSVLQIDAHADLRDKFDGSSLSHACVMRRIAELCP---TVQVGIRSVSDDEMDFIRDNKLKLLWAYDIRWVKEAVSRL-SDNVYITIDLDGLDTSIMPAVGTPEPGGLLWHEVTHLLRSVAE-KRHVIGFDVVGLCPCH---PASEFTAARLVMKMIAYIARNKR.. 296
2 0.000e+00UniRef50_A0A257ABQ2 Agmatinase n=1 Tax=Thermofilum sp. ex4484_15 TaxID=2012526 RepID=A0A257ABQ2_9CREN  ali  32  18.SRKFDETPFTLIGVPLEATVSYRPGTRFAPLRIREVSRELETYSLRAGLDFEKIGVYDAGDLTLFQTDLIKNLNLIGNTFKEYVGKGKRVIILGGEHTLTLACIRELSK--EPTLLIDFDAHMDLRDEYLGSKVSHATVMRRVSELSNVS-LIEIGVRGFSEEEYEYAKKEGVTVFYLRSGAILRRVKEELKVERVYLSIDMDVLDPSIAPGVGNPEPGGLTLHSLLNLIASIVS--DKIVAFDVVEVCPPYDISDITSFTAARVVYEVASLIWRVLKKG 299
3 0.000e+00UniRef50_A0A0B5HQI5 Agmatinase n=1 Tax=Archaeon GW2011_AR10 TaxID=1579370 RepID=A0A0B5HQI5_ARCG5  ali  30  19..KPLSECKAVLLPVSFEATASYMKGTKAGPKAIIDASKHLEWFDLELGKEVKEVPIFTSETLK--PKNVKGLLESVESSVKEIVSQKKFPLLFGGEHSITFPAVKACASSFDNLSVLSIDAHADLRNELNGEKYSHACVMRRCSE---TSKIVLAGVRSLSAEEKKFAEKSGVKIFF-GNDFSVKEVVDSC-SKNVYLSIDLDAFDPSIMPAVGTPEPCGLDWGTVLGLCRELFKRKT-VVGADLVELSPIKGLRAPD-FAAAKLAYKILGY........ 281
4 0.000e+00UniRef50_A0A0S3QSR4 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A0S3QSR4_THET7  ali  43  11........DVVLFGVPFDETVSYKPGTRFAPVEIRKVSDAIETYSPYLDLDIEECPIGDVGDMELPLGNRELSLRMIEEKIDDLLAKGKRVLSIGGEHLITYALIKAYKRYYENLVLVQLDAHTDSRDTYLGEKLSHATTVRRIYELGI--DVCQIGVRSGLREEFVFAREN---YMLHHPFNLNIDLRGIVGGRPVYITLDIDVLDPSVCQGLGTPEPGGVTYRELVGFLSKL--KGVNIVGADLVELSPLWDPTGNSAVVGASLVRELSLLLA...... 270
5 0.000e+00UniRef50_A0A0G1V7C5 Agmatinase n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1V7C5_9BACT  ali  29  16.RFSYQRSRVVILPVPYEGSVSYQHGTSGGPHAILTASRQVEWYDIELGREPDTAKVHTLAEIEPMTDSVRDMIESIRTVTEKNIQKKKFQLMLGGEHSISLGAIQAYQAKYRDMSILQIDAHSDLRDTWENSAYNHACVMRRAAE--SVKRVVQVGIRSQDSTEALYASEHKDQVIFYGDDVPVQKISESLSS-HVYVTIDVDGLDPSIMPATGTPEPGGLSWKQLITLLRFVAKSHT-IIGADIVELSP-LSSNAAPDFLTAKLAHKLIAY........ 284
6 0.000e+00UniRef50_A0A2H5Y0H0 N(1)-aminopropylagmatine ureohydrolase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H5Y0H0_9BACT  ali  24  20..SELERAHIVIVPAPYEYRTSFGKGTAQGPAALLAASAHVETYDEEYDRELYELGLATLKPIPLDSLRDXXXXXXXXXXXXXLLRRGKFVVTLGGEHTIALAPIRAHFRAFPQMSLLQLDAHADLRQTYEGSPYSHACVMARVLEFFPPERLVQVGLRAISREEADSIRRAGICTVFAHAQGWEERVLERLGSE-VYITLDVDVLDPAQMPATGTPEPNGLWYHEVISFLQRIRQSGRRIVGFDLVEFAPIPGLHHA-AMTAARLVYKVLNLAFA..... 298
7 0.000e+00UniRef50_Q7V9I4 Arginase family enzyme n=43 Tax=cellular organisms TaxID=131567 RepID=Q7V9I4_PROMA  ali  41  24..REVDNCNLGIYGVNYDGTTSFRPGARFGPSSIRQVSNGIESFCPQLNLDLEDINFTDFGNLEINFGAPEPVIKKVKTASNFIYSLGMKPLLIGGEHSITIGSIQSTIEYFPNLILIQLDAHADLREEWLGSKFNHACVMRRCLEMISSERVFQVGIRSGTKKEMHELRKTKRLVNFISPAKELYNALNPHKGKPIYLTVDVDWFDPSVISGTGTPEPGGFTWQDFSAIINVL--QNHKIIGADIVELAPQLDPSGVSSIVGAKITRSLIMLLSISQ... 299
8 0.000e+00UniRef50_A0A1F3SVX8 Agmatinase n=1 Tax=Bdellovibrionales bacterium GWB1_55_8 TaxID=1797386 RepID=A0A1F3SVX8_9PROT  ali  27  24.....KDVDVVLLGIPFDGGTSFRPGSRFAPRAVREASVLSRNYHPEMAVHVYELNVVDGGDVSVNPLNFQKTMASIEAEVTRVRRAGARSICVGGDHSVLLPELRALHRTRKKTALIHFDAHTDTADQAWGEKYHHGTPVRRAIEEGRGSRVFQIGIRGPSKDQESFVRESGIHVLGIDDFHDARKLKKAAGRSPCFLSFDVDVLDPAYAPGTGTPVVGGMTSFDALRALRGLA--GLNIAAADVVEVSPPYDHAQLTSLVGAAVIFEILALMASA.... 314
9 0.000e+00UniRef50_A0A1S7HLM1 (ZYRO0G05610g) n=17 Tax=saccharomyceta TaxID=716545 RepID=A0A1S7HLM1_9SACH  ali  26  50...EPTEFDIAIIGVPFDTAVTFRPGARFGPQAIRRASQRLRGFNARAGINPYWATVVDCGDVPVTPMDNQLALKQMNEAYKELLAAPPRFMTLGGDHSVILPVLRALHAHYGPIAVVHLDSHLDTWPSYWHSEFTHGSMLWLAAGLLAKGHCVHAGIRTREDDRVGFHRIHADEMMDLTPRGVARKIKSFIKGMPVYLSVDIDVLDPSAAPGTGTVEPGGWLTRELIAVLRNL--EDLPLVGADVVEVSPPFDHADVTAMAAAQVAYEIVTSMVKTPLKG 363
10 0.000e+00UniRef50_A0A1A8LME6 Agmatinase n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1A8LME6_9GAMM  ali  25  31......DAEVVVSGVPFDLACSGRSGTRMGPNAIRQSTANLIWEGKRWPWDPERLNVCDAGNVDYAYGEPESLVDNLETHAMRWLKAGKKMLTLGGDHYITLPLLRAHAREHGPLALIHLDAHTDTYE--HGTRFDHGTIFHHALGLLVPEHSLQIGIRSYDRHNHPFEVLEADWVNEHGAAAVLERIRARVGHHPVYVSLDIDGLDPAYAPGTGTPVCGGMSTDFMLKVIRGMV--GMDLIGMDVVEVNPAYDHGEITSLAAATLGLEFLYVLAASKR.. 305
11 0.000e+00UniRef50_Q3J2B4 Agmatinase n=10 Tax=Rhodobacter TaxID=1060 RepID=Q3J2B4_RHOS4  ali  27  40.TKDLTGVDLAITGVAFDQAVTNRTGTRFGPRAIREAST-LQPYDRPFGWPLEELTVVDYGDLAFDYARTAEFPARLTAHVAGILAAGAGALTLGGDHSITLPILRAHAAVFGPLSVVQFDAHSDLWVDDDPGRIDHGTFMYKAVGLVDPARSVQVGIRTDTPDWLGMNVIDARTAHEQGPAAVAARVHAIVGHHPTYLTFDVDALDPAFAPGTGTPVWGGLASWQAAAILRDLA--GLNLVGGDVVEVSPPYDPSGITAVAGAHVAYELICLYGWRRRK. 320
12 0.000e+00UniRef50_A0A257A7M3 Agmatinase n=1 Tax=Desulfurococcales archaeon ex4484_217_1 TaxID=2012518 RepID=A0A257A7M3_9CREN  ali  33  21.SVPYDKAKYVVLGIPLDEAGTFRPGYRFAPYKVREVSEALETYSLRVKADYDGSPVHDLGDVVITPGDLEKTFYKVEEVLKSIISDSKIPVIIGGEHTITYPIIK-VLRTYKP-CVIIFDAHFDLRYEYLGSRMCHATVMRRVSEIIGLRNMVFVGVRAFCGEEANLVRQKGVKYVTAHEVKTVNVLVKFIRNSRVYLTIDMDVFDPSFAPAVGNPEPEGLTPTLVLDILSYI--TDNKLLGLDITEITPNYDVNDITSILAAKLIMEIVTYH....... 296
13 0.000e+00UniRef50_A0A0S8CRP8 Agmatinase n=2 Tax=unclassified Desulfobacterales TaxID=1403365 RepID=A0A0S8CRP8_9DELT  ali  28  16.PSSYEEATIHIIPVEMEKSVSYGGGTAAGPRAILEASLQLESFDGST--IPGQAGMYTHGPLPCQAEKVEQDLETISAEVGRVLQKNGVPVILGGEHTVTLGALKAFVESGKRIGVVQFDAHADLRDSYEDNRLSHACVMRRVYEMELP--IVQIGIRSLSQDEYIFSRAHN--LYSLGAAEIPAQVLPWDFPEQIYITFDVDCFDAAIMPATGTPEPGGLTWYQVMDLLHKVSAKRT-VCGFDVVELAPIPAMHAPD-FTAAKLVYKLMGLAV...... 286
14 0.000e+00UniRef50_A0A1Z5HDB5 Guanidinopropionase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z5HDB5_9GAMM  ali  27  36..EDAEYVDIGLIGVPWDGGTTYRSGARLAPRQVRDASTFMRNMHNTLKIKPYELNCADLGDANINAVNLLESLQWVEDFYHQVLSKDIVPLSVGGDHLVSLPILRALAKN-QPVGMVHFDAHTDMFSGFSGNSSFHGTPFYHAIGLLDPKRIVQIGIRGYTEEDRLWGLEKGVRIIDMGTEGILIEIKKVIGDDETYLSFDIDCLDPAFASGTGTPEIGGFTSIEAQHLIRGL--HGSNLIGADLVEISPPYDQSSNTALVGATLLFEILCLLADRKQK. 322
15 0.000e+00UniRef50_UPI000DBEA13F agmatinase n=1 Tax=Bradymonadales bacterium B210 TaxID=2211119 RepID=UPI000DBEA13F  ali  32  16..ESFEAARNILFGIPMDFTCCFRTGTRLGPREIRYFSDNLEDYSVEQRRGLEADTFYDAGDLELPFGNPAQCLDVIEAAVDQILQAGKRPVAMGGEHLVSAGIVRAIAKHFPDAVILHVDAHFDLRHTYAEQELSHATALRNALEMDQPPRLVQIGVRSGPAEEAEFAHRHIPQIHTAELLAELEKVRELWGDRPVYCTFDIDAVDPAYAPGTGTPEPGGLSSHQALAIARFL-PSFKHLVGFDLVETSPPLDHAGITSALSAKMIREFM.......... 292
16 0.000e+00UniRef50_A0A1G1JSA4 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=A0A1G1JSA4_9BACT  ali  30  12..ANFKKSKVVLIQVPYEKTTTYKKGTKYGPAAIIDASGYMELFDDELNQETYKIGIHTMPELEVENIPPEEMTEKIHDSALEILKSNKFPVIIGGEHTVSIGAVRALKSVYPNLSVLHLDAHCDLRDEYFGSKYNHACVARRISEICP---VVQVGTRSLSRLEKDFASQSNGRVKTLSVYDILEMWKDTVLSENVYVTIDLDVFDPCLVPAVGTPEPGGIGWYETLDLLREVARE-RKIVGFDVVELSPLKDQA-ASDFLAAKLIYRFLGYIFSNKK.. 289
17 0.000e+00UniRef50_I3XC91 Guanidinobutyrase Gbh n=750 Tax=root TaxID=1 RepID=I3XC91_RHIFR  ali  29  58MPVDADNPDVGIVGIPMDLGVTNRPGSRFGPRALR-AIERIGPFNHVLGCPVHDLRVADIGDVAFSRYRLELSHEDIEKRMNQIVDAGVVPLSVGGDHSITHPILKAVGKK-RPVGMIHIDAHCDTGGAYDLTKFHHGGPFRNAVGVLDPTRVVQIGIRGSAEYLWEFSYESGMTVIHAGIPAIIEKAKKIVGDGPAYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLELIRGL--KGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMV...... 343
18 0.000e+00UniRef50_A2BIW8 Agmatinase (Agmatine ureohydrolase) n=7 Tax=Thermoprotei TaxID=183924 RepID=A2BIW8_HYPBU  ali  33  21...PLERAEAVIVGVPFDYTSSYRPGSRFAPRAIREAAANIEFYSLRANLDVENIGISDLGDIAVSSQ-PLETLQRIEQVTRELLEQDKLLIVLGGEHTITLGVAKALAATREPLCLIVFDAHLDLRQEYMGEKYSHASVMRRVVEQV-TSNIFYIGARAFTSEEFSYMRSHGLQMVTLGLAEIVRRIRNWAKCKTLYISFDIDAYDPAYAPGAANPEPDGLETWLALELLRIIIEVPATIAVFDLVEVSPPYDCSWITSILAAKTVVEAIAAHVARR... 307
19 0.000e+00UniRef50_A3PFH5 Arginase family n=26 Tax=Prochloraceae TaxID=1213 RepID=A3PFH5_PROM0  ali  40  18..RNPKNCSIGIFGVNYDGTCSFKPGARFGPEAIRQVSSCLETYCPKLNKDLEDIMYVDFGSILIDKNDSKSVIESVKSATNYLISRRLSPIMLGGEHSITRGAIEALVKKYPDLILVQLDAHADLRESYIGNEHSHACTMKRCLEVLPEKKILQVGIRSGTKEEFEIMHNNNVNFCPGGNVHELKQALLPYSKSPIYLTIDLDWFDPSLLAGTGTPEPGGFFWNDFEEILKTL--KGFRIVASDIVELSPEIDKSGVSSIVAAKVLRSLILSL....... 289
20 0.000e+00UniRef50_A0A1Y5SQ85 Guanidinobutyrase n=41 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5SQ85_9RHOB  ali  26  36....YSDVQIGLIGVPWDSGTTNRPGPRHGPRQLRDASTMIRAQHPTSGMRPYEVNCADLGDVGPNPADILDSMTRITAFYDQVLAAGITPLTAGGDHLTSLPVLRSLAKVHGAMGMIHFDSHTDLFHSYFGGTYTHGTPFRRAVELLDPKRVVQIGLRGYDTEDRDFAAANGIRFHDRGVADVMAEARDIAGDGSTYISYDIDFVDPTYAPGTGTPEVGGPNSYQALQVVREL--EGVNIIGADMVEVSPPFDPSGGTAFLGMSIMFELLCVMAAQ.... 318
21 0.000e+00UniRef50_A0A1F4N2L4 Agmatinase n=1 Tax=Caldithrix sp. RBG_13_44_9 TaxID=1797576 RepID=A0A1F4N2L4_9BACT  ali  45  16.RATFEEAGIVLFGAGFDGTSSYRPGSRFAPMAIRSETYFAEDYSPYFEKDLTEKAIHDLGDVELAFGNTRESLDRIERVSRFIVEKNKIPVCIGGEHLITLPVIKPLIEKYPDLQVVQLDAHLDLMDELFGDKLSHGAVMRRIYELLSPKRMYQVGIRSGNKAEYEFARSH-TRLFPFRVSEFL-QIADELAGKPVYLTIDLDVFDPSLIRGTGTPEAGGILFQDYIEILRKI--QSFQLVGADIVELSPQIDTTNVSTIVTSKILRELLIII....... 286
22 0.000e+00UniRef50_L0DI55 Agmatinase n=5 Tax=Bacteria TaxID=2 RepID=L0DI55_SINAD  ali  28  40....LEGVDIALIGVPTDAGLSHRPGARYGPQAVRAQSGLIRYINPYTGVIPYEHGVVDAGDVPFQNTVLDDIVREIFSYYTQVVAAGVVPLSVGGDHSITYPILKAVASR-GPVGLIHFDSHHDTAPPMKGSRFHHGAPFRNAVELIDPRRTVQIAIRDPYRQAARYAEAHGFTVLDMGLDAVVATTRKTIGDGPVYITFDVDALDPAFAPGTGTPVVGGLSSREAMILLQGL--RGLNIVGADVVEVSPPYDPTGMTALAGAQILMELLCLASESLKKG 325
23 0.000e+00UniRef50_A0M7G7 Agmatinase n=350 Tax=root TaxID=1 RepID=A0M7G7_GRAFK  ali  29  17.....DEAKVVLIPVPYDGTSTWQKGADKGPEAFLNASENMELYDIETRSEVYRQGIYLAPPVTED-SSPEKMVEAVYKTTKNYIKQDKFVTLFGGEHSISIGSIKAFNESFEDLTVVQLDAHADLRPEYEGSSCNHACAMH---EASKTTNLVQVGIRSMDVSENDHMDEN--QVYFAHDEDWQEDAIGQMTP-NVFITIDLDALDPSIMPSTGTPEPGGLFWYETLEFLKMMFKKK-NVVGFDIVELCPNKEEKS-SDFLAAKLYYKMLSYKFK..... 280
24 0.000e+00UniRef50_A0A2E5F524 Agmatinase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5F524_9CHLR  ali  29  25..SSLPNSRIVIIPVAYDSTTSYKSGARDGPLAIIQASRHMEDYILEINRDMSGYGIHTHPQLEPRTDSPQSMIQQIENVANKYASMGKLVVTLGGDHSITIGTVRAHHSLYPDLSVLYFDAHADFRNEYQGSTYGHASAARRIYD--QVNQLVQIGIRSISSEEADFIADHRIPFHSLTPEERVTAITSRL-SDNVYISIDLDVFDPSEMPSVGTPEPGGLRWHELLSMIRGISERH-KIVGFDLVELAPQEGPNFA-AYTAARLAYTTIGYALQSQ... 316
25 0.000e+00UniRef50_A0A2R4ZMC6 Uncharacterized protein n=2 Tax=unclassified Desulfurococcaceae TaxID=132567 RepID=A0A2R4ZMC6_9CREN  ali  34  19.........FSFVGAPFDSTSTFKPGSRFAPDYLRVYSRSLELFSPRSGVDMEEIGVYDEGDVAVFHGDSLKTIEAIETVVKDLISEGRIPIVVGGEHTVTLGPVRALPR---DIGVVVLDAHMDLRDEYMGNKFSHACVSKRIADLLGPGSVLLVGVRAYTKEELRVAAKSGVDYVTSGRRAVAGKILRFMDNKHIYLSIDIDVLDPSFAPGTGTPEPDGIATWDLLDLLYDVVDE--RVSGFDVVEINPLADPSGVTSMLGAKIVFEVASYIYSKR... 289
26 0.000e+00UniRef50_A0A151BFP1 Agmatinase n=1 Tax=Candidatus Bathyarchaeota archaeon B25 TaxID=1779369 RepID=A0A151BFP1_9ARCH  ali  31  18....YEEADYVVLGFPYDLTSTYRLGSRNAPNAIREASLNIETYSPRTGLFLENLKIRDLGDLEVST--LEDPFQQLTAVFKDVFNAGKFAVTLGGEHTLTHSTVKALPE---NVMLLVFDAHLDMRDVYEGRSFSHTTHLRRLTEEIDPNRLLMVGVRAIAMEELESARKRGIRYITHGFNWTVRRIEEHFKASSVYISFDMDVLDPSYAPAASNPEPEGLNPTFTLNLLEVLASRIPEVVGLDLVEFSPAYD-NGVTAVLGAKIVFEVLCLVEAA.... 291
27 0.000e+00UniRef50_G0L5B5 Agmatinase n=10 Tax=root TaxID=1 RepID=G0L5B5_ZOBGA  ali  28  17....LETAKVVLIPVPYDGTSTWGKGADKGPQAFLEASENMELYDIETDSEVYEQGIHLAEAI-TENSSPEAVVNAVHKQTKDYIKRNKFVTLFGGEHSISIGTIRAFNECFDNLTVLQIDAHADLRESYEGTKYNHACAVH---EASQTTNLIQVGIRSMDAIEKSFMDEEKTFFHDMHDEYWTDKVIEAM-TDNVLITFDLDAFDPSIMPSTGTPEPGGLFWYETLEFLKQVFKEK-NVVGFDIVELCPNP-ADKSSDFLAAKLYYKMLSYKFM..... 283
28 0.000e+00UniRef50_P0DJQ4 Proclavaminate amidinohydrolase n=47 Tax=Actinobacteria TaxID=201174 RepID=PAH_STRC2  ali  26  21LPHDPQGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLNCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDLIDPAAMVQIGIRGHNPDSLDYARGHGVRVVTADEFGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKP--VGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAHR.. 310
29 0.000e+00UniRef50_A0A1H9BWP0 Agmatinase n=5 Tax=Streptomyces TaxID=1883 RepID=A0A1H9BWP0_9ACTN  ali  28  47........DVVVVGAPYDGGTSYRPGARFAPRAIRHESCLIHGTGIDRGPNVFELDVVDGGDIDLSPFSMDLAMETATEALTALLDDNAAFLMLGGDHSLSLAALRAVRHKHGKVAVLHLDAHSDTNPPVYGGTYHHGTPFRWAIELIEPAHMVQLGIRGPRPDSLDYARGHGVRVITAQEADVAAEIRAVVGDLPLYVSVDIDVVDPAHAPGTGTPAPGGLTSREVLSLLTLVG--DLNPVGFDVVEVSPPYDHSGITALLAAEIGAELLYQYAR..... 323
30 0.000e+00UniRef50_A0A2D9LMI3 Agmatinase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D9LMI3_9CHLR  ali  29  41.....QGVEVAIMGAPFDMGVVNRPGARFGPRAIRQAGYNDDLYHMGLQVYPTDLSVADFGDANCPPSSLERSHEAIQAKVSQCLKAGALPIVVGGDHSITLPSATAVANHYGPVGIVHFDAHADTAPTYGGVLASHSSPMRRLIEIVQGKNFVQVGLRGYWPTLFDWMREQGMRWHQMSEIEVLDDAISEALDGPIYLSVDIDVLDPAFAPATGTPEPGGLTSVELLRAVRTIVGS-VETVAADVVEVAPDYGPANITAEAALRVILEILSSLANKKK.. 334
31 0.000e+00UniRef50_F6GDY8 Agmatinase n=221 Tax=cellular organisms TaxID=131567 RepID=F6GDY8_LACS5  ali  29  16....LETSKIVLIPVPYDGTSTWQKGADKGPDAFLNASENMELYDIETETEVYKQGIY-LADAVTENTSPEAMVDAVHKATKKYIKKNKFVTIFGGEHSISIGTIRAFNEMYPSLTVLQLDAHADLRKEYEGSKCNHACAVY---EASQTTNLIQVGIRSMDVIETTVMKEKTYFAHEMAIDDWMDSAVDQM-TENVFITIDLDAFDPSIMPSTGTPEPGGLLWYETLEFLKQVFAEK-NVVGFDIVELCPNK-IDKSSDFLAAKLYYKMLSYKFEN.... 283
32 0.000e+00UniRef50_UPI000C8199B3 agmatinase n=2 Tax=Eggerthellaceae TaxID=1643826 RepID=UPI000C8199B3  ali  28  15......GYDVAILGFPFDVGASARSGARFGPRGVRDASTLYGLYDPVRNVEYLDQGIIDCGDVDVSPCGFEQSFENCEAAVRCIIDSGAVPVVIGGDHSTTIPVVRAL-DRYDDVCIVQFDAHLDWTDSYGEFTCSHSSPMRRSSELAHVGRMMQIGLRGLGPADFAEARAWGSTIVSAPELEGMEAIIARIPDEHYYITVDIDGLDPSLCPGTGSPQPGGLLYEEVNDLVYAVVKKG-DVVGFDVSEVAPPYDHADQTSLYAAQIILDFICFYTKKRSQG 300
33 0.000e+00UniRef50_A0A2M7WK25 Agmatinase n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID=A0A2M7WK25_9BACT  ali  32  11...PYEDSRAVIIPFGYEKTVSYLKGTSRGPGAIMEASSQLELYDIQTDSEPHLMGIHTLSETEIEGLSPEKAQDFIYDAVQKTLNDGKLPVLLGGEHSISAGSVRACKEKFPDLTVLQIDAHADLRDSYEGSKYSHACAMSRIAESAP---YVGVGIRSVGTEELDAFKKKRITVDDFRRLNNFKSIIDKL-TENIYITIDADGYDPSIIPGVGTPEPGGLTYQETDNLLSEVI-TNRNVVGFDFVELRPITGEV-RSEFTAAKIIYKIIARIFRK.... 283
34 0.000e+00UniRef50_A0A1Y5R7U2 Guanidinobutyrase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1Y5R7U2_9PROT  ali  27  29.AEDWTGLDIGLIGVPFDGGVTNRPGARHGPREIRNQSSLIRRINHATKIDPYALRIADLGDAWVEPFELKGAHDEIAAFYKAVQAAGIVPVSAGGDHSVTLPIFRAIA-ADRPVGMVHFDAHCDTGDDYLGSKFHHGAPFRRAVELLDPKRTIQIGIRGSVNDLWSFSHESGMRVHEIGVKGAIAEARRVVGDGPVYVSFDVDGLDPVYAPGTGTPEVGGFSTLEAQLMIRALG--DLDIIGGDVVEVAPPFDPSGNTALVGATIMYEILCIAAAARRNG 319
35 0.000e+00UniRef50_A0A0G0R0R1 Agmatinase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G0R0R1_9BACT  ali  27  13...SYEKARAVIIPVPYDVMASYGTGARFGPDAIIRASQQVETYDEELEKDLDHLPLFTHEPLAPDKSSAEAMMDKLEAIVKEVDEDGKIPVVLGGDHSLSIAPSRYFAKKYPGVGILHLDAHSDLRTIWEESPFSHASSMRHAYNLG--ANMVQVGIRSMPKEVVDECKEH-RKVFLAPDVPV-EEILAAL-PDKVYISLDIDVLDPSLIPATGTPEPGGIGWYDLLKLLRAVATKK-QVLGFDLMELSPVPGLIHP-EYAAARLLTKFFGYLLA..... 278
36 0.000e+00UniRef50_A0A1V5EA33 N(1)-aminopropylagmatine ureohydrolase n=3 Tax=Bacteria TaxID=2 RepID=A0A1V5EA33_9DELT  ali  28  14.....KKAAFVVVPVPYDLTTTYQSGSRRGPAAILDASGNMELYDEELDQETYLAGICTFAPIEAEAAGPEAMVRKVEERVTAASQGGKIPVVLGGEHSISLGAIRALKRRHANLSVLQFDAHADMRESYQGSPYSHACIARRAREICP---VVQVGIRSLSAEEAVFLKANPVKTWSVEAIDWPEDLCRDLSDD-VYVTIDLDVFDPSLMPSTGTPEPGGLLWHEVLSVLRE-VCRRRRVRGFDVVELAPLPGIIAPD-FLAAKLTYRTMGYLVQAAGRG 287
37 0.000e+00UniRef50_C3MH08 Agmatinase SpeB n=93 Tax=Bacteria TaxID=2 RepID=C3MH08_SINFN  ali  29  58MPVDADNPDVAIVGIPMDLGVTNRPGSRFGPRALR-AIERIGPYNHVLGCPVHDLRVADIGDVPFSRYRLELSHEDIEKRLNQIVDAGVVPLSVGGDHSMTHPILKAVGKK-QPVGMIHIDAHCDTGGAYDLTKFHHGGPFRNAVGVLDPTRVIQIGIRGSAEYLWEFSYESGMTVIHAGIPAIIEKAKKIVGDGPTYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLELIRGL--KGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMV...... 343
38 0.000e+00UniRef50_I4BVN5 Agmatinase n=4 Tax=Acetomicrobium TaxID=49894 RepID=I4BVN5_ACEMN  ali  38  13......DARWILFGAPSDAAVSRRGGAQYAPDAIRWESLHIETYSPYLGEGLGKASFFDVGDLFFVPGDIQSSLLKIEKVTSSFARKGKRVFILGGDHLVSLGSVKGVLSKFSDLHVVHFDAHADLRDYYLGSKYSHATVMRRVAELASPRHLHQFAIRSGTREEIEWGKRN-VDLHLIDFLEPLKEVLGKLEGCPIYVSLDIDVLDPSFAPGTGTPEPEGVSVTDLFKALRMF--KGHNVVGFDLVEISPPVDVNGVTSVLGAKIVREVLIML....... 278
39 0.000e+00UniRef50_D8FAF1 Agmatinase n=3 Tax=Proteobacteria TaxID=1224 RepID=D8FAF1_9DELT  ali  27  24.RVNPDQALFHVIPVPYEKTVTYGTGTRKGPAAILEASQQLELYD--GKGIPAEKGIYTD-TVHSCGGEEDVVLDALAVRVEGILAKRKIPLILGGEHTITAGVLKGVARLLGSIGVIQFDAHADLRDRYEGSRYNHACVMRRVLEMGH--RLFQIGTRSLSMEEAVYRKKRGLDTLDAEDIGIPETLLPENFPDNVYLTIDVDCMDPSLMPATGTPEPGGMTWYQMMEALSRVCRQ-RKVIGFDIVELAPMTGFHAPD-YTIARLIYQMMGLITE..... 294
40 0.000e+00UniRef50_F8E6K6 Agmatinase n=1 Tax=Flexistipes sinusarabici (strain DSM 4947 / MAS 10) TaxID=717231 RepID=F8E6K6_FLESM  ali  45  13..KSVEKSELLIFGAPYDGTSSFRPGSRFAPDKIREASYGLETYSPDYDMDIEDLNVGDIGNVEFPFGEKDKVFKEIRSCTANLLDMNKKILCLGGEHLITLPIIEELSRIHGNLKLIHMDAHADMRDTYISEKLSHATVLNNITELIGHKNIFHYGIRSGTREEFD--KIAKFNNLNMKNGKLSENI----GDDPVYLTIDLDILDTSVLPGTGTPEPGGLTFKELSELL--FSFKGFNFVGADVVELAPDYDITGVSSIVAAKVVRNAICTL....... 276
41 0.000e+00UniRef50_A0A0S8JPC9 Uncharacterized protein n=2 Tax=candidate division TA06 TaxID=1156500 RepID=A0A0S8JPC9_9BACT  ali  35  4..SSFDDARIAIIGAPYDGTASFLPGARLGPQAIRAASEAVETYSPYLDLDLEDVPFCDRGNLIFEQMTPEGVHQTVRTAVSECLTAGKRTIVLGGEHTVTLGAVEATDKVHKDLVVLQLDAHLDLRDAYLGERLSHATVMRRVREVVGAERLIHLGVRSGERDEFAEAK----HVFRYTLGNHLAAMTSIVGGRPVYLTLDIDLLDPGAMPATGTPEPGGPGYRELIECVHHLGTS-LQVVGSDLVELNPLAAPARWPSVMAAALVREMILILWLSLKH. 276
42 0.000e+00UniRef50_A0A2P5K4K6 Agmatinase n=1 Tax=ANME-2 cluster archaeon HR1 TaxID=1968520 RepID=A0A2P5K4K6_9EURY  ali  33  12..SSYRDATFIIFGAPFDYTSTYRKGSRLAPGAIREASYSFETYNAFFNVDLCEVPLHDAGNIEISNNSIEQAITAVGDMVNKVLAQGKIPIMLGGEHSLTLPCIKEAKFRYHDLGAVILDAHLDLRDDYSGEKNSHACISRRIIEDV-TGKYISIGIRSGSRHEYSIADLTADNIYDMGCDNVHTELTRYLNTRHLYLSLDMDVLDPSFAPALGTPEPFGLTDRQVLSFIRKLAPRS---IGFDVVEIAPQYDR-GYTALLGAKFIREFIAAVWANKEQ. 291
43 0.000e+00UniRef50_A0A2H3JBH6 Arginase/deacetylase n=3 Tax=Agaricomycetes TaxID=155619 RepID=A0A2H3JBH6_WOLCO  ali  25  75LEDTTAGFDIALLGMPFDTGVTYRPGARFGPYAIRSGSRRQRGYTLAWKVNPYELGIIDCGDVPVSPFDNALAVDQMEVAYSSLLARHPRIITLGGDHTIVLPILRALHKVYGPVSVIHFDAHLDTWASYPGSRVTHGTFFYLAQEEGLMTNSIHAGIRCENDKAVGFQLISTDDIDDLGVAEIIKRIRARIGDSPVYLSLDIDVIDPGLAPATGTPEAGGWTTREVKRIIRGLA--GLNFVGADIVEVAPAYDNAEITAIAAADIVHDFLSMF....... 388
44 0.000e+00UniRef50_Q2NRD3 Agmatinase n=372 Tax=Bacteria TaxID=2 RepID=SPEB_SODGM  ali  27  32......DADWVITGIPFDMATSGRAGCRHGPAAIRQVSTNLAWEGCRWPWDFDRLKVVDCGDLVYEFGDAQDFCDKLQDHAERLLAAGKRMLSFGGDHFVTLPLLCAHAKHFGKMALVHFDAHTDTY--ANGSKFDHGSMFYHAEGLISPAHSVQIGIRT------EFERDNGFTVLDAGVDDILAQVKQIVGNLPVYLTFDIDCLDPSAAPGTGTPVIGGLTSDRALKLVRGL--QPLNIVGMDIVEVAPAYDQAQITALVAATLALEMLYIQGAKR... 304
45 0.000e+00UniRef50_A0A1V6I9K6 N(1)-aminopropylagmatine ureohydrolase n=1 Tax=Deltaproteobacteria bacterium ADurb.Bin026 TaxID=1852864 RepID=A0A1V6I9K6_9DELT :_  ali  28  13..SDYQNAAIVILPIPFDKTSTWLKGADKGPEAILEASAHLEFYDIETDTEVLKRGIFTADPIQADSSDV--LIDKSESVVSKYLNDDKFVVAVGGEHSISIGVIKSYVKKYKDLSVLHLDAHADLRDTYEGSRYNHACVIARVMEF--TEHIVSVGVRSIDVEEKP--RIQNIKMFFAHGIEWIDEAVGRLTDD-VYITIDLDVFDPGIMPSTGTPEPGGLGWYQVMKLLFAVSKSK-RIVGFDVVELCPS--DSKAPDFLAAKLIFTLLSNIYANR... 282
46 0.000e+00UniRef50_A0A1Q7RKF5 Agmatinase n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7RKF5_9BACT  ali  27  19..STLESSRIVLLPVPYDRTASYMKGTARGPEAIVDASRYMELYDDELDAEPYTIGIHTAPPVSGNDDPPEVMTRKVEEATARHLEKGKMPVILGGEHSVAVGAIKAYHKKHPKLSVVQFDAHGDLRATYEGSEYSHACAMHHFAGRLP---TLQLGIRAISREERDLIRDKRLMVIPARDIARPQMALEAVDTDEIYLTIDVDYFDPAIMPATGTPEPGGPGWYETLAFIREVCRRK-RLVGFDVNELRPLGDDVAPD-FLAAKLVYKILGY........ 287
47 0.000e+00UniRef50_A0A292RDE8 Agmatinase n=37 Tax=root TaxID=1 RepID=A0A292RDE8_9BACT  ali  44  15.NPDYDTANIIMLGLPFDGTVSYRSGSRFAPEQIRLASWGLEEYSPRFDKDINDCNFHDIGDLEFPLGNTVKSLELIKDNVKQIYDDGKRLLGIGGEHLVTYPEIVAISDVYGDLAIVHFDAHTDLRDEYMGEKLSHSAVIKLCSSYVRPENIKQIGIRSGMKEEWEFMKRNNTFIKDNNDY----KSLDCLLDKKVFITVDLDVLDPSVMSGTGTPESGGMSFNELMGWFEYL--KKFDIIGADVVELAPDYDTSGCSTAVATKVIRELLMIM....... 282
48 0.000e+00UniRef50_A0A0B6X0Y5 Agmatinase n=2 Tax=Pyrinomonas methylaliphatogenes TaxID=454194 RepID=A0A0B6X0Y5_9BACT  ali  29  17.......ARVLVWPVSYEGTVSYGAGTARGAEAIIDASRNMELYDEELDAETYRIGIHTLP-IFPPAPSPAEMNQKLYEEARRLVSTGKFLVTLGGEHSITAPIVRAHAERYANFSVFQIDAHADLRATYDDTPYSHACVMRRIVEDLRIPA-VQFGIRSMSAEEARVKDRLPTRIFWAKDVQSWNEAISLL-TENVYLTIDIDGLDPSLVPHTGTPEPGGLGWYETLGLLRALAGR-RRIVGMDLVEYAPA-GEHHASAFLCAKLVYKTLGYIFA..... 284
49 0.000e+00UniRef50_H8I4U2 Agmatinase n=6 Tax=Euryarchaeota TaxID=28890 RepID=H8I4U2_METCZ  ali  35  11..SSFDDATFVLFGVPFDGTSSFRTGSRWAPMEMRKASYNFETYNGDLDVDLVDVPVHDMGDIE-AYCSVDDTLDAVYDVASGIVKAGKLPIMMGGEHSLTYPCVKAC----GKVGFVVMDAHHDLRQEYGGLRNNHACVSRHIIEDL-ADRYVSIGIRSGTKEEYEYVRNKGIDVDAMGIDAVLRETEAYLGCDRIYLSLDMDAIDPAYAPGLGTPEPFGMTPRQVREVIRRLA---PKTVGFDVVEISPVYDH-GVTAILGAKLIRDFIAAKWKS.... 282
50 0.000e+00UniRef50_A0A0B7JEV9 Agmatinase n=82 Tax=root TaxID=1 RepID=A0A0B7JEV9_PHOPO  ali  27  24LNFSPSDADVIITGVPFDMATTGRSGSRMGPGAIRQISTNLAWEGKRWPWSLKSIKIADCGDLVFDCGDAGQMCERLEAHATGLLEQGKTLLTFGGDHFVTLPLLRAHAKQFGKMALIHFDAHTDTYD--QGSKFDHGTMFYHAEGLIDPTHSVQIGIRTEHSDKLGFNVISADTANDWSVAQIVEKIKATVGDMPVYLTFDIDCLDPAYAPGTGTPVCGGITSDKALKIIRGL--QGINLVGMDVVEVAPAYDHADITALAAATIATDLLHLWAIQKQ.. 305
51 0.000e+00UniRef50_Q4WHD9 Agmatinase, putative n=118 Tax=Pezizomycotina TaxID=147538 RepID=Q4WHD9_ASPFU  ali  30  65.....ERYDIAVIGAPFDTAVSYRPGARFGPRAIRAASARGTSYNTRAGINPYWATVKDCGDIPITPFDNGLAERQMYEAFLELGSRKAKLVTLGGDHSIALPALRALYQIYKPITVLHFDAHLDTWNPSEQSHFNHGSFFHKASGLICNSTSAHAGLRAPNTPEQGFMRIHADDIDELGPMGIVDKIIERIGRDPVYLSVDIDVLDPSTAPGTGTPEPGGWTTREFIRILRGI--EKLNIVGADIVEVSPSYDNGETTALAAAQVAFEIITSIVKA.... 384
52 0.000e+00UniRef50_A0A2C9D6R5 Agmatinase n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2C9D6R5_9RHIZ  ali  27  40LSRELENVDAVVWGIPFDSAVSNRSGARFGPQAIRRASAIFDGYPFGFDI-FEELAVVDWGDCSLDYGRPQDARLQIEAQAGEILDAGCHLFTLGGDHYVTWPLLRAHAERFGPLSLIQFDAHQDTWHGDDDDRVDHGAFVAWAHGIIDPSTSIQVGIRTHAPEDCGLEILYGHDIDRLGIAGVLDRICNRVGDNRAYMTFDIDCLDPAFAPGTGTPVSGGLTTREMIALITGL--EDIDFVGGDVVEVAPAYDHADITAIAASTVAQSYLGLLAAKKRGG 322
53 0.000e+00UniRef50_A0A0D5L6C9 Agmatinase n=54 Tax=root TaxID=1 RepID=A0A0D5L6C9_9BURK  ali  26  26.ARDPQDYDIALAGVPYDGGVTARPGARFGPREIRNMSTMMRAIHHVMRFNPFEARVADIGDVPFEHYDIERAHADIRAFFEPVFRAGKRALIAGGDHSITFPIFQAIGAAKTPLALVHIDAHTDTWDAYKGSKFTHGAPFRRAVELLDPTRTIQIGIRGNTDEGWRYSLDHGMRVVFIEEFEALAEARRIVGDMPVYLSLDVDGLDPVFTPGTGTPEIGGLTTRETLALLRGL--DGLNWVGGDVVEVSPPYDPSGNTALVAATLMYEMLCLFAR..... 313
54 0.000e+00UniRef50_A0A1B8EI92 Uncharacterized protein n=168 Tax=Fungi TaxID=4751 RepID=A0A1B8EI92_9PEZI  ali  27  75.......YDIAIIGSPFDTAVSYRPGARFGPRAIRAASARQRGFNPRAGFNPYWATILDCGDIPINPFDNELAYRQMTEAFSELASQKPRLITLGGDHSLALPALRALNELYGPVAVLHFDAHLDTWHPSEQSHFNHGSMYWIASGLIANGSSVHAGLRGWDDYEDDFFRISADDIDDIGPAGVAKLIVEKIGTDPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV--EALNVVGADIVEVAPAYDRGEQTALVAAQVVYEILTSMVKR.... 377
55 0.000e+00UniRef50_UPI0004898695 agmatinase n=1 Tax=Rhizobium leguminosarum TaxID=384 RepID=UPI0004898695  ali  27  30.ALPLERADVGVVGVPFDLGSSYRAGSRHGPAAIREASRVLRLVNGHTGVAPFEIRIADLGDAKIHPLNFDQSIEIITRCFLQLSKMAVRPLVLGGDHTISLPILRGLVQR-EKVGMIHFDAHSDTSDETRGMKISQATPFRRAVELLDPERVVQIGLRGYGRDDYKWARSVGMTLITIDDFEVIEEIRDIVGTWPAYLSFDIDCLDAVFCPGTGVPEPGGVSMRDALVMLRGL--RGIDLIGADICEVSPHFDVGGITSLHAAHLGFEMLCLLAES.... 316
56 0.000e+00UniRef50_A0A2S8ST49 Agmatinase n=1 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8ST49_9BACT  ali  28  21..AEFETARFVVLPVPYDSTTTWRGGTRSGPAAIIEASMNMELFDRELGREICDAGMHTTDDIEPVMSGPEGMASRVESVIGEVLDAGKIPVMLGGEHSLTLGGVRALAARNEKISVLQIDAHTDLRDEYADTKFGHGCVMRRCSEIPNVSKIVQVGLRSTSREEHENIPANVIQ-FWADDINQIPRILRELEGT-VYLTFDVDGCDPSWMPDTGTPEPGGLSFTQVRDLFKAVCATK-NVGALDCLEL---IGGHEASAFAVARLLYKTMGYLSEN.... 294
57 0.000e+00UniRef50_A0A1F9YS33 Agmatinase n=4 Tax=Euryarchaeota TaxID=28890 RepID=A0A1F9YS33_9EURY  ali  34  13.SFSFEDSEFVIVGVPFDRTTTYRSGTRFAPTAIREVTHVFEKENFEHGTTFEDIPVHDAGDL-YEEGTVDDMVMAIEEEARRIVLAKKFPLFMGGEHSISPPVVKAF----GDISVITIDAHLDFRDEYQGLRNSHACAHRRIVDHVGKGNAFAFGVRSISSDEDEALYADSFRIHKEGCEKVFEEMLSKLKRKPVYLSLDIDGIDPAYAPGTGTPEPFGITPWDVRYIINRL---GDRLVGFDVVEVCPPYD-NGNTSILAARMMREVMAWKAMHAKKG 287
58 0.000e+00UniRef50_Q9I6K2 Guanidinopropionase n=69 Tax=Proteobacteria TaxID=1224 RepID=GPUA_PSEAE  ali  26  30..TDPAALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGRE-RPLGMVHFDAHSDTNDRYFGNPYTHGTPFRRAIELLDPLRTVQIGIRGYSPDDDAFARECGIRVIHMGVEATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGL--RGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAES.... 313
59 0.000e+00UniRef50_A0A2B4RYE8 Agmatinase, mitochondrial n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2B4RYE8_STYPI  ali  24  59MQSTADGLDACFLGIPMDNGSAHRTGARMGPRQIRCESCLLRPHNTHTGAAPYELMVADVGDVSVNVFNIEANINIIHQHVASIISDGCKPLIMGGDHTISYPILKAMKEKYGPVGLVHLDAHPDTSKTTFGEKISNATPFRLAAELLDCERVVIIGLRGNSPIDYEYGRNLGFKIVPAKYCWLMAQVRELMGDAPVYITFDIDAVDPGYAPGTGTHEIGGLTSIQALEIIRG--CRGMKIVGGDLVEVSPMFDVQGATSILAANFLFEMLCVL....... 342
60 0.000e+00UniRef50_A0A0M9VQ94 Agmatinase n=1 Tax=Malassezia pachydermatis TaxID=77020 RepID=A0A0M9VQ94_9BASI  ali  30  53......DFDVAVLGVPLDTAVSYRPGARFGPRAIRAGSARFRSFNPALGVNPYKTKFLDCGDIPVTPFDNELAFQQIEDAYDDLLHRNVKPVVMGGDHSIALPILRSLNKVYGPVSVLHFDSHLDTWAPNQYSGYTHGTMLYHASQEGLVSNSMHVGLRGLSGADFEDYRRDAWEVDQLGLDGTVAAIRERLGDSPVYLSIDIDVLDPSIAPGTGTPVSGGLTSRELRSIIRML--SGINLVGCEVVEVSPPYDTNGVTALAAAELLYELMSVMA...... 375
61 0.000e+00UniRef50_A0A2H0PGW0 Agmatinase n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_47_16 TaxID=1973975 RepID=A0A2H0PGW0_9DELT  ali  25  15....YNNANVVIVPCPYEHTTSYGQGTSNGPAAILEASRQVEYFDEELWTEPYKAGIFSADPIAFAGKTGEEAINQIAATVGKFYADNKLPIILGGEHSLSTGCIMAAHRAYPDLTVVQVDAHGDLRTSYHETPWSHACIMRRVDDLGIP--SVGVGIRAICEEEAVLIREKKLKRIFAHELDAQEKWIDRALDGPVFLTFDVDGIDPSLIPATGTPEPGGLTWQQSTHFIKALCER-CNVVGMDFVELAPNPEQS-ASDFAVARLVYKSIGYWARAK... 287
62 0.000e+00UniRef50_A0A2E2E306 Agmatinase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2E2E306_9PROT  ali  31  62.SPDFGDLQVAMVGVPMDLGVTNRPGARFGPRAVRTI-ERIGPYNHVLKCPVSELRVADIGDVPFSRFSLNSCHEDIEDYLAKIVAAGVIPLSIGGDHSVTLPIMKAIGKKA-PIGMIHFDAHCDTGGEFDNSKFHHGGPFREAVGVLDPERCIQIGIRGPAEYLWEFSVDSGMTVIEMGPAAVIKKARDVVRDGPVYVTFDVDCLDPAFAPGTGTPEIGGVTSREAMTMLRGLA--GLNIIGGDVVEVAPQYDSTTNTAQVGAQILFEILCLM....... 340
63 0.000e+00UniRef50_A0A268E999 Agmatinase n=1 Tax=Bacillus sp. 7586-K TaxID=2021690 RepID=A0A268E999_9BACI  ali  31  25.TNDLENVDFAVIGVPFDTGAGYAVGTRFGPAAIREMSQRLRPINPALNIELSKMNGIDYGDLTVHPGYIEYSYEEIEAQLEPIFEKGIIPILLGGDHSVSLPHIRAAAKKYGPVSLVHFDAHSDTWRSDDPKKYSHANMFSLGADEIDPHTSIQMGMRGGGPPDFESSIALGYEVLSTDDVELCEKVKQRVKNRPVFLTFDVDFLDPVYAPGTGTPEVGGFTTYEAMQMIRGIC--GINIIGFDIVETLPDRDPAKVTALNAATITHQVLSIIAMKK... 311
64 0.000e+00UniRef50_A0A225AKU7 Putative agmatinase 2 n=3 Tax=Dikarya TaxID=451864 RepID=A0A225AKU7_9EURO  ali  29  53LAASHEEPDIAILGFPYDTSTSYRPGARFGPRGIRAGSSRGRSYNTVWGVDPYEQGIIDCGDVPITPFDAAHAFKQMEQAYRQILWKHPRILSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGSAITHGTFFWHASGCISKGTSVHGGLRTIDRDVVGFTLIEAHEIDEIGVHGIVEKVRKAVGDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKAFLKGL--EGINLVGADVVEVSPPYDVAETTSVAAADLLVDILAGMTKS.... 362
65 0.000e+00UniRef50_A0A1X6ZLI4 Agmatinase n=1 Tax=Roseovarius albus TaxID=1247867 RepID=A0A1X6ZLI4_9RHOB  ali  27  35.SRDLQGVDIVAWGVPYDLSVTNRPSCRFGPRGIRAASTNV-TWDWFWDFDPEKLHMVDYGDCMFDPGFPMEIPEVIYQEAMSILQSDAFLLTMGGDHSVTYSVLKAQAERHGPISLIQIDAHSDTWEE-SPKRFDHGSMFYHAAQEGAPETSVQAGLRTYNSSTHGFTTLTAEFVHEQGVAATVAKIKEVVGDLPAYLTFDIDALDPAFAPGTGTPVCGGLSSWQAISLIRKLA--GVNLIGADMVEVSPPFDHAEITSLAGATLLLEMVCLIASQK... 313
66 0.000e+00UniRef50_A0A1G0YDN1 Agmatinase n=2 Tax=unclassified Lentisphaerae (miscellaneous) TaxID=641407 RepID=A0A1G0YDN1_9BACT  ali  32  15LPSSPGTALLHVIPAPYEKSVCYGKGTANGPSAILHASHQLETFD--GKSDPSDLGIFTHPPVDC-LGSHEFALKRIEKTVAEVLRIGKVPVMIGGEHTVTFGAIKALSVKFADFGVVQFDAHADLRDSYQKSGYSHACVLRRIHELGIP--VFQMGVRSICAEEHEYRKKKKIPYLDAEVKGIPGKILPASFPKKIYLTFDIDALDPSVVPSTGTPVPGGLGWYQTMELLENV-LKGRKLLGMDLVEFSPVKTFHYPD-YTAANLLYNIFGIAQRAK... 288
67 0.000e+00UniRef50_U1MUQ6 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=U1MUQ6_9MICO  ali  29  70...EVEHADVAVVGIPFDSGTSFRPGARFGPAHVREHSRQLHPYHQVHESFPFDQQVVDGGDLRVGPYDIEAAVEAIHEQARALVQGGTTVVAIGGDHTIALPLLRAAAERHGPLAVLHFDAHLDTWDTLHGASIWHGSPFRRAAELLDLERCQHVGIRGYDPSELDFAIIRSDDFARHSPEQLAERIRDRLGTGQVYVSIDIDVLDPAHAPGTGTPEVAGISTRELFGVLREL--RGLDIVGGDVVEVLPAHDHAGITGLAAAHTVWELLALI....... 349
68 0.000e+00UniRef50_U4LG95 Similar to Putative agmatinase 2 acc. no. O42887 n=2 Tax=Pezizomycotina TaxID=147538 RepID=U4LG95_PYROM  ali  29  69LSQPSETFDIALIGAPFDTATSYRPGARFGPRALRAGSQRAASYNALTGVNPYWAKITDCGDIPLTSFSSELALAQMTSAFEEIMTHKPLLVTLGGDHSIILGALRAVNKIHGQVAVLHFDAHLDTWDPYVGTPFTHGTMLNLAEGLISNNSNVHAGLRTADDTEQGWLRIGSEDIDDLGAKGVVEKIVQRLKGKKVYLSFDIDTLDPAVAPGTGTPEVGGWTMREVKRILRGITAEDVELVGMDIVEVAPAYDNQGITALAGAQVVFEVLSGYVKK.... 370
69 0.000e+00UniRef50_A0A1C5VKZ9 Guanidinobutyrase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C5VKZ9_9FIRM  ali  29  33...DIDGEDFVVLGVPYDTSVTNRTGCRFGPRAIRNAYGAGRLYEQDNSYKVANLKGMDMGDIGVVLGYVEETMELIRESVRKVLDAGAVPIVLGGDHLIAYAELKAYSEKYGKVAMVHFDTHEDTWDYGDRIKYNHGTPFRNAIEILDTEHSIQVGIRSGGDTYRKYAQDHGMKVITAGIKETCRRIKEQVGDAKVFITFDIDFLDPVYAPGTGTPMPGGFSTYEACEIIRN-GLAGLDIVGFDLVEVMENYDPAGITAINAVAILKQFVILLSKKKAE. 318
70 0.000e+00UniRef50_A0A088U2K6 Agmatinase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A088U2K6_9BURK  ali  29  31...DPAQLQIALVGVPWDGGTTNRAGARHGPREVRNQSSLMRRVHHVSRIAPYDLRVGDLGDAPTNPIDLLDSLARIERFFRRIDAAGAVPLSVGGDHLVTLPIFRALAAR-RPIGMVHFDAHSDTNDRYFGNRYTHGTPFRRAIELLDPQRTVQIGIRGYSADDEAFARDCGIRVIAMGVAATLAEARRVVGSGPTYVSFDVDVLDPAFAPGTGTPEIGGMTTLEAQHLVRGL--QGLNLVGADVVEVSPPFDAGGATALVGATMMFELLCILADAISR. 316
71 0.000e+00UniRef50_M2SP37 Uncharacterized protein n=6 Tax=leotiomyceta TaxID=716546 RepID=M2SP37_COCSN  ali  28  50LAASHDKPDIAILGFPYDTSTSYRPGARFGPRGIRAGSARGRSYNTVWEVDPYEEGIVDCGDVPITPFDAAHAFKQMEQGYRQVLYHHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGSALTHGTFFWHASGCISKGTSVHGGLRTFSPKDYEFGIIEAHEIDDIGMNGIIEKTLSFVKDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGL--EGINLVGADVVEVSPPYDTAEITSIAAADLIVDIMAAMAKSKK.. 360
72 0.000e+00UniRef50_A0A238ZNI7 Agmatinase n=1 Tax=Desulfurobacterium atlanticum TaxID=240169 RepID=A0A238ZNI7_9BACT  ali  46  11........EITIFGVPFDGTTCFRPGARFAPAGIRFFSENLETYSPALNRDLDDIDFCDAGDLEINAL-PEDMVETVYSFMENV----KIPVMLGGEHSVTFPVVKALKERYGELTVIHFDAHTDLRDIYSGTAYSHACVMRRVLELGC--KIVHVGVRSGTLEEFTLIRDNP--LLHLVDIKKLPEILE--NEKNIYFSIDIDYFDPAFAPGTGTPEPCGGTPVEFFSIIYNLPSA--NIVGFDIVEVSPPYDPSGITQMLAAKVVRELI.......... 260
73 0.000e+00UniRef50_A0A1Y2NJ92 Guanidinobutyrase n=132 Tax=root TaxID=1 RepID=A0A1Y2NJ92_STRPT  ali  29  49.PAGYAGADVVILGAPFDGTTSHRPGTRFGPQAIRR-TDYLPPYRPHLGLPFTELKIVDAGDVPTPPGETERAHQLLERTVSEVVAAGAIPFTLGGDHSIAWPTMRGIAGRRGPFSVVHFDAHADIGDSDFGAEYGHGTVMRRLLETVPGDRFTQIGLRGYWPGPLQWAAGLGVRSITMSELRCLDDVLDQIGPGPLYLTIDIDVVDPGMAPATGTPEPGGLTSRELLDAVRTCAQR-VDLVGAEIVELSPPYDPGEITAYLANRIVLEVLSGMAWKRR.. 343
74 0.000e+00UniRef50_A0A225B0U1 Putative agmatinase 2 n=10 Tax=Pezizomycotina TaxID=147538 RepID=A0A225B0U1_9EURO  ali  29  77.......YDIAIIGAPFDTAVSYRPGARFGPRAIRAASRQLPSFNARAGINPYWATLLDCGDIPITPFDNALASRQMYEAFLELGNQRPKLVTLGGDHSVALPALRALYQIYKPITVLHFDAHLDTWNPVEQSRFNHGSFFHIASGLISNTTSAHAGIRTPGTPEQGFMRIHADDIDDIGTRGVIDAIIERIGEQPVYLSVDIDVLDPATAPGTGTPEPGGWTTREMIRILRGI--EKLNVVGADIVEVSPSYDVGETTALAAAQVAFEIITSMVKAGVEG 389
75 0.000e+00UniRef50_A0A099KGZ3 Agmatinase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A099KGZ3_COLPS  ali  28  35.SKDLTHAEVAVTGIPYDLALSNRSGARLGPRAIRAASSNLAWGTVHWGIDPFELPVVDYGDCGIDTSMPEQVPQDIEEHISHILDQDCATLCLGGDHFITYPILKAYAKKFGEISLIHFDAHYDTWNDTKG-KIDHGTMFYHAAGIVSPERSVQIGMRTAIDDTIGFNVINNHAVHSQQPEEISAQIKKIVGDNPCYLTFDIDCLDPVYAPGTGTPVVGGLTTYQAQRILRGL--EGINLIGMDLVEVSPAYDHAEITSLAGASLALDLLCLYA...... 310
76 0.000e+00UniRef50_F8KWJ4 Agmatinase 1 n=27 Tax=Bacteria TaxID=2 RepID=F8KWJ4_PARAV  ali  26  20LPDPYSGAEIVILPVPFDLTSTYQKGSDKGPAALIEASRNMELYDIETDSEVYKKGIYT--DQPIQAKTSQDMLQQTHERTKTLLSHNKFVVTLGGEHSISYAPIRAHAEHFGSISVLQFDAHADLQDAYEDDPWSHASVMARVKEIPQVDKIVSVGIRSMSAEELPNLDPPNTFFHTLDDKHWIDQVLSKLSDQ-VYITFDLDAFDSSLMSSTGTPEPGGLQWNQATQLLKKVAKHK-KIVGFDVVELCPN--PANLSDFLAAKLIYKLLSYTFYSNR.. 298
77 0.000e+00UniRef50_D3F8N5 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D3F8N5_CONWI  ali  25  32.ATDWANADVAVLGVPFDTATSYRPGARFGPAAIRDQSQLIRPWHAALEVDVFTLSVLDGGDLTVTPGNAARTAEQIHAGLRPVLEAGATPLVLGGDHSIVLGELRAQAERHGPVGVVLLDAHADTWDEYYGERYFHGTPFRRALELIDPRRSLLAGMRGYAASDLDTPREWGFEIVTCDELRTLRRVRERIGDGPTFLSFDIDVLDPAFAPGTGTPEIAGLLPHEAVAFLRALA--GIRFTGFDVVEVSPQFDPGQVTALHAASIGFELLALCA...... 315
78 0.000e+00UniRef50_A0A0M0BJM3 Uncharacterized protein n=1 Tax=miscellaneous Crenarchaeota group archaeon SMTZ-80 TaxID=1685135 RepID=A0A0M0BJM3_9ARCH  ali  36  24.NTSFDDAKYVILGVPYDKTSTYRPGSRFAPSHIREASLNIETYSFKTNLDLEEIKICDLGDLNIVD-SLEETLKRLKIVVTEIVNADKIPIVIGGEHTITTGVFKSLKE---NSALMIFDAHLDFREEYMGSNFSHATFVRHLMNALGPEKIILAGTRAVSKVEVEYAKKIGLFYITTNEIQIINKIKSKISDKKVYISLDMDVLDPAYAPAVGNPEGFGINIKDLMEIIYGL--RDIPLSGFDLVEVVPHYD-QGVTAIQAAKIIFEIISL........ 295
79 0.000e+00UniRef50_A0A0T6AH84 Putative agmatinase, agmatinase n=5 Tax=Bacteria TaxID=2 RepID=A0A0T6AH84_9DELT  ali  30  19.....KSSSFVVIPFPIDLTTTYVTGTRNGPGAIIEASGHMELFDEENKIEPYRAGIFVSTEIPMLTTGPIAMLKELEKRMKAVMRAGKFPILLGGEHSGTCGAVSALKKKYEDLTILQFDAHADLRDTYLGTQWNHACVGRRIVD--SGAKLVQVGVRSISEEEDRFLRKS-ETVKTFYASEVRDNLADVTRGGNVYISIDLDVFDPGIMPAVGTPEPGGLDWFEVVDILRDVMRSDCNIVGFDIMELSPLPGIVAPD-FLAAKLCYRMMGWVLAKREE. 295
80 0.000e+00UniRef50_A0A2V8FL89 Agmatinase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8FL89_9BACT  ali  27  22.TTDFARARVVILPIPLDRTTSYVPGTRNGPHEILVASSHMELWDEETQTDVHSIGIYTLPEMEFPFASMDEVVGEIRRVAAELVKHDKFPFILGGEHSITPAVVAALAAKHPGLSVLQLDAHADLRESFMGTPHNHACAMRRTLEH---ARTTQVGIRSLSPEEAAAAPTLPTAIFYDFDADWIERVVDSL-SETVYITIDVDGFDPAIMPATGTPEPGGLSWYEALALLRRVIERRT-VVGCDVVELSPIPGQVAP-NFLCAKLVYKILSY........ 291
81 0.000e+00UniRef50_A0A2D6LJD6 Agmatinase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2D6LJD6_9ARCH  ali  30  22..ADYDKSKVVIFPVPYDGTTSYKPGTRDGPHAIIDASRVVEFYDEEAKKNFSEIGICTLDELE-ILDDAKKTIDRVYEATKKLLEDNKKFVMLGGEHSLTSGAVRAFKEKFSDLSVLHIDAHADMADLNGDSKWDHGCVARRVHEMCL---VVLAGIRSLDEEQAKFIEKENIPTYFAHDDSWMDDAISKL-SKNVYLTIDLDALDPSIMPSVGTPVPGGFQWFTLLKFLRKLKEK--NVVGFDVMEFMPIPGMHSPD-FTAAKLVYKLIG......... 289
82 0.000e+00UniRef50_A0A0U3B3E2 Uncharacterized protein n=3 Tax=Lacimicrobium TaxID=1751872 RepID=A0A0U3B3E2_9ALTE  ali  31  29.........VVIAGIPFDLATSGRPGARFGPAAIRQASVNLGWEKKRHPWPFDALNIADIGDLAFSHGDARGAMEAVREHVSQVVRSGAIPFMLGGDHLITLPALQAVHAKHGPVAVVHFDAHSD--DYAGGSEFDHGSVFYHARGLLQDEKVIQIGIRGSSP----FKVLCADELWHSKAEEVVARIKNTVGDAPVYLTFDIDCLDPVYAPGTGTPVSGGLSGPFVLELLRKL--HGLNWVGMDLVEVSPPYDQSQITSLLAATMMTDMLCLLACQQ... 297
83 0.000e+00UniRef50_D6TKE7 Agmatinase n=9 Tax=Ktedonobacteria TaxID=388447 RepID=D6TKE7_9CHLR  ali  28  16..CNPETAQVTIIPAPLEYSVCYMKGTEHGPQAILDASSQMELYDEELDCCPIEIGVYTRPVLDYSGMDHAEALKATGQAVRETLEKGQLPLILGGEHSLSAPCIAAVHEKYPDLTVVHIDAHGDLRDEYEGTPLSHASIERRVVDMGIP--LLEIGIRSFSPEEAEFLKSGNIAVVWAYQIARIAQIWERLG-KHVYLTIDLDAIDPSEMPAVGTPEPGGLSWYQVLDLVREICQRST-VVGMDVVELCPMEGQTRAD-FLAAKLVYKMIGYRFQQ.... 288
84 0.000e+00UniRef50_A0A1J4SHF0 Agmatinase n=1 Tax=Candidatus Desantisbacteria bacterium CG1_02_38_46 TaxID=1817893 RepID=A0A1J4SHF0_9BACT  ali  40  1MSVPKSRQEIVLFGCPHDISSSYRVGSRLGPAAIRHSLNEIEDYSPYLEGDLRDVHFSDAGDLGLANKNTGDALNLIKETTEKILEEDKIPFALGGNHLITLPVLQVINKKYKNIKILYLDAHCDLREEYLGNKLSHATVAKRLLDFVSPESLFQFGIRSGERKEFEFAGRH--KIIYKFSRKSLTEVLKKIGNSPLYITMDLDVFDPGIFPGTGVPEPGGISFEEFIEFIKGL--KKTRIVGLDVVELSPPCDPTEISSFLAATVVREMLILIGKRKK.. 275
85 0.000e+00UniRef50_A0A2J6W559 Agmatinase n=1 Tax=Caldisphaera sp. TaxID=2060322 RepID=A0A2J6W559_9CREN  ali  35  22.....KKSKYVIFGVPFDSSTSYKPGTRFGPDSIRQAASSLESNSYFSDIYLEDIGIDDEGDITPVIGDINETMNRVTSITSEIVKENKIPIVLGGEHTITYGVLRGIKKAL-NISLIVIDAHYDLRDDYLGLKLGHASVMRRNLEILGLTKINYLGVRAYSKEERNYALSKNNDIYRLGILNTINTIKRFLSDKYIYLSIDMDGFDPSFAPGVGNPEPGGINNVEGLSIVNQLV--DKRLIGADVVEVSPPYDSNDITAALGAKLINEII.......... 294
86 0.000e+00UniRef50_A0A160T3Q5 Proclavaminate amidinohydrolase n=45 Tax=Bacteria TaxID=2 RepID=A0A160T3Q5_9CHLR  ali  27  28.TRDLSGVDVAIVGVPFDSGTSFRGGTRFGPRHIRAASLALWGTHHIHGVAPTDLTIVDYGDVEIEMAYIEKSMDFITTEVGAALAQGAMVVALGGDHSISLPLLRAQAAAHGPLAVVHFDAHTD----VEPGGYEHGTVFRHAIELIDPTAYIQVGIRGFFPDDLNVARRLGARVFEMGIPAVIEAIRETVGDRRVYVTLDIDATDPAFAPGTGTPEPGGFSSYQMLQLMRGL--KGLNLVGMDLVEVSPPYDQSDVTAILAANLVFEYLCLVALRR... 315
87 0.000e+00UniRef50_A0A1V5LV76 Guanidinobutyrase n=1 Tax=Firmicutes bacterium ADurb.Bin419 TaxID=1852892 RepID=A0A1V5LV76_9FIRM  ali  30  31..KDIDKSDVVIVGIPFDDTSSYRTGSRFAPRFIRNVSTCLKKYNRFFDVDIFGSGIIDYGDIPVIPGYIEKSYNLITDELSKIVDKGAVTIAIGGDHGILLPELRAFKEKYGKLSVISFDAHRDCSNLHFGQPYGHGTTFRRAIELIDPHSSIIIGVRGSGYSSRDYIKELGFELIDMEIADIGNTISKVIGQKPCFVTFDMDCIDPAYAPGVNTPEICGFTSRECLFLIRQL--EGLSIVGCDLVEMNPQYDYGEITAYLAGNIIFELLSIILKNK... 315
88 0.000e+00UniRef50_W7YCU7 Agmatinase n=3 Tax=Bacteria TaxID=2 RepID=W7YCU7_9BACT  ali  31  16...DYNKAAVAVLPVPYDGTSTWVKGSDKGPAALIEASGTLEMFDIETGNDVSKKGIYTLPPVIEDR-SPEKMSEAVERAITQLLGDGKLPVLVGGEHSVSIGAFKAMAKRYENITFLQFDAHADLRESYEGSAYNHACVMHQAKKLAP---IVQVGIRSMCQEERVYVDPEKMFFRYRQNMDWQNDVMAQLSGD-VYITIDLDVFDPSIMPSTGTPEPDGLLYHEVLSMIRKV-QTHCNIVGFDVVELCPN-EKNKAPDFLAAKLVYQVLSGI....... 281
89 0.000e+00UniRef50_A5GWS9 Agmatinase n=53 Tax=cellular organisms TaxID=131567 RepID=A5GWS9_SYNR3  ali  40  21..RDPAGCQVGLFGVPYDGTTSFRPGTRFGPAAIRQVSDGLETYDPQLDADLEDIAFADLGAVEISFGAPEPVVEAVRQATNAVLDLGLKPLMLGGEHSISSGAVAAVAERYPDLVLLQLDAHADLRESWLGGRHSHACAMRRCLEVLPSGELLQLAIRSGTKQEFQELRREQRLV---GMQQLAAR-LQAIQGRPLYLTVDLDWFDPSVMPGTGTPEPGGYLWADFTELTALLQRQ--NLVAADVVELAPGLDSSGCSSVLAAKVVRSLLLSLAA..... 288
90 0.000e+00UniRef50_A0A2N2K254 Agmatinase n=15 Tax=root TaxID=1 RepID=A0A2N2K254_9DELT  ali  31  11...SLRDALFVVVPVGYDLTSTYQPGSRRGPAAIIEASTNMELYDEELEKETYLAGIHTTLPVDIDSRGPKNMINAVRKKIAKVAALNKIPVMLGGEHSISFGAVQALKEKYPKLKVLQLDAHADLRESYQESPYNHASVARRISEICP---LIQVGIRSMSKEEAAFLPQSKVKSYSADFKDWHTTVCKDLSGD-VFVTIDLDVFDPSIMPSTGTPEPGGLYWRDVLRLLK-LVSSSCKIRGFDVVELAPIPGIVAPD-FMAAKLIYRFMGYITK..... 281
91 0.000e+00UniRef50_A1CGK0 Arginase family protein n=64 Tax=Dikarya TaxID=451864 RepID=A1CGK0_ASPCL  ali  29  62........DIAILGFPYDTSTSYRPGARFGPRGIRAGSSRGRSYNTVWGVDPEELSIVDCGDIPITPFDAAHAFKQMEQGYRQVLWKHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGSAITHGTFFWHAAGCINKGASVHGGLRTFSPKDYEFHRIEAHEIDIIGVEGIIKRTVDVVGDNPVYLSIDIDVLDPSIAPATGTPESGGWTTRELKRYIKGL--ENLNLVGADVVEVSPPYDTAETTSVAAADLIIDILAAMAKNKK.. 364
92 0.000e+00UniRef50_A0A2H9QTK7 Agmatinase n=4 Tax=Euryarchaeota TaxID=28890 RepID=A0A2H9QTK7_9EURY  ali  34  10.NSSFNDAKFVIFGVPFDSTSSFRSGSRFAPNRIREASYNFETYLMEQDVDLIDIPFHDAGNLD-EYGNVDEMTGAVEDAVKKILP--KFPILIGGEHSLTIGAVKTL----KNVSVVFIDAHLDFREEYLGIKNSHACVSRRVSEIVGIENVFSIGVRSFSREEKNDAEKLGLKYFDVKEKGIEKSIRNLNLKKKIYLSLDMDGVDPAFAPGVGNPEPFGLTPLDVVKCIKILSD---RLVGFDVAEVCPPYD-NGNTSLLGARIIRDLIGCAGKYR... 278
93 0.000e+00UniRef50_A0A1X4XZQ9 Agmatinase n=1 Tax=Desulfurella amilsii TaxID=1562698 RepID=A0A1X4XZQ9_9DELT  ali  44  7.TSSYEKSNIVLVGVPYDGTSSFRPGSRFAPNAIRENSDGIESYSPYFDKDLREKKICDMGDIPLPFGDKELVLDIVEKFSFKLIKNKKKLLSIGGEHLISFPLIKTFSKKYENLAVVHLDAHSDLIDSYRSEKLSHASVIRRISEIVGFENVYQLGIRSLNITDLNYRKDN----LCLFNFDKVQDYVDKISSKPVYLTIDLDVLDPSIFPGTGTPEPGGVTYKELIDCLKKI--SVLNIVGCDVVELSPQYDVSGVSSIVAASVVREVLCLL....... 275
94 0.000e+00UniRef50_A0A2H5ZZW9 N(1)-aminopropylagmatine ureohydrolase n=10 Tax=Bacteria TaxID=2 RepID=A0A2H5ZZW9_9BACT  ali  27  37..SSFESARVVILPVPYEATVSWGGGTRYGPRALLHASRFVELYDHELDTEPYKVGIHTLPELLLPAGGPAAALEELRRVVEILLDDGKFVIMLGGEHSISAPPILAHAARMKPLSVLQLDAHADLRAEYEGTPYSHACVMYRVHRE---ARLVPAGIRSLTAEERDLMRREKIPAVFLSEPDWIDRVIQSLGPE-VYITIDVDFFDPSVMPATGTPEPGGGTWQPTLALLERVFRE-RRVVGCDVVELAPIPGQPHPD-FLAAKLVYKLVGFYAACRER. 313
95 0.000e+00UniRef50_A0LG67 Agmatinase n=9 Tax=Bacteria TaxID=2 RepID=A0LG67_SYNFM  ali  28  31....FENAGAVIIPVPYDATTTYRAGTREGPRAILAASRELEPYDEETCTEAYRHGIATLEELPVVVSSPRDMLDSVRVVGAQVLRSGKLPVLLGGEHLLSLGMIEAAADHFGDLSILHLDAHADLREQYQGSPYSNACIMRHGAALAP---VVQVGIRSLTAEEHEFIRAKKIPCFFAHDLHLYARVIPCLG-KRVYLSIDLDVFDPAVMPSVGTPEPGGLSWYEVIDLLRAVFRE-RQVVGFDVMELLPVPCFAAPD-FLAARLVYKLLSFFFA..... 300
96 0.000e+00UniRef50_A0A147JX64 Uncharacterized protein n=3 Tax=unclassified Hadesarchaea TaxID=1775753 RepID=A0A147JX64_9EURY  ali  35  18..EPYKRAQVVFMGVPLDITSSYRTGMRFAPARIREASMNLETYSAELDV-FEQLGIADIGDLVLVSTDLNATGERIERAVRKLRDEGKVPALLGGEHTLTYFS----SRVFENAFLVQLDAHRDLREEYLGDRLCHATVMRRVLDSLPSDRLLQVGIRSCSKEEAEFARSAGLQAYERGLEDVTSEVRKKVGNKRVYLSIDLDVLDPAFAPGVATPEPGGLSTLDVVKLVRELG--KLNICGFDVVELAAPHD-DGKTAFAAAKIIYELLAAISGSLK.. 293
97 0.000e+00UniRef50_A0A1W9HT52 Agmatinase n=1 Tax=Proteobacteria bacterium SG_bin7 TaxID=1827384 RepID=A0A1W9HT52_9PROT  ali  27  31......DYDVGIFGIPFDGAVSYRSGCRFGPSKIREVSSLGRGYHWGREINFEKIKVADIGDSPTVPVDQKLCFERVEKFVADVLKNKKKFISVGGDHSTTLPILRQLKKKYKPLRLVHFDAHLDSYPAAWGFEYHHGTFVRHAVELIDPKISHQIGIRGPGSDDLDFVKKTKINVHTVDDIDDFKKVLKDLGDEPTYISFDIDCLDPAYAPGTGTPVIGGLTTYETQKILRNF--KIKNLVGADIVEVSPPYDHADITALAAVDTMFEILSIYADSK... 310
98 0.000e+00UniRef50_A0A2A5NX52 Agmatinase n=1 Tax=Candidatus Geothermarchaeota archaeon ex4572_27 TaxID=2012530 RepID=A0A2A5NX52_9ARCH  ali  29  21..SPFATSTFVVLGVPFDSTSTYRPGSRFAPYAIREASINIEGYSWRYGVDVGEVKVHDLGDLLVALGDIRETISRVERVVRALRGAGKLPILLGGEHTITYGAVRGL----GGAAIVCFDAHLDMRDEYQGVRLSHATFMRRLIEDYGPDSVVMVGVRAACREEVEYARREGVEVITSRECRVAERVRGRVGHDKVYISVDIDVLDPSYAPGVANPEPMGLSLEGVLEVLSPIL--DGRVVGLDVVEVCPPYD-NGLAAIHAAKLLFEELASLSR..... 295
99 0.000e+00UniRef50_B5IFF7 Agmatinase n=4 Tax=Aciduliprofundum TaxID=379546 RepID=B5IFF7_ACIB4  ali  34  9.NKNFNESFFIIFGVPFDGTSSYRHGSKFAPDEIRKASYNLESYVMEHKISLSELPIHDMGDIGDEFGNVEDVIETVYSTMQSILP-NKFPIMIGGEHSITIGAAKALKKL--NAGIIFIDAHGDFRDEYLGNKYSHACTARRAYD-ILNGKIISIGVRSASQEEVEDAKDLNYEWIDLGWKRTIKKAMEILDVQKVYLSIDIDGIDPAYAPGTGTPEFFGLSPMDVKNIINFLA---PNLIGADITEVCPPYD-NGNTSILAARLVQEIIAA........ 280
100 0.000e+00UniRef50_A0A2W4HVX9 Agmatinase n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4HVX9_9BACT  ali  27  47..SNEETSQAVIIPAPYENTTSYGRGTKNGPKAILDASQQVELFDDELWVEPYRVGIHSGAEVKMAPSETEAPFQELTDAVKAQLSRGKFPIVLGGEHALSIGPVRACMERYPDLSILQVDAHADMRKSYDGNAYSHASVSYHLYKMLPKPALTNVGVRNISAEEVEWMEQENVKIFWARQQKTWQEIVNTL-SDNVYLTIDVDGLDSSIMPSTGTPEPGGMDWYQLMDLIKTVCVRK-NVVAADIVELSPIPKLHGPD-FLVAKLLYKLIGYKFA..... 323
101 0.000e+00UniRef50_A0A117M6E2 Agmatinase n=1 Tax=candidate division TA06 bacterium 34_109 TaxID=1635277 RepID=A0A117M6E2_9BACT  ali  42  9.SEDKKNSEIVIVGYPFDSTSSFRAGSRNGPNSLRFFSWNLETFSNYQKKDIHEKNYFDMGDVELPFGDIKKTNSIIYKTTKRLLNSKKKIISLGGEHSITYPIIKAFNEYYDDFILVVFDAHADLREEYLGVKFSHACVVRNCVKLLGEKRVCQLGIRSYTKEEFEFSKKL---LSFNEDINSFD--FNLIKGKRIYISIDLDVLDPSVFPGTGTPEAGGFNFKDFINFI--LKFQDNEIVGVDLVELSPEHDISGISQAAAAKIVREIILLL....... 274
102 0.000e+00UniRef50_H1XYW0 Agmatinase n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XYW0_9BACT  ali  32  12...SYQKARTAILPVPYERTTSFEGGTARGPQAAIAVSPYLETYDEELDVEIWKAGIFTLPALNF-GEDVQKDFDLITRSVLKLIEDQKFVVAIGGEHSISYPLFRAFHQKFPDISVLQLDAHADLRESYQGTPFSHASVMKRIFDL--NQNLVQLGIRALSIEEREFIKQKNIKTVFAHQENWPDDILTHL-SETVYLTIDVDFFDPALMPGTGTPEPGGFFWPETLKFLKTLFKTK-NVVGMDVVELRPLAETRH-SEYTVARLIYKLIGY........ 277
103 0.000e+00UniRef50_Q0AZ58 Agmatinase n=2 Tax=Syntrophomonas TaxID=862 RepID=Q0AZ58_SYNWW  ali  37  19.SRDLGACDRVLLGLPLDSTTSFRPGTRLAPYRIREVSEAVEEYSVYLNKSLEEIDFYDAGDVVIPFGNVPQSLKNIEATARYFLEHEKKLFSIGGEHLVSLPLIKVYHDFYPDMVVIQMDAHADLRADYLGEKLSHASVMRRVVEIIGTKKLFQLGIRSATREELDYARQHSQLYLDQF-LTALKDVKEKIGQRSVYISLDIDVLDPAFAPGTGTPEAGGFSSRDLLQMLHEL--RELDVVGFDLVEISPPCEHGDNTSILGAKILREALLAY....... 288
104 0.000e+00UniRef50_A0A1I6GFN6 Agmatinase n=5 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1I6GFN6_9RHOB  ali  31  40.TKDLSDVDLAITGIAFDQAVTHRPGTRFGPRAIREASC-LQPYDPPYGWDLSEFAIIDYGDMPFDYANVAQVPSLIEAHFARILHAGPGTVALGGDHFMTLPILRAYAAKYGPLAVIQFDAHSDLWADDDMSRIDHGTFMYKALGLVDVARSVQVGIRTECDDYLGMTYIDARACHERGTADVVAQIKQIVGAHPTYVTFDIDALDPAFAPGTGTPVWGGLASWQAAAMLRDLA--GINMVGGDIVEVSPPYDTTGATAVAGAHIAMELCCLALWNRRE. 321
105 0.000e+00UniRef50_A0A256ZX63 Agmatinase n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A256ZX63_9EURY  ali  35  13.NSNYNAAEFVIFGIPYDKTSTFRHGAAEAPSEIRKASWNFEPYRFETGVDFREVRVHDFGDLPVKDLSPKDMVKEVEIFVKKIKKDRKFPVAIGGEHSVTLGIVKALGD--EDFCVLSLDAHLDYRDEYEGERFNHACVIKRISEEIGIEKIAILGFRSADKEEYRNAINDKLDIFKLGLKNVLKELKKYFGKSKIYLTLDIDVLDPAYAPGTSTPHPFGLTTFQLLEIIDEFSE---KLIGFDIVEVCPPYD-NGETSLLAAELIRTTIT......... 283
106 0.000e+00UniRef50_A0A2H5W3N2 N(1)-aminopropylagmatine ureohydrolase n=9 Tax=Bacteria TaxID=2 RepID=A0A2H5W3N2_9BACT  ali  29  20....FETARILIWPVPFEATTTFLKGTALGPHAIIEASRHLELYDEELDAEVYRLGIHTLPPAP-VNASLEEVIERLYHEARRWVETGKFLCTLGGEHSITSPIVRAFAERYPDLSVLQIDAHADLRQSYDGTPYSHASVAARLVEICP---VVQVGVRALSLEEARARHQLPVTTFFAKDLHWIPQVVECLSPQ-VYLTIDVDGLDPSLIPATGTPEPGGLSWSETLRLIRQVAEHRT-IVGMDVTELCPMPGH-EASNFIVAKLIYKALGYVFHR.... 289
107 0.000e+00UniRef50_A0A2M8AXE6 Agmatinase n=4 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M8AXE6_9DELT  ali  30  32..ASWKDATFVVIPFPVDMTTTYMTGTRNGPRAILDASSHMELFDEENKIEPYRAGIFVSTEIPVSLAGPVQAMKEVERRVKATVRAGKVPVLLGGEHSGTVGAVTALRKRYGDLTVLQFDAHTDLRDTYLGTPHNHACVGRRIVDAG--ARLVQVGIRSMSEEEDRFLKKSGLKAFYASEVDVTKGIVSSL-SENVYISIDLDVFDPGIMPAVVTPEPGGLSWFEGIDILRDVMRSNRNIVGFDVMELAPIAGMAAPD-YLAARLCYRLMGWLVARRSE. 311
108 0.000e+00UniRef50_A0A2D5UDM2 Agmatinase n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2D5UDM2_9BACT  ali  41  19....FDEAIIALFGCPYDGTVSFRPGARQGPAAIREFSDVLETYSPELGADLGDVPFCDLGDLALAEVRVEQNLEIISAEARRVFSSGKIPFALGGEHLVSLPLILAALESHPDLVVFQWDAHADLRGDYEGAVFSHATVMRRVAEAVGNGGLVQFGIRSGTREEWGWMKDN-RTVKPLDPDHVMAAVAEK-QGRPVYLSVDLDVLDPSVCPGTGTPEPGGSSFANLAACIYALRRAGVPIIALDVVELAPGIDPTGMSAAAAAKVVRELL.......... 283
109 0.000e+00UniRef50_UPI00094F4DDD agmatinase n=2 Tax=Labilibacter TaxID=1849718 RepID=UPI00094F4DDD  ali  31  18...DYNKAEMVILPVPYDGTSTWIKGSDKGPEAIIEASGTLEMYDIETELDVSKKGIYTLAPVD-EKASPEAMVLAVENAVNEQFKNNKFTVLIGGEHSVSIGAFKAYAQKYKDLSILQLDAHADLRPKYEGSENNHACAMYQAREVAP---IVQVGIRSMCEEEKAFV--NADTMFFRHQIRWKKEVLKQL-NKNVYLTIDLDVFDTSIMPSTGTPEPDGLLFNDVIDLIETVA-SKVNIVGFDVVELCPNK-ANKAPDYLAAKLIYRILSIIYKSKQ.. 288
110 0.000e+00UniRef50_A0A125STW8 Guanidinobutyrase n=9 Tax=Bacteria TaxID=2 RepID=A0A125STW8_9CYAN  ali  24  34...DPADVDVAIVGLPFDTGATFKVGARFGPEAVRGASALLRPYNPELDVMVFELSCVDYGDAPVVPGFIEDSLDAIARTIQPLAEAGVIPLSIGGDHSVALGELRALAAVHGPLALVHFDAHGDYWDSYFGHKYTHGTPFRRAVELIVPEASVQLGMRGYDSDDLDTPRRAGFTVLTMRPEEIGALVREKVGDRKAFLSFDVDFFDPAFAPGTGTPEVGGPTSFQGLGYLR--ACTGLTWVGGDVVEVLPAMDHSQVTAHLGAQIGYEFLSLVALSKR.. 318
111 0.000e+00UniRef50_C3MMG9 Agmatinase n=45 Tax=TACK group TaxID=1783275 RepID=C3MMG9_SULIL  ali  33  28.....EEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGSRLLRPYNQFLDTYPFDLNACDMGDINIIPGYIEDTMNIIQTNLYEIISKNLVPFIAGGDHSITLPVLRALHKKYGKINIIHLDSHYDFWDSYWGKKHTHGTWLRRAIEEGLIKEAIQGGIRAFSKEDLKDKERLGVKSFTIRDDSVIREINSL--SGPTHVSIDIDVVDPAFAPGTGTPEVGGLTSFEIIEIIRKL--RFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSVLSLN.... 304
112 0.000e+00UniRef50_A0A1F5CR36 Agmatinase n=15 Tax=Candidatus Bathyarchaeota TaxID=928852 RepID=A0A1F5CR36_9ARCH  ali  32  19..KDYDKADYAVLGVPFDATSTYRSGARFGPNAIRQASLNIETYSFRTGLDVENLRLHDLGDL-HVSTDARKTLNTLKLVIRDIIKT-KVPVTIGGEHTITLGIAKGFGSKIPKTAVVSFDAHLDLRNEFLGLKLSHTTFMRRINEETKPAKIIEVGTRSVCKEELAYAKKAGIEFLTTGSQRAAERLKEKLECEHIYLSIDMDVLDPAYVPAVQNPEADGLEMHVLLDILGSIC--DRRVMGFDVLEIAPSYD-QGITAIQTAKVIFEVLCNLQKSRK.. 297
113 0.000e+00UniRef50_A0A2E2X200 Agmatinase n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2E2X200_9RHIZ  ali  27  36.TKSLDGVDVAVWGIPFDAAVSNRPGARFGPQAIRRASAIFD-NDPQXPFEFENMAVIDYGDCLLDYGNHQETPGRIQSEAAKILGAGAFLLTLGGDHYVTWPLLKAHVDKHGPLALVQFDAHQDTWDD-DGERIDHGSFVGRAAGLIDTSKSIQVGIRTHAPEXCGIRMIYGHEVEDMSAQEIADAIIEHTGGXPVYLTFDIDCLDPAFAPGTGTPVAGGPSSAKALSILRKLGA--LDIRGADVVEVAPAYDHADVTAIAGATIAMYMLGLLAEKR... 313
114 0.000e+00UniRef50_A0A0K2SLE4 Guanidinobutyrase n=2 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SLE4_9FIRM  ali  27  26.NRQTDGVDVAIVGLPFDTGGTYRVGARFGPAAIRAASQMLHPYNPATGVDLERLSAVDYGDLRVVPGAVERSHALLADGLEPLHRNGLRVIGLGGDHSVSLPHLQAAASVHGPLALIQFDSHSDLWDEFWGERRNHGTVIRRALEEIDPSASIQVGLRGSNRAESAFSREFGFAVLSTADLEAPRKIRERVGERRSFVTFDVDFVDPAFAPGTGTPEVGGFSSWETLELLRGL--SGIEFVGFDVVEVIPAYDHASITALLAATVVHEMLGLVACS.... 312
115 0.000e+00UniRef50_A0A2V6T5F6 Agmatinase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6T5F6_9BACT  ali  28  29...DTRELDVAFVGVPFDTAAGYRVGARLAPRAIRNASSQVRIHHPIYDLTVHKIRIADYGDVRTTPFEIERTFAWITEEFDAIYGNGCRTIAVGGDHGITYPILRAVARRHGPLAIVHIDAHTDTHDTQFAHKLTHATTFRRAHELLQPGKVVQMGIRGFYPDDLKWSKEHAHELHRRDMDGVVAEVREIVGAAPVYFTFDIDGMDPSCAPGTGVPEIGGLTNWQVMQIIRGLV--GLNLVGADLVEVSPPCDTNDITSITAAHMLFEIASVFAANK... 311
116 0.000e+00UniRef50_A0A2H5VUV3 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5VUV3_9BACT  ali  30  19..RPTSGPKIGILPIPYDLTTSYQPGARRGPIAILEASTHLETYDEELEWDPSALQLETLAPVVPDTSGPEATMERIYGVACEALKTHDFLVGLGGEHSVSFPLVRAVKEKHPHVGVLQLDAHSDLRASFEGSPYNHACVMHRVLDLGVP--IAQVGIRSLTAEEHELIKSGKVTTVFASEADFLPKVLAALPDE-VYITVDLDAFDPAIMPATGTPEPGGLSWYRALEILREVAKSK-RIVGFDVVELAPFPGLVAPD-FLAAKLVYKLLAY........ 291
117 0.000e+00UniRef50_A0A1V5TZH3 N(1)-aminopropylagmatine ureohydrolase n=1 Tax=bacterium ADurb.Bin243 TaxID=1866936 RepID=A0A1V5TZH3_9BACT  ali  28  22....YENSKYIILPVPYDSTTSYRVGTREGPAAIISASMNMELYDIETASNPYEAGICTLPAAEPHMGAVDKFLKNLEKICARILADKKYLITLGGEHSISYSPIKALKKAGRKMAVVQIDAHSDLRADFEGTEYNHACVMRRVREEFKLE-TVHVAIRSYCDDEAAYIKKSRVKIFHGHEVALVEKIKALAGFDDVYLTIDIDGLDPSIVPATGTPEPGGLLWYETLHFIKELVKSK-NVCGFDLMELMPIPG-NHASDFLASKLVYKVIAYLAKSKK.. 306
118 0.000e+00UniRef50_UPI000C7A8967 agmatinase n=1 Tax=Nonomuraea indica TaxID=1581193 RepID=UPI000C7A8967  ali  31  22.......SDVVVLGVPIDSGTGGRPGARFGPAAIREASALIALYHVGLETEVFELRIVDVGDVPVTPGQHERNLDAAEKWARELMSVTDRVVVLGGDHSVLLPVLRAVADKHGPVSFVHWDAHADTWDGGPEHLLTHATAVRRVIEEGLTNQVFQIGLRGYSRETFAWAGEHGVDVDEAGLTDIVQQVIASV-TGKVYISIDIDVLDPSYAPGTGTPEPGGLTSRELLAGIRDLA-RNTDVVGLDVVEVAPPYDHADVTALVANRCVLEFLSATAQRKAAG 304
119 0.000e+00UniRef50_A0A0T6A3G6 Agmatinase, agmatinase n=1 Tax=candidate division NC10 bacterium CSP1-5 TaxID=1640516 RepID=A0A0T6A3G6_9BACT  ali  38  9.........IILFGAPLDLTSSYRTGTRLGPQQIRAAGEGLEDYSLALDRDVRQVKVIDQGDLELPPDNLEAGLARIEEEAARALEKEMAFVALGGEHLITLPLVKAALTRYPDLALLQIDAHADLAEFYDGKPLTHATVIRRVAELLGPRRVVQLGIRSATAEEVIFARQQ--THLFPGPPADMAKVVKILSGRPVYLTIDIDVVDPAFAPGVGTPEPGGWSSLDLFQVLNRMAA--LEIVGMDLVEVCPPYDPAGITAILAAKALRETL.......... 266
120 0.000e+00UniRef50_A0A0J6VZ56 Agmatinase n=98 Tax=root TaxID=1 RepID=A0A0J6VZ56_9MYCO  ali  30  31......KPDVAIVGAPFDIATTNRPGARFGPRAIRATAYEPGTYHMDLGLEIFDLEVVDFGDAYCPHGQTEVSHANIKERVHAIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTADEIEGNLASHGTPMRRLIEAVPGSHFVQVGLRGYWPDTFEWMQEQKMTWHTMQEIWVMADAVALAKADKLYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEH-DVAGVDVVEVAPAYDHAELTVNAAHRVVFEALAGMAARRR.. 317
121 0.000e+00UniRef50_A0A291B6D7 Agmatinase n=12 Tax=Bacteria TaxID=2 RepID=A0A291B6D7_9BACT  ali  26  36......DADVVITGVPFDMATTGRSGSRMGPGAIRQASINLAWEGKCWPWDFSEIKIADCGDLVFNCGDAAQMCERLEAHASSLLAEGKTLLTFGGDHFVTLPLLRAYAKQFGEIALIHFDAHTDTYD--MGSQYDHGTMFYHAEGLIDPYSSIQIGIRTEHGYTLGYQVVDATKANDWPVNKIVDTIKNRVGNHPVYLTFDIDCLDPAYAPGTGTPVCGGLSTAKILQVIRAL--QCINLIGMDVVEVAPAYDHAELTSLAAATIATDLLHVWAVNHKK. 310
122 0.000e+00UniRef50_F8C5F1 Agmatinase n=7 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=F8C5F1_THEGP  ali  31  10...DHPQARVALIPAPLEITTSWQKGTKEAPTEILKVSPNLEFFDEETEIEPQELGFFTYP-VPELPFDINTALEEISKKVRETLIKKRFPIVIGGEHTVTLGSIKALKGFYENLKILHLDAHLDLRDEYLGCKISHATVIRRIYEMGIP--ILSVGVRTLCKEEYEFIKEVNFPLLWMKDLENWEKIEEFIKEGDIYLSLDMDVFDPSFAPGVGTPEPGGINWYEFLQILKLVVR--YNLVGMDIVEVKPNLG-NAITEYLAAKIIFKISSYLAKK.... 283
123 0.000e+00UniRef50_A0A2H0P5N9 Agmatinase (Fragment) n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_49_13 TaxID=1973976 RepID=A0A2H0P5N9_9D  ali  34  21....YDNAHFVIVPVPYEKTTSYGRGTCKGPGAICAASEQVELFDEELQKEVYQKGIATVKEVTD--------LDELQKVTEKILEDKKFPIVLGGEHTISAPPVRAFKKFYNDISVVHFDAHADLRDEYNGSKLSHACVMRRVVEEKVP--LVQIGIRNHSLEEAEVIKKEGLNIH--GSDYWMEEAVALL-SKNVYISFDVDAFDASIMPSTGTPEPGGMNWFQVVKFFRLLCKS-RNVVGADFVELAPVKGNSGPD-FTVAKLIYKL........... 278
124 0.000e+00UniRef50_A0A0G0WII6 Agmatinase n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A0G0WII6_9BACT  ali  29  19...SFENAKAVILQVPYEGTVSYGSGTSNGPQAIIQSSRFMESYDIELDAEIYKKGIFTLEPMAVRDLQPEDMTLQVEKEYTKLVAANKFVVMIGGEHSISYAADRPLREKYPDLSILQWDAHADLRDSFEGTKFSHGCAMRRFYD--NAKRIVQVGIRSFSVEEAEYIKKNNLRIFTPAEFDV-EKIIERLSP-NVYITVDLDGFDPSILPATGTPEPGGLYWPDFLKLMRAVFA-KRNVVGCDVVELAPIAG-QPASDFLSALAVYKMIGY........ 285
125 0.000e+00UniRef50_A0A2H9KYY7 Agmatinase n=1 Tax=Candidatus Micrarchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_45_29 TaxID=1974417 RepID=A0A2H9KYY7_9ARCH  ali  34  14...PYANSKAVILQAPYEKTASYLKGQASAPAAIIKASCQVETYDIELQNDFDKVGFHTLPPLQIENLPPEKAVDALEQATSKILADGKFPIILGGEHSLTTGAVRACKKKHADLCVLQIDAHADMREEYENSKYSHASVMARVREICPA---VSVGIRSYSKEEAKLIEKYPDVIFDSRIKGKENIILSKIKEKNVYITIDADGFDPSIMPGVGTPEPGGLLWDETLSLLKKVCAEK-NIVGFDIVELMPIP-SNAVSDFTCAKLAYKLAGY........ 280
126 0.000e+00UniRef50_A0A1Y0EBE9 Agmatinase n=13 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y0EBE9_9RHOB  ali  31  40.SKELSGVDLAVTGIPFDQAVTHRPGARFGPRAIREASC-LQPYDPPYGWDLSEFSIVDYGDMAFDYASVAGVPALVEAHIARILAAGAASITLGGDHFITLPILRAYAAKYGPLSVIQFDAHSDLWPDEDMARIDHGTFMYKALGLVDPARSVQIGIRTQCDDYLGMRYIDARSCHARGVADVVAEMRGIVGDHPTYVTFDIDALDPAFAPGTGTPVWGGLASWQAAALLRDLA--GINMVGGDIVEVSPPYDTTGATAIAGAHVAMELCCLLWNKRKKG 323
127 0.000e+00UniRef50_A0A1V4XKC2 N(1)-aminopropylagmatine ureohydrolase n=25 Tax=Bacteria TaxID=2 RepID=A0A1V4XKC2_9DELT  ali  27  13....FDQATFVVVPVPYDLTSTYQSGSRMGPAAILDASAHMELYDEELRRETYLAGIHTLPSLEADARGPREMMETVRRQIFEVVSAGKIPVTLGGEHSISFGCVQAVQEVYPGLSVLQLDAHADMRDSYQGSPFSHASVARRISERCP---LVQAGIRSMSAEEAAFLPASAVKTFSADDPDGCRAIAACLEGD-VYISVDLDVLDPAFLPATGTPEPGGIRWNDVLRLIRAVSGR-CRVRGFDVVELSPIPGMI-ASDFLAAKLVYRMMGYALAN.... 283
128 0.000e+00UniRef50_D7CX25 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D7CX25_TRURR  ali  27  28..TDLAGADAAIVGAPFDTGGTYRVGARFGPAGIRHESMLLRPYHPELRVDVEQLSLVDYGDLPVTPGYLSESHAQLERGAAELVAAGVTPFFLGGDHSVSLPLLRAVAQRHGPVGLVHIDAHSDLWEGYFGGKDTHGTPFRRALELLEPARSIQIGLRGYSAEDHALSQRLGFEMVTAGVQEVARRVRARAGTGPLYLSFDIDALDPTFAPGTGTPEVGGLSS--VQALALLRALAGLPFVAYDLVEVMPPYDVAGTTCLLAANLVYEMLALEACRR... 314
129 0.000e+00UniRef50_A0A2T7NAZ9 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NAZ9_POMCA  ali  28  58.....QGLDACFVGVPLDSGTSNRSGARLGPRHIRQESSLLRQANPMLGTIPFDIQVADVGDVCMNIYDLPTAVKQIKAAFDKLIVNGCVPLTMGGDHTISYPILQAIKDKYGPVGLVHVDAHADVNDTMLGAKIAHGTPFRRAFEYGDGRRVIQIGLRGYDLDGYKWSTEQGFRVVPASDCWLMTEVRSMMGSGPVYLSFDIDSLDPCFAPGTGTPEIAGLTIYQALEIIHG--CQGLNIVGADLVEVSPPYDVGSMTSLTAANLLFEMLCVVQLSK... 339
130 0.000e+00UniRef50_A0A1B9F6Y2 Agmatinase n=2 Tax=Dissulfuribacter thermophilus TaxID=1156395 RepID=A0A1B9F6Y2_9DELT  ali  30  13..SSRDQAKWFLIPAPFDASTCYRPGARFGPQAIIEASTQMELLDEELLFEPYKIGIHTTQAIEPV-LDPEKMAELVREEVSKAIDQGKMVCTLGGDHSVSIGAITAFFNAFGPLNIIQFDAHLDLRESYQGSRFSHACVMRRVWDLGNP---IQVGIRSFSGEELTFLKETGAKPIFAKDIGSIDSVIKSLKSLPTYITIDLDCLDPSVMPAVGTPEPGGMLWYTLLNFLQTII-SNSNIVGFDCVELSPVPGINFP-EFTAARLIYKVIGY........ 283
131 0.000e+00UniRef50_A0A150J7W7 Agmatinase n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A150J7W7_9EURY  ali  31  15..SNYENSYFVVLPVPLEKTVSYKGGTSEGPKAIINASQNMELLDEEFFVSPCTKGIHTKNEINC-QQDMETVMQLIEDESYLILKDNKFLCVLGGEHSVSQAPILAAKRLYKDLSVLQFDAHLDLRDAYLGDKYSHASVMSRVEEH---SKIVQVGIRSFSEEEYEKIKTGRYNIFYAKDIYWFNRAIEGL-SDNVYITFDIDAFDPSLIPGTGTPEPGGLSWYLVCDFLKEVF-FNRNVIGVDVVEVAPQ-ENSAVSEFVASKLLYKMMTY........ 282
132 0.000e+00UniRef50_G4KX50 Putative agmatinase n=194 Tax=Bacteria TaxID=2 RepID=G4KX50_OSCVS  ali  48  10LACDAEAADVVLFGVPFDGTTSFRPGTRFGPSAIRGESFGIETYSPYCDRDLTDCRIFDGGDLELPFGNTQRVLELIRDSAADLLADGKRFVMLGGEHLITLGAVRAVAERFPDVHVIQFDAHTDLRKEYLGEPLSHSTVMRQVWNLLGDGRLHQFGIRSGERTEFEFAREH--TCLHKFNLADFTETAAQLQGMPVYFSLDLDVLDSSAFCGTGTPEAGGVTFKELMEAVLRL--HGLNIVGCDINELSPHYDHSGSSTAAACKITREILLQIAR..... 283
133 0.000e+00UniRef50_A0A2V8C9B5 Agmatinase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8C9B5_9BACT  ali  29  28...DPHGLDVAIIGVPFDGGTSYRPGSRYGPREIRNQSSLIRSYSYFQRVPFERLNVADAGDIDAPPVSIEKCYAVVEERIGATVEAGARPIVIGGDHSISLPVLRALARRHGPLGLVQFDAHIDTWDEYFGGKYFHGTPFRRAIELVDGRRFIQVGIRGPMEDDFDFHREHGITVIDIGVAWAIAEIRRVV-TGPAYMTYDIDSVDPAFAPGTGTPEIGGLTSHDAQRLVRGLAGLTLLGG--DIVEVAPVYDPGQITSVLAANLMFEFLCALA...... 308
134 0.000e+00UniRef50_UPI000A07371A agmatinase n=1 Tax=Streptosporangium amethystogenes TaxID=2002 RepID=UPI000A07371A  ali  28  9....PQGADLVIVGAPYDGGTSYRPGARFGPRAIREESALLHGTGLDRGPSVFGIGAVDAGDLDLNRFSMESAMSTATERLTELAERNQALLMLGGDHSMTLAALRAAHKVHGPVAVLHLDAHSDTYPPVDGGRYHHGTPFRWAIKLVDPARMIQVGIRGHVPGALEFARARGVRIVTAPDIDLMSMIQECVGDGPLYVSCDIDVVDPAFAPGTGTPSPGGLSSRELLAILRGIGDLQP--IGCDVVEVAPAYDHGGATALLAAEIGYELIYQYARSRR.. 292
135 0.000e+00UniRef50_F0T7F0 Agmatinase n=2 Tax=Methanobacterium lacus (strain AL-21) TaxID=877455 RepID=F0T7F0_METLA  ali  34  24.SKDLNETDVAIVGVPFDHGTTNRPGARFGPRSIRTASQNYGIYDSELKRNLGGVNIVDYGDVPILPTHTKTNMKMINSTFKKIVDAGVFPVAFGGDHTVTYPIVKAFKK---PLDIVHFDTHLDFVDGTENLKFSHSNPLKRVSEIENINNITQIGIRGFTDENYDESKNYGSKIITAGTAWVLDQI---PESDNIYVTLDIDVLDPSIAPGTGTPEPGGLTYNQLKDILTNLTNKG-EILGFDLVEVNPLFDLSEITSLTAARLCFDFLGSIF...... 306
136 0.000e+00UniRef50_A0A268K8G3 Agmatinase n=7 Tax=Bacillus TaxID=55087 RepID=A0A268K8G3_9BACI  ali  27  22LPSNRENAKLAIVGLPFDTAASFRVGARFAPQAIRQASMTLFPYHPIHKVYPFDANAIDIGDVSVIPHNIHRSYEVMEKAVMELMEQGIIPIGLGGDHSVTLANLRAAAKIHGPVALIHFDSHTDTWDTYYEEKYWHGSPFIRAYELLIPDKVFQVGIRGNHPGDIDSSSDLGYHVITRGFENVVKEMKEKIGDTPCFLSFDIDFVDPSCAPGTGTLEVGGLNSFETLQIIRSL--TDFNFIGFDLVEVLPPYDPTQITSLLAATIIHDFASLVALKIK.. 309
137 0.000e+00UniRef50_A0A2H0WI42 Agmatinase n=2 Tax=Bdellovibrionales TaxID=213481 RepID=A0A2H0WI42_9PROT  ali  27  34.....EKFDVALFGIPYDGGVSYRPGARFAPTEVRNASSLGRGFHWNRELNFEQLKIADVGDCPTVPIDQNQTYEKIEKFVGSILKTNKKFVAVGGDHSTTLPVLRALKKHYKPLAFVHFDAHLDTYPAAWGCEYHHGAFARHAVELVDPKKMLQIGIRGPSKEDLAFVKKHKVQVKTVDDVGSLDQFLKTLDNTPTYISFDVDCLDPAFAPGTGTPVVGGLTSYETQRILRAL--KIPNLVGGDVVEICPPADHADITSLVGVDVMFEMLCLM....... 311
138 0.000e+00UniRef50_A0A0J6NP84 Agmatinase n=43 Tax=Proteobacteria TaxID=1224 RepID=A0A0J6NP84_9NEIS  ali  27  37.SRDLTGADVVVSGIPLDLSTTFRSGARLGPQAIRAASVQLAELSPFWGFNPFDLAVVDYGDCWFDAHNPLTIKPSIIEHARTILASGAKMLTFGGDHFITYPLLIAHAEKYGPLALLHFDAHCDTWPDDEPDSLNHGTMFYKAVGLVDPRKSVQVGIRTWNDDFMGMNVLDAPWVHDNGVDVAIARIKEVIGDSPVYLTFDIDCLDPAFAPGTGTPVPGGLSSAQALKIVRNLG--DLNIVGMDVVEVAPAYDNSELTAIAAAHLACDMLCLMRNKKLDG 319
139 0.000e+00UniRef50_A0A239TBV3 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=A0A239TBV3_9FIRM  ali  55  14..KEFEEAKIVLFGAPFDSTTSYRPGTRFASRTMRAESYGLETYSPYLDLDLEDAAVFDGGDLELPFGSVENALEDIEEFTQKIIDCDKLPLMIGGEHLVTLGAVRAVAAKYPDLHIVHFDAHADLRDDYLGAKLSHATVLHRVWNIVGDNKIFQFGIRSGDKSEFVWGKDHVKT--QRFNFNNLKETVMALKGKPVYFTVDLDVLDAAVFPGTGTPEAGGVSFDELRCAMKLVAE-NCNIVGTDMVELSPPYDQSGISTATALKLLREYLLAL....... 282
140 0.000e+00UniRef50_A0A1G2ZHM1 Agmatinase n=1 Tax=Planctomycetes bacterium RBG_16_43_13 TaxID=1801967 RepID=A0A1G2ZHM1_9BACT  ali  29  20..TELDKSRFVVLPVPYEQTTSYKKGTRFGPGALIDASCQVELMDEELMQDTYKVGIHTLPPFP-INKDPAVFIRELSDYTRRFLDKGKFVITLGGEHTVTAGTIIPYAKKYPKLSVFHIDAHPDLRNEYEGSIYNHACALRRVLDYAP---IVQVGIRCITPEEVEIINSGRVKTFFAHVKEIIPSVLKTLSDD-VYITIDLDGLDPSIMPGVGTPVPGGLMWYDTLEILREIIYKK-NVVGADVMELCPLQD-NVLSEFTAAKLTYKIMGYVVKS.... 291
141 0.000e+00UniRef50_A0A0H4W4P5 Guanidinobutyrase n=48 Tax=cellular organisms TaxID=131567 RepID=A0A0H4W4P5_9BORD  ali  26  25.AAPQDDFDIALAGVPFDGGVTLRPGARFGPREIRNMSSMTRAIHHVTGFNPFAVKVADIGDVPFTGGQLEAAHADIRRFFAPLFAAGKKVLVAGGDHSITFPIFQAIAPR-QPLGMVHIDAHTDTWDEHAGSKFSHGSPFRRAVELLDPRRTIQIGIRGNTDEGWRYSLDHGMRVVFAGVQAIVREARRVVGPGPAYLSVDVDGLDPVYAPGTGTPEIGGLSTRETLALLRGL--DGLDFVGADVVEVAPPYDPSGNTALLGATLMYECLCLLARS.... 309
142 0.000e+00UniRef50_A0A0S8CKT0 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0S8CKT0_9CHLR  ali  27  14..SDLQKAKAVILPVPYDSTSEWRGGSRHGPQAIIDASEYLELYDLELDREIYRAGICTLPRVEPLLGSPQGMIDRVYQVVGDLVQKGKFVVLLGGEHSLSLGAVRAFKEAFPTLSVLQLDAHADLRDQYLGTKYGQACVMRRILEVCP---ICQVGVRSLSWEEKQFSAEKQLKVFYMTDFASIDRITESLSRD-VYITIDVDVLDPSIMPAVGTPEPDGMSWRQILDTVKSVMIHK-HVVGFDLMEFCPVEGSSSC-AFLLAKLAYRLIGYAVSQERR. 289
143 0.000e+00UniRef50_A0A1Y4NS07 Agmatinase n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NS07_9FIRM  ali  30  40..RTLEDVDYVVVGIPFDTLTSNRPGTRFGPKAIREA---YGGINYVYGTDVYTLSGVDYGDIQVQNGDTKQSFENIKAEIGKILEAGVIPVALGGDHSITYAELLAYRDVYGPVSLIHFDSHTDTWEESLDFP-THANPFRNAIGCIDPKTSIQVGMRGIMKSEYDFAHENGTDLHKMGVYEAAKKIREKVGNNKVMVTFDIDFVDPAIAPGTGTPVPGGFTSWETLELVRT-AITGLDVVGFDLVEVAPNYDPTENTQLLANKLVGEFITAIAAKK... 325
144 0.000e+00UniRef50_UPI000852C38D agmatinase n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000852C38D  ali  30  41..........VFLGVPFDGGATFYVGARFGPQYIRSESRILRPYNAELDVYPFKLRAVDYGDVDVIPVSITKTLDGIEEVVKDVINQGATLFIAGGDHSITLGVLRAIGKMFKPI-LLHFDSHLDYWDEYWGEKYTHGTWVRRAIEEGLIAQVVQVGIRGYDKSDFNYPRESPVEVEERGIEWLISELRSL--EGNVYVSFDIDVVDPAYAPGTGTREPGGFTSNEVLRIIRSLADAKINLVGFDVVEVAPPLDVANITSLLAANILYQAMSVKSK..... 314
145 0.000e+00UniRef50_A0A2H5YBF7 N(1)-aminopropylagmatine ureohydrolase n=23 Tax=Bacteria TaxID=2 RepID=A0A2H5YBF7_9BACT  ali  30  15LALPPEQSDFVVVPVPYDSTTSAKAGAREGPLAIIAASRFLEDYDPALGWEPCSLGIATLPEVEPDVGNPQATLERVAQVVEGILGMGKVPVVLGGEHSIALGGVQGALRHYPRLSVLYLDAHADLRDTYMGTRYSHACTARRIAEIAP---LVEIGVRSMSAEEARFARSRGIPLFPWGPEDALAWALPRLGPE-VYISIDLDVLDPALMPAVGTPEPGGLGWREMLVLLEGVARS-RRIVACDVVELCPREGPASC-ATVAATLVYKLMGLMALGHAPG 298
146 0.000e+00UniRef50_A0A1F9HT98 Agmatinase n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_46_8 TaxID=1797879 RepID=A0A1F9HT98_9DELT  ali  26  18....YKNSPVVIIPVPWEKTTSYMKGTGKGPQAIIAASHQVEFYDAELKKENWKPGIHTFSPVDFGASDSKKALEAIEKTVGQVLDDHKFPIALGGEHTLTAGCVAAAAKRYPNLSILQIDAHADLRESYDGTPYSHASAMRLCLK--SVKKLVGVGIRSVCVEEVEFAKQHGVTLIYDHEKNWVTKALQGLTDD-VYLTIDVDGFEPNLIPATGTPEPGGLTWYEGLKLIRSVFQKK-NVVAADVVELLPLA-SQHASDFIAAKLVYKLIGYRQESR... 291
147 0.000e+00UniRef50_UPI0009FB181D agmatinase n=1 Tax=Syntrophomonas palmitatica TaxID=402877 RepID=UPI0009FB181D  ali  37  19.SRDIDKCNKVIMGLPMDSTTSYRPGTRLAPYRVREVSDAVEEYSVYQDRSLAEINFYDAGDVCIPYGNVVESLQRMEQAADCFLGQGKKLYCIGGEHLVSLPIIKAYHRHYPELVVIQMDAHADLRSDYLGEPLSHATVMRHVLEELGERRLFQLGIRSGTREEMMYARE-KSNLYLDSFLEVLEEVKVKIGERPVYLTLDIDVLDPAFAPGTGTPEAGGISSRDLFKAFHEL--KTLNIAGFDMVEISPPYEKGDNTSILGAKIMREALLAF....... 288
148 0.000e+00UniRef50_A0A1V6A3L3 N(1)-aminopropylagmatine ureohydrolase n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V6A3L3_9BACT  ali  29  24....YEDAKAVIIPVPYDSTTSYRAGTREGPQAILTASRQVELFDLDLGCEPLTSGVHTFPELETDTSGPEGTVKNVEKAFKAVFSANKLPVMLGGEHSITSGVKAAKAKYKKSLSVLQLDAHSDMRDEYENTIYNHACVMRRVYDLAP---VTQVGIRNTCKDEIEFFKKVKHDIIWASQMAWIERVLSRLSDD-VYITIDLDALDPSIMPAVGTPEPGGMLWYQTLELLTKVIDKK-NVIGFDVVELCPIPG-NIASDFLAAKLVFKMLGRIFKK.... 297
149 0.000e+00UniRef50_A0A1V5FZ74 Agmatinase n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A1V5FZ74_9PROT  ali  27  48.RKDLRDADVAVFGAPFDLATTNRPGARLGPRAIRSASASLAWCPPYWGFDPERLQVVDFGDLYFDPGRPAEIPERLYQQVRDILAHSVTPLALGGDHFVSFPILRALSEQHGAIALIHFDAHSDTWRDDDG-RVDHGTMFFHALGYVDPAVSVQLGMRTFNEETHGFLVWDADRLHRDGIDAALQAIHARVGQRACYVSFDIDFLDPAFAPGTGTPVCGGFSTHEALRLIRGLA--GLNLIGMDVVEVAPAYDHAEITALAAASVAHELLAVLASRR... 325
150 0.000e+00UniRef50_A0A1G7QV34 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QV34_9DELT  ali  27  32........DVSIIGVPFDSGVSYRPGTRFGPAAVREASTLLKPYSPELDVDVTEASIADHGDIDTIPGYMEESFTAITAGLLPFFRANTLPVILGGDHSISLANLRAVKEAQGPVALLHFDAHSDTLPSYYGKPYNHGTPFYWAIGLILPERSVQIGIRGYSRKALDWPRQQGLRIHALGLEAVIREALARVGDAPVFLSFDVDFLDAAYAPGTGTPEVEGFTTYEAMTLVRGIC-SHCRTIGMDLVEVLPDKDAAGITALAGASVIFAFL.......... 304
151 0.000e+00UniRef50_A0A2M7T598 Agmatinase n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T598_9ACTN  ali  31  28...SFEESKVVVVPIPYDSTSSYRAGTREAPVAVINASRQVEFYDEELETEIYDVGIHTLNEIMPNMEGPRHQIEVVRRVLLDMMEAGKFPVTIGGEHSITLGAVQAVKDFFPQVSVLQLDAHTDLRKEYEDTQYSHACVMRRIFDEG--VRIAQVGIRNSSKEETRFIKANNIFSVSARQYRGIEEIVDALSDD-VYITIDMDVFDPSEVPAVGTPEPGGLSWYEVLDILREV-TFHKRVVGFDVVELCPIPG-NPASDFLTAKLIYKLIGYCFR..... 300
152 0.000e+00UniRef50_H2C483 Agmatinase n=2 Tax=Metallosphaera TaxID=41980 RepID=H2C483_9CREN  ali  30  39.....ERPKAVFIGIPFDDATTYRPGARFGPMGVRDGSRLLRPYNPFQGVYPFDLNACDAGDVDTVPGHIEDTMKKVEEGLLNILVFS-TPFIVGGDHSITLPVLRAVHKVHGRVNLIHMDSHYDFWDSHWGKKYDHGTWLRRALEEGLLEEVVQIGIRGFSHEDVEDSKRLGITSFSIREVEVMDRVKAL--RGPTYVSFDIDVVDPAFAPGTGTPEVGGLTSFEALELVRGLP---VELVGFDVVEVSPPYDVSELTTMLASNLIYEAMSLKARLERRG 316
153 0.000e+00UniRef50_A0A021X7H5 Guanidinobutyrase n=673 Tax=root TaxID=1 RepID=A0A021X7H5_9RHIZ  ali  29  36........DIALVGIPWDGGTTNRAGARHGPREVRSASSLMRSTHHASKTQPFTINIADVGDLPINPIDLMDALKLIEGGMRTVIEAGALPLAVGGDHLTTLPVLRAVAAS-GPVGLIHFDAHSDTNDTYFGNPYTHGTPFRRAIELIDPRRTVQIGIRGYAPDEHDWAVKQGIRIIYMGVAAVMAEARQIVGDAPTYVTFDIDSIDPSMAPGTGTPELGGFSTREAQHLVRLL--EGVNIVGADVVEVAPPFDLAGMTSLAGATIMFELLCVMARRRRAG 320
154 0.000e+00UniRef50_A0A1F9YCD0 Agmatinase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1F9YCD0_9BACT  ali  28  15....YDAARAAILSVPYEGTVSYGKGTSKGPRKIIEASRYLEFFDEELGLLNYQAGLTTCPPLK-PAATPQKMVEAVRQSARQLLSDEKFIIMLGGEHSISYGLYLALRERVRDLSVLQIDAHADLRTTFQGSPFSHACVMRRIDESCP--RTVQVGIRSFCAEEALFIRQKKKHLFMAKDIDWFDQAIRRL-SRNVFLTIDIDGFDPSLVPHTGTPEPGGLFWYETLAFLKRLFE-KRNVIAFDLVELAPTS-FSAPSDFLAARLVYRLLGYKFK..... 284
155 0.000e+00UniRef50_A0A1J4UHW9 Agmatinase n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UHW9_9ARCH  ali  26  14MKNNLKNAKTVIVQAPYDGTVFYKDGQRHGPREIIDASRHMELYDAEFGCDVCEAPVYTMDELVLSKESPKKAVERVGEVVDEVLKERKFPLVLGGEHSVSAGAVSACAKKFKKFSVLQIDAHGDLRDAYEGTKYSHACAMRRAREACG--NIVQAGVRSMSGEEAEWIKKERIEKYIFGSEFEESEVLERIENENVYVTFDLDGFDPSIMPAVGTPEPGGISWKQATSLLRKVFERK-NVIGADVVELCPVIG-DTASAFLAAKLCYKMIGW........ 284
156 0.000e+00UniRef50_A0A179D4F8 Agmatinase n=4 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=A0A179D4F8_9BACT  ali  26  8LPEVREKARVALIPAPYDATTSWRPGTREGPRRILEVSPYLEFFDEETGSEPHRLGFYTFPE-PELPVDPEKAILTIESLVCKALDEQKFPVLLGGEHTVTLAALRALKERFSSFKILQIDAHPDLRDVYQETPFSHACVMRRAYEMGL--EVVAVGIRTASREEYELIQREKLSVLWARDEAGLANLKDLLGEGPVYVTLDLDGFDPAEAPGVGTPEPGGLTWYEVLEILK-LAAS-FRVIGFDVVELLPIPG-DPRTEYLAARLIYKFLAYLERGLR.. 286
157 0.000e+00UniRef50_D5DRS1 Agmatinase n=130 Tax=cellular organisms TaxID=131567 RepID=D5DRS1_BACMQ  ali  29  35........DFIVTGIPFDSGQSFRTGARFGPEAIRDFSILLRPYNPEQKINIFDISGVDYGDLSVVPGYILETYKKIEEGLTPVVNEGIIPISLGGDHSMTLGELRAIAKKHGPVALLQFDAHSDTWDSYFEQKYNHGTVFRRAIELIDVSRSIQIGMRGYGIEDLEDAKNLGLEYKKLGVERMLDIIHERVGEGPVFLSFDIDFLDPVYAPGTGTPEVSGASIDDALQFVRGL--TNIDFVGFDLVEVLPAYDHGQITAAAAANIVYEFITLIALRKK.. 314
158 0.000e+00UniRef50_A0A1J4UIK6 Agmatinase n=1 Tax=Candidatus Micrarchaeota archaeon CG1_02_51_15 TaxID=1805249 RepID=A0A1J4UIK6_9ARCH  ali  27  9..ENPSKAKAAVLPIPYEETASYAKGTAEGPAAIIAASRELEYYDDETGTTPWDAGINTLPELK-PPKNPAKMAQTVQAAVDKILSAQQFPVMLGGEHSITIGAVRVAKKRFPNLSVLQFDAHADLRDEYDGSNYSHACTLRRVIE--DGITVAQVGIRSTDRESLEWA-QGKTKIFWARNKWSAADVLAAL-THDVYVTFDVDAFDPSIMPATGTPEPGGLLWDETLAILKPVFSQK-NVVGCDVTELLPLKEMHAPT-FTAAKLVHKMIAYKFER.... 278
159 0.000e+00UniRef50_A0A1G8M7E4 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G8M7E4_9BACI  ali  28  29.....EGVDFVVAGNPFDTAVSNRIGARGGPQHIRNFSVLLRPYNPDQGINIFDYSGVDYGDFEIVPQNIHRSYDIVGEQLAPIIEKEITPIILGGDHSVSLGHLRAFAKKYGPVALVHFDSHSDTWDNYFGEKYMHGTPFRRAVELIDTSHSIQVGLRGPDPEELGFKTIPMREVRKLGKDEVLRQIHERAGNKPVFVSYDIDFVDPAFAPGTGTPEVAGPDSFEALEYVRELY--GLNIKGFDLVEVLPEYDSDDITAALASTIAFEMITLVAMQKR.. 311
160 0.000e+00UniRef50_A0A1M4M380 Agmatinase n=25 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1M4M380_9FIRM  ali  53  15..KTYDEANIVVFGAPYDGTTSYRPGTRFAAKVMRAESLGFESYSPYQDKDLTEIAVCDYGDLVLPYGGPELILDIISDFTRDVLSDEKIPVMIGGEHLVTLGTVRALVEKYPDLHVIHFDAHTDLRHEFFGRELSHATVMRRVWDLVGDGKIFQMGIRSGDRSEFEWAKEHLHQCRY--NCDTIDYIIEQTKGKPVYVTIDLDVLDPSVFPGTGTPEPGGVDFKTLLDCI--LKMSELNIVGADINELSPHYDPSGSSTAVAIKTLRELLLVVHK..... 285
161 0.000e+00UniRef50_A0A2T9XAG4 Agmatinase n=1 Tax=Acidianus hospitalis TaxID=563177 RepID=A0A2T9XAG4_9CREN  ali  30  26.TKDVSDANIAIIGVPWDDLATSRPGARYGPLGIRNASSFIRKYNYVLDINPFEVKIVDYGDVEVHAGYIEDMFNEVEKEVKEMLKKNVIPVVLGGDHSISLPIIRGLSSKYKKVAVIHVDAHHDSLDILYGKKYDHGTIFRRGVEEIIGESSVHYGVRVFSKEDMESVRALGYDLLTMKIIDTVEQLKRKVGDQPVYLSIDIDVMDPAYAPGTGYPDPGGLTSREILEFVRKLY--GLNIIGMDVVEVSPPYDVAEITSTLAASIVFEGLSIISKNLKK. 317
162 0.000e+00UniRef50_A0A0P9CCP6 Uncharacterized protein n=2 Tax=Bacillales TaxID=1385 RepID=A0A0P9CCP6_9BACL  ali  25  24...SPQPVDVVLLGAPFDTAASYRVGARFGPEAIRRVSSLLRPANMYHRIRPDDLRIVDGGDAMVIPGNIERSYASITERVSSWLAEGATPIMLGGDHSIALAELRALAGKYGPVAMIQFDAHGDTSDEYWGEKDTQATPFRSAVELLNPAKSTQIGMRGYDTNDIEAGRQLGFDVVTMGLKPVMQAAQLRAGNTPVFVSFDIDCLDPAYAPGTGTPEIGGFTTFEAQHMIHQLV--GLNCVGFDVVEVLPSQDVSEITALAAATVAFEFLTLIAVNNK.. 308
163 0.000e+00UniRef50_A0A2G6CLY4 Agmatinase n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6CLY4_9PROT  ali  28  36..CTYDESRVVLLRAPYDGTTSYMAGARDGPAAILAASAQVEPYDRELGCEPCEVGIHALPAVPPAAAGPKAVIDQIEALSLPVVADGKLPFVLGGEHSVTLGAARAVAEVHPRLSFLQIDAHLDLRPSYEGSPYSHACVAYHLLGLGDGGQVVQVGVRTACPEELAVIEEHGLDVWREEDDAWIARAVEGLADHPVYVTVDVDGLDPSVIPGTGTPVPGGLGWYQTLRLLRAVGQA-CRVVGCDVVELAPGPG-DHRSAYAAAQLVYKMIGYFEAAR... 317
164 0.000e+00UniRef50_A0A0G3XWG0 Guanidinobutyrase n=83 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0G3XWG0_9BACI  ali  28  22LPADRENAKLAILGMPFDTAASFRVGARFAPQAIRQASMTLFPYHPIHKVPFEDTNGIDIGDVSVIPNNIHKSYELMENAVFDLMKKGIVPIGLGGDHSVTLASLRAAAKVYGPVALIHFDSHTDTWDTYYGEKYWHGSPFVRAHEEGLPDKVFQIGIRGNHPGDIEASLKLGYNVITTQELDIAQEMKETIGETPCFLSFDIDFVDPSCAPGTGTLEVGGFSSRETLDIVRSL--TDFNYIGFDIVEVLPAYDPAQITALLAATLVHEFASIVA...... 305
165 0.000e+00UniRef50_Q0F026 Agmatinase, putative n=3 Tax=Zetaproteobacteria TaxID=580370 RepID=Q0F026_9PROT  ali  45  11.....EEHEIRIIGAPFDGTASFRPGSRFGPSAIRDASDGIETWSPDLDSDLESVHYADAGDLELPMGNTEGVLAIIREAVDECLTDDVIPFLLGGEHLITLPAVESVFEKYPDLVVVQLDAHADQRDDYLGVELSHACVMRRISELVGDENVRQLGIRSGTQREYELMKGFG-TLTSFREDDLIE-LVDWIGDRPVYLTVDLDVFDPACFPGTGTPEPGGIEWWTFQRFIK--AMQGCDIVGLDAVELAPQLDTSGCSSVLAAKCVREML.......... 272
166 0.000e+00UniRef50_Q8KZT5 Guanidinobutyrase n=458 Tax=Bacteria TaxID=2 RepID=GBH_ARTS8  ali  29  40......KADVTVVGVPFDSGVSYRPGARFGANHVREASRLLRPYNPAWDVSPFEIQVADAGDMAVNPFNINEAIETIQQNALDLTANGSKLVTLGGDHTIALPLLRAAAERAGPIAMLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGDTEAISHVGTRGPDDHRFGFGIVTSADVYYQGVLETVAKIRDRIGNRPLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEIIRGF--RGMNLVGADVVEVAPAYDHAEITGVAGSHVAYELVTLMADNAVEG 324
167 0.000e+00UniRef50_E8T4C8 Agmatinase n=3 Tax=Desulfurobacteriaceae TaxID=558314 RepID=E8T4C8_THEA1  ali  37  8.....EKGKIAVVGAPYDSTTCFRPGARFGPDGIRNFSHNLEEFSPALNKTLEELQFCDLGNVEL-PAPPEQMVEHLYSFVKEV----ELPVVLGGEHSVTYPVVKALKERYGSLTVIHFDAHADLRDEYSGTPYSHACVMRRVAELGC--TVYQVGIRSGAREEFLY-RETSPFVFDVELSE-LPTLFSSLE-EPVYITVDIDYFDPAYAPGTGTPEPGGASPLEFFTTLYKLPA--VKLVGFDLVEVAPPYDPSGITQALGAKVVREVM.......... 261
168 0.000e+00UniRef50_T0LFC6 Uncharacterized protein n=2 Tax=candidate division Zixibacteria TaxID=1379697 RepID=T0LFC6_9BACT  ali  32  17..SDFKKSKFVILPVPYEQTTTFKTGTKNGPQAIISASREVELFDEELEFEPHTIGIATLQDMEVTALGPEKMSQRIYQTAKKLVSQNKFVIMLGGEHSITYGLVKAYQKKYKDLTVLQLDAHADLRESYQDNKFSHACAMKRVWEICP---VVGVGIRNLSEAEFRFVKQKKINLFYARDLQNYDEIVNSLSN-NVFLTFDLDYFDPSIMPAVGTPEPGGLYWYETLELLKKVIQKK-NLVGFDVVELSPLPGNVAPD-FLAAKLIYKLISYQVAKQKK. 292
169 0.000e+00UniRef50_A0A2K8L2H5 Agmatinase n=3 Tax=Zetaproteobacteria TaxID=580370 RepID=A0A2K8L2H5_9PROT  ali  45  11.....EEHDIRIIGAPFDGTVSFRPGARFGPAAIRDASDGVETYSPYLDADLETVHYADAGDLELPMGNTEAVLAIIRETVDECLNDDVIPFLLGGEHLVTLPAVEAVFEKYPELVVVQLDAHADQRDDYLGIELSHACVMRRVSELVGDENIRQLGIRSGTQREYELMKGFG-TLTTFRDDD-LDEMVAWIGDRPVYLTIDLDVFDPACFPGTGTPEPGGIDWWTFNRFIK--AMMECDIVALDAVELAPQLDTSGCSSVLAAKAVREMLLAVS...... 276
170 0.000e+00UniRef50_A0A2E6VUY7 Agmatinase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VUY7_9DELT  ali  25  33..ASLQAADVALLGAPFDGGTSYRPGARFGPEKIRSMSSLGRGHHPEHDVNIFKMKVGDAGDCPVTPQDISKTHAQIKERVAEVLKAGTFPMVVGGDHSTTIGTLDALVAHHGPLGIIHFDAHTDTYPAAWGCDVHHGTFMRLGKERGWFRAVVQVGIRGPFSTEQDIHVQYGYRVFTVDDVGAVVQHIQQLDDGPFFISFDIDCLDPSCAPGTGTPVPGGLSTWEAQQILR--ATSHINVVGADLVEVSPPYDHHDITALTGVTVIWEILSAVAAR.... 315
171 0.000e+00UniRef50_A0A076K4V5 Agmatinase SpeB n=32 Tax=cellular organisms TaxID=131567 RepID=A0A076K4V5_9RHOB  ali  29  61....PAGLDVVIMGIPMDIGTSWRSGTRFGPKQIRQESAMIRPYNLQTGAAPFDLQVADMGDVAINTFSLAESLRIIESAYDGLHDYPVVPATLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVNDEMFGERETHGTVFRRAYEEGLPDLVYQIGLRGYTAEDFSEAAGWGFNMITAPEIWLGQEIRQAIGDHPCYLTYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRAL--RGLNIVGFDMVEVSPMYDTSGNTALTAANLMFEILSIL....... 339
172 0.000e+00UniRef50_A0A1F4YM81 Agmatinase n=2 Tax=candidate division Zixibacteria TaxID=1379697 RepID=A0A1F4YM81_9BACT  ali  30  19..SNYETAKAVILPIPYESTVSYGAGTRNGPQAIIAASRQVETYDQEFGAAPCNMGIATLGELEQVASGPDAMMKQIEEAAAGILADGKFLMTLGGEHSISPPLVRAHKALYPNLSVLQFDAHTDLRPEYQGSKYSHACAMSRIWETCG---FVGVGVRNFCGSENERALLEGRLIDFHKNVDIVPNILSLLADD-VYITFDLDGLDPSVIPAVGTPEPGGLFWDETMDLIRKVSRQ-RRIVGADVVELAPIPGMTYPD-FAAARLAYKIMTY........ 287
173 0.000e+00UniRef50_A0A101EB65 Agmatinase n=3 Tax=Clostridia TaxID=186801 RepID=A0A101EB65_9THEO  ali  37  20.REDYAGARVCLLGLPLDVSTSFRPGCRFGPAVIRAVSEVLEEFSPAVWRSLGEVPFCDLGDLELIPGDIEENLHRIEGAAEAILGDGKFFLALGGEHLVSYPLIRAVRRRYPDLAVIQLDAHADLREEYLGKRYSHATVMRLVAGEIGPDNLYQFGVRSCTWEELAYSRETN--FFLDKILEPLTRLVPHLTGRPLYLSVDIDVIDPAFAPGTGTPEPGGCRPQEIFEAIYSL--KGSRVVAMDLVEVCPPHDCGDITSVLAAKIVREA........... 285
174 0.000e+00UniRef50_D3QZK8 Agmatinase n=394 Tax=Bacteria TaxID=2 RepID=D3QZK8_MAGIU  ali  50  13..ADFATADIVLFGAPFDSTTSFRPGARFAAQAMRPDSYGLETYSPRLDLDLTDFSIMDSGDLELVMGCSDVALNQISEHVDEILAASKIPAMIGGEHLVTLGALRSVVKKYPALHIIHFDAHTDLRENYLGNPLSHACVIRRAWELVGDGRIWQFGIRSGLKEEFTWAKSH--THLQKFDFSGLAEVCTELKGQPVYFTLDLDVLDPAYFPGTGTPEPCGVTVLQLLDAIREL--RDLDIVGFDVNELSPHYDASGVSTAVACKILRELLLQVAAHRR.. 285
175 0.000e+00UniRef50_A0A2V9RIE8 Agmatinase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9RIE8_9BACT  ali  29  39..TDPSELDVALIGIPFDGGTTYRPGPRFGPRNVRVQSAMIRPWNPVLKVDPEKLRVGDFGDLSINPLSIEDTYRRITEQLGEVLRADARTICVGGDHSILLPILRAIHRHFGPVAFIQFDAHGDTWGGYFGSPHSHGTPVKYAVELLEPGCALQVGLRGYSEDDFEFARKHGIAMITSEEIELMKRHLRKHRNKNVYVTLDIDVVDPAFAPGTGTPQVGGFSSAQILSAVRAL--HGLHIVGCDLVEVSPPYDNGEITSLLAANLIYELLCLF....... 318
176 0.000e+00UniRef50_H5SQH2 Agmatinase n=3 Tax=Bacteria TaxID=2 RepID=H5SQH2_ACEAU  ali  27  34....FSAARAVVLPVPYDLTTSYRAGTRHGPHAIIEASTHLELYDEELRDEPYRVGIHTLPPLEPSAACPEETIQRVEEAISWLLEREKFPVMLGGEHSLTLAPVRALHKKFGNFSVLQLDAHSDLRDSFQGTKFNHACVGRRVHELG--VNLVQIGIRAISVEEAHYIRAKNLHVCFDYELEVLEQALTKLRD-PVYVTVDLDVFDPGLMPAVGTPEPGGLDWYTVLKILRHVGEKHT-VLGCDVVELCPIAGMVGPD-FLAAKLVYKMLGYFLHNK... 330
177 0.000e+00UniRef50_A0A0G1CW45 Arginase family protein n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1CW45_9BACT  ali  34  20...DYDKSKVAVFPVPYSSTTYWKSGTKEGPQAIIEASRHVELYDIETKKDASKQGIFTLELLEPSKNSPEETTARIKSVMDKILRDGKFPMMLGGEHSITLGAVQAVREQFSDFSVLQIDAHSDLRDEFEGTKFHHACVMKRIKDLG--VSVTQVGVRSSEGEEL------GDNVFLAPNL-PIDKIISTLK-EKVYLTFDLDGLDPSIMPSTGTPEPGGLGWYETLKLIKEVA-KKRKIIGADVVELDPIPGFSAPD-FLAAKLVYKIINYI....... 278
178 0.000e+00UniRef50_B5YF20 Agmatinase, putative n=3 Tax=Dictyoglomus TaxID=13 RepID=B5YF20_DICT6  ali  30  16..TNPEKAKVLIISYPLEVTTTYKKGTKEGPQAILSASYNLELYDEELDDIPAEIGIYTYPDLLLSLGNVEKVLEEIEELTFNIIDYDHFPIFIGGEHTITKGILRAYNKKYKHFSVLHLDAHSDLRNEYEGTKNNHACALREASETLD---IVQVGIRSMSEEEKKYVKERNIKVYERFNTTLIEDILKSLKDE-VYITLDFDVFNPAEMPAVGTPEPGGLSWYQVLSLLREVF-KNKKVIGIDLVEFSPIPGLIYPD-YMAARLIYKIIGYYKK..... 290
179 0.000e+00UniRef50_A0A1W6JYS4 Agmatinase n=1 Tax=Acidianus manzaensis TaxID=282676 RepID=A0A1W6JYS4_9CREN  ali  33  27.....EDVRAVFVGVPFDDATTFRPGARFGPSGIRQGSRLLREYNQFLDTPFEKLNMCDQGDINAIPGFLDDTMKIIENGIYEIISKNRVPFIAGGDHSITLPVLRAMRKKYGKVNLIHLDSHYDFWDTYWGNKYTHGTWLRRALEEGLLNEVVQAGIRAYSKDDLEDKKKLGIKSFTINEMKEKIEEIISIINGNTYISIDIDVVDPAFAPGTGTPEVGGLTSYEIINFIRKL---KTKIIGFDVVEVSPPYDVSELTSMLAANIIYE............ 294
180 0.000e+00UniRef50_UPI0004249251 agmatinase n=2 Tax=Alicyclobacillus TaxID=29330 RepID=UPI0004249251  ali  35  12.NPDYRAASVVLFGVPMDYTVCFRPGARFGPAHIRQASYGLEPYSLQFGDTLLHRSYHDAGDLVLPFGNAKDSLLRTETYVSGLVKDGKTPFALGGEHLISLPIIRVLHEHHPDLHVIHLDAHADLADVYFGESVTHATVMRRVLDFLPHNQFAQFGIRSADWSELEFAAARPLRQCTMDVAEPLAQWLAEVPATPLYVTVDIDVLDPAFAPGTGTPEAGGISPRELFAALGLL--RGRNVVGADLVEVAPQLDASGCTAVLGAKIVREMLLTLFEGTARG 290
181 0.000e+00UniRef50_E3PRB2 Agmatinase n=34 Tax=Bacteria TaxID=2 RepID=E3PRB2_ACESD  ali  52  14...EFEESQIVLFGAPFDGTTSFRPGTRFAPNIMRNDSFGLETYSPYLNKDLEDYMLFDSGDLDFPFGNPQRIIDMIKEHSKAIVNTGKIPFMIGGEHLVTLGSVQSVYEKYNDLHIIHLDAHADLREDYMGQKLSHATVLRRCHDFLGDGRIHQFGIRSGTKEEFTWAKDH-VDMHPFSLDG-LKEVIDELKDKPVYITIDLDVLDPSIFPGTGTIEPGGISFLELVGAFKEFSRLN-NIVGMDAVELSPHYDQSGMSTAVACKVIRE-MALIA...... 281
182 0.000e+00UniRef50_A0A2J0LJF4 Agmatinase n=1 Tax=Candidatus Omnitrophica bacterium CG12_big_fil_rev_8_21_14_0_65_42_8 TaxID=1974751 RepID=A0A2J0LJF4_9BACT  ali  29  20..SSREKSMIAILPVSYDLTTSYKSGASGGPKAIIDASRYMETYDDETGKEIYKLGIYTAEEIKSVNPEPEDIIKKVEKEISFMLKAGKFPVVLGGEHSISLGAVMAFKKKIKDFSVLQLDAHRDLRDNFQGLKNSHACIAKRIIEL---TSLTQVGIRSMSAGEAD--KEYNLKTFFMGNEDWIEDAVDSLDNDRVYVTIDMDAFDPSIMPSVGTPEPGGMGWYETLALLRRLSQKK-EVIGFDVVELSPVPGNVSPD-FLTAKLIYKFLNYIFSK.... 292
183 0.000e+00UniRef50_A0A1C5VFB2 Guanidinobutyrase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5VFB2_9FIRM  ali  29  31.....DDVDFVVVGIPFDTCATFRVGTRFGPAAIREMSAVVAPYNPILEVGIFDYSGVDYGDVGSVPGYVEESFEVITEGMLPIFEKGVIPIAMGGDHSVTLPELRACAKVNGPVALIHFDAHFDTIDQYFGKPYTHGTPFYHAAGLVDTSKSIQVGIRTKNSSDLGYDYIYAADCHKMTCEEIIKRIKDRVGDAKAFLTFDIDFLDPSCAPGTGTPIPGGFTTAQALEIIRGL--KDLNIIGYDVVEVSQPYDPNGITAIAAAGLMQEFMSHIAWKKKH. 315
184 0.000e+00UniRef50_A0A212K565 Guanidinobutyrase n=44 Tax=Bacteria TaxID=2 RepID=A0A212K565_9DELT  ali  28  30......QADVSIIGVPFDSGVSYRPGTRFGPAAIREASTLLKPYSPELDVDVESFTIADHGDIDTIPGYMEDSFAAITSSLKPFFASKTLPVILGGDHSISLANLRAVHAAHGPVALLHFDAHSDTIPSYYGKPYNHGTPFYWALGLILPQHSTQIGIRGYSRNALDWPRQQGLRIHAMGLEAVIREALARIGDAPVFLSFDIDFLDAAYAPGTGTPEVEGFTTYEAMSLVRGIC-SKRRAVGMDLVEVLPDKDVAGITALAGASVI.............. 300
185 0.000e+00UniRef50_A0A1V6JGP7 N(1)-aminopropylagmatine ureohydrolase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V6JGP7_9BACT  ali  30  15.....KSSKIVVLPIPYDGTSTWVKGSDKGPEALLEASANMELYDIETDSEVYLHGIHTAPAVS-ENKSPEDMVQAAEKEALKYIDSGKFLVTIGGEHSVSIGPIQAHAKRYKNLSVLQIDAHTDLRDSYQGSKNNHACVMARAQELCP---IVQVGIRSMDSGEMERLDRN--RVFWAHHIEWMDKAIDLL-TDNVYLTVDLDGFDPSILPSTGTPEPGGLQWYQALSFLKKLVERK-NLVGFDIVELCPPYEKS--SDFLAAKLLYKILSYKFAK.... 281
186 0.000e+00UniRef50_A0A1G7QVI1 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QVI1_9DELT  ali  26  29..ADPTGMDFAVFGIPFDTGSSYRTGSRFGPAAIRNISSMIKPNHVIFEVNLNELRGGDFGDVNIVPGYIEPSYAAITEFMTPLLAAGVTPLALGGDHSITLAELRAIAARHGKVSLLHFDSHLDLNTAVFGQPYNHGTPFRRALELIDPATSIQVGMRGYDPDDFKVAAELGFKVLEMGLAEVIKAILERLGRTKVFCTFDVDFVDPAYAPGTGTPEVGGFTTWEVLRLVRALNE--VHFVGFDIVEVLPAIDPAELTPYVAANLGFEFLSILAWRKKHG 316
187 0.000e+00UniRef50_A0A2H0Y197 Agmatinase n=6 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A2H0Y197_9BACT  ali  30  16....YQTAKFVVVPVPYEATTTYGQGTRRGPAAILTASLQVENFDEELKAEPYVFGIHTQGNCQ---------IKGLASRVKRHLAAGKTPIILGGEHSITPFVVKAAAQQDQALSVLQLDAHADLRDKYQGKKNNHACVMRRVLEICPA---VQVGVRSLSKEEWGFAKKSGQDMHWAQDKLDIKKIKNQL-SKNVYITIDVDVFDPSLIPAVGTPEPGGLSWYQVLNLLREICQTK-NVVGFDVVELSPRL-NELVSPFAVAKLVYKVISYL....... 272
188 0.000e+00UniRef50_Q7N122 Agmatinase n=533 Tax=root TaxID=1 RepID=SPEB_PHOLL  ali  26  34......DAEWVITGVPFDMATSGRAGSRHGPAAIRQVSTNLAWESRRWPWDFKLLKVVDCGDVVFNFGDAQDMSDKLQAHAEKVLASGKRMLSFGGDHFITLPLLRAHAKHFGKMALVHFDAHADTYP--NGSQFDHGTMFYHAEGLIDPHHSVQIGIRTEHGRDNGFTVLDADQVNDRSVDDLLAQIKETVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTTDRALKLLRGL--QPLNIVGMDVVEVAPAYDQSEITALAGATIALEMLYLQASKKR.. 307
189 0.000e+00UniRef50_A0A0T8FRU1 Formimidoylglutamase n=136 Tax=Bacteria TaxID=2 RepID=A0A0T8FRU1_STREE  ali  29  22LPAERENAKVGLVGMPFDTAASFRVGARFAPQAIRQASMTLFPYHPVHDVPFDDTNAIDIGDVPVIPHNIHRSYELMEEAVGALMDRGIVPIGIGGDHSVTLASLRAAAKRYGPVAMIHFDSHTDTWDTYYDEKYWHGSPFIRAYELVDPKKVFQIGIRGNHPGDVQESKDLGYHVVTAGELEILEQMKTAIGETPCFLTFDIDFVDPSCAPGTGTLEVGGFSSRETLQMIRSL--TGFNYVGFDLVEVLPSYDPTQITSLLAATIIHDFASLVAVKTKR. 310
190 0.000e+00UniRef50_U4KNG3 Putative agmatinase n=1 Tax=Acholeplasma palmae (strain ATCC 49389 / J233) TaxID=1318466 RepID=U4KNG3_ACHPJ  ali  48  15..SNYEEADVVIYSVPMDATTSFRPGTRFAGNAIRVDSFGVEWYSPYRDRDLKNYKTVDTGDLDLPIGAVEDALNIVYDATKTILEDNKVPMMIGGEHLVTYPVLKAVKEKYDNLHVIHLDAHTDLREEFFGRELSHATFMRQAHKFLGDHKIFQFGIRSGDKHEFEWAKKH---IHQQKDFTGLDKVVEQLKDVPVYITIDLDVLDPAVFPGTGTPEAGGMQYKELLWAIDQ-FEKLNHIVGADIVELAPMLDPSGASTAVACKTLREMVLLLHKNIEK. 289
191 0.000e+00UniRef50_A0A256Z2Z8 Agmatinase n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256Z2Z8_9CREN  ali  34  21.....EDSIFSLIGVPFDSTSSYRPGSRFAPQRVREASQNIELYSLRSGLDMERVPIYDEGDLAVVHGDVYEVMKRLEYVVEDIVNEGKVLIALGGEHIITYGILRGFKK---PTCVLYFDAHADLRDEYLGYKLSHACTLRRLVEIVGPDKVFIIGLRALCSEEVDYIRKSGIKYLTLSFMDVVNNVRKFLGCENVYVSIDIDVIDPAYAPGVANPEPEGLSPTYLLNLLSEVINES--VWGFDIVEVVPPIDPSGITSVLAAKIINELASYIYIAKGKG 298
192 0.000e+00UniRef50_A0A2G9MN50 Agmatinase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2G9MN50_9ARCH  ali  30  11.RVSYADAQIVILPAPFDGTSTYGKGADKGPAAIIDASPHLELYDVETQTEVWKKGIFTAKTLKFND-DPEEVVNMVHEAVSKFLKDDKLVVVLGGEHSISTGFARALKEKYSRLSVLQFDAHGDTREEYNGSKYNHACVMARIRDLNVP--IVQVGIRAIDKCEVE-SRKEDQHVYFAHDIKWMDDAVSKLTDE-VFITFDLDAFDPSIMPSTGTPVPGGLGWYQVMKFLEKVSASK-KIVGFDVVELAPQKGNNGPD-FLAAKLIYRLLSMIYKK.... 283
193 0.000e+00UniRef50_UPI00041583B9 agmatinase n=1 Tax=Thermodesulfatator atlanticus TaxID=501497 RepID=UPI00041583B9  ali  29  8LPENPAKARVVFCPAPYDATTSYLPGTRFGPRRIIEASPYLEFYDEEKDCEVYKAPFLTLPE-EELPVDPEKMLKTLKSRLDPYVNAGLFPVTLGGEHTVSLAPMALLKEKYGRLCVIQIDAHADLRNEYQGTPFSHACTMRRALELGI--ELYPIGIRAISREEIVFAREKGLKIHWARELEVVNEILTRIGKRPVYVTIDLDGFDPAEVPGVGTPEPGGLKWYEGLFILQAV--SSLNVVGFDVVELLPK---DDRSAYFAARLIYKFLSYLF...... 280
194 0.000e+00UniRef50_A0A1G6MW86 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G6MW86_9BACL  ali  27  30.....DGSDVAVIGLPFDTGASFRAGARFGPAAIREMSVLLRPAHSFHKINPFEVRCVDYGDLPLLPGYMEDSFDIIRDTYRRLAREKVIPVGLGGDHSVTLAELRGLADVYGPLSLVHFDAHGDTWDEYWGKKYTHGTPFRRALEEIDPHHSVQIGLRGYHPDDMDEAAELGFEVIAADELHTLRRIENRVGDRNAFLTFDIDFFDPAYAPGTGTPEVGGFTSHQGLTFVRHLPL--LNYVGFDLVEVLPAHDHSQNTALLGAAVVYEFLALIALN.... 310
195 0.000e+00UniRef50_A0A2M8FY96 Agmatinase n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M8FY96_9DELT  ali  29  16..ATYEKAKVVFLPVPLEKTTSYAKGTANGPEAILQASTQVEFYDEEIDDEPFLLGLHTKASLQFEDLTLEESVALIEKEVEAIVKDKKLPFVFGGEHTISAPVVRAVGKFHPDLTVVQIDAHADLRQEYEGTPLSHASVMARILEKFPA---VQIGIRALSKEEALWIKKDKLPVFFAHHIEWIDQALAAIKTEKVYLTIDIDGLDPSLVPDTGTPEPGGLSWLHTSSFLRRLMQEK-EVVGMDLVELMPKEGSHG-SNFIAARLASKCIGYWKKGK... 290
196 0.000e+00UniRef50_A0A0D2WMM6 Uncharacterized protein n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WMM6_CAPO3  ali  28  462....PASVQAAFVGVPFDLGTSNRVGTRYGPRAIRAESVLLRPYNMATRAAPFELQVADAGDVPINTYNLAESIKIIEQFYSDILQHNCVPMTLGGDHTITLPILRAIVKKHGPVGLVHIDAHSDTNDVMKGEKIAHGTTFRRCVELLDTKRVVQIGLRGYAADDFDWGRKQGFRVVQAEECWLMAEVRAAMGSGKVYVSFDIDGLDPSVAPGTGTPEYGGLTAHQGLEIARGV--RGLNIVGCDLVEVAPQYDTSGNTALLGANMLFEMLCSL....... 741
197 0.000e+00UniRef50_A0A2J0KVA3 Agmatinase n=3 Tax=PVC group TaxID=1783257 RepID=A0A2J0KVA3_9BACT  ali  26  16..SNLKDSKVVIIPVPYDATATYKKGTKLGPAAIIDASRYMEQFDEELNKETYKIGIHTAKPLNVKRLSPKKMTLKVQDAVKSVIEKDKFPVILGGEHSISVGAVRAIAKAVDHFSILHLDAHCDLRNEYFGSRYNHGCFARRVIELAP---IVQVGIRSLSKEEKDFLPHPKIRIISAYDIEWIKKACDTL-SENVYVTIDADVFDPSVVPSVGTPEPGGIGWYDAINLFKML-TKKRRVIGFDAMELCPQKG-GEASDFLMAKLIYRFLGYIFDNKK.. 290
198 0.000e+00UniRef50_C7D719 Agmatinase n=57 Tax=root TaxID=1 RepID=C7D719_9RHOB  ali  28  26.AETPEGLDVGFIGIPMDIGTSWRSGTRMGPKQVREQSAMIRPYNIQTGAAPFDLQCADLGDVAINTFSLSDSLRIITETYDKHLKHNFIPMTLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVNDEMFGERETHGTVFRRAYELITPSKVYQIGLRGYTSEDFTEAEGWGFNTVLAKDLWLAKTIKDAIGDQPCYITYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRGI--NGLNIVGCDLVEVSPPYDPSGNTALTGANLMFELLSIL....... 307
199 0.000e+00UniRef50_A0A2H5XU44 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5XU44_9BACT  ali  28  18..KSTNTAAIAIQPIPLERTTSYGKGTKDGPREILRASHYVEFYDDEFDRELFERGIATLEPLPLKKLPIEEALALVEARASAILQAGKFCVGLGGEHSITAPLVRAHAQKVPDLTILQFDAHADLRIEYDGTPYSHACVMARIAEFLDPSRITQVGIRALSKEEASFIRSAGVRTFFAGDAQWMDRVLEGL-SEHVYITFDVDALDPSIMPATGTPEPEGLTYSECIAIVKRLIETGRRIVGFDVVELAPIKKLHHP-NLTAARLVYKLLNLAFAHDRSG 300
200 0.000e+00UniRef50_A0A1W1W0G6 Agmatinase n=2 Tax=Thermoanaerobacterales TaxID=68295 RepID=A0A1W1W0G6_9THEO  ali  38  20.TDNYVDSWICILGLPLDVTSTFRPGSRFAPQSIRSVSEVLEEFSPFLKRDLKEVAFCDLGDLELVPGRIRENLTRIEEVASEVWKDGKLLLSLGGEHLVSYPLIRAARSHYPELAVLHFDAHADLREEYQGEKYSHATVMRLVAEEIGPSHLYQLGIRSCTWEEWVYGSEN-TNLFLDHIELPLSRLLPELKGRPLYLTLDIDVVDPAYAPGTGTPEPGGCRPQDIFSALYLL--KDAHIIGLDIVEVSPAYDMGNITSILAAKLVREAILAF....... 289
201 0.000e+00UniRef50_A0A1W9MI09 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon A3 TaxID=1933927 RepID=A0A1W9MI09_9EURY  ali  39  9.NSEKEDADVCIFGMPFDSTTSFKPGTRFGPNAIRDASYNLEFYSMALERNIGDIKIFDAGNIGF-HTKPQDAISEISKRTNDLLKNDKFIVGLGGEHTVSYGIAHAMKEIYKDIAVIHFDAHADLRTEYDSEKFSHACVMNLIGSEIGFENIYQFGIRSGEEEELKFAEKTNFYPLHKYDTTQILEILDDLNSKRTYLTIDIDVLDPAFAPGVGTPEPGGITSNDMFKILNSL--KKFDVVGFDVVEVNPMIDVSGITAMAAAKIVREGI.......... 276
202 0.000e+00UniRef50_A0A0G1VFJ1 Agmatinase n=5 Tax=root TaxID=1 RepID=A0A0G1VFJ1_9BACT  ali  32  24.NQDYKTAQVVVFPVPYDSTTYYMGGAKQGPFALINASRHMELYDLEKGKDVSTVGIFTLEPLEPSKNSPEETIDRVESVIAKIIQDAKFPLMLGGEHSVTLGCVRAFHKKYGDFTVVHFDAHTDLRDEFQGTRFHHGSVMRRTTELGIP--VTHMGIRSVSEEEMEYLKGKGKEVFYAERKHTLEEMINTLR-ENVYITVDVDVLDSSAMPATGTPEPGGLTWYQIIDAVRAIGAKK-KIIGADVVELAPIPGMVAPD-FLAAKLAYKIIG......... 293
203 0.000e+00UniRef50_A0A2N2D3H8 Agmatinase n=13 Tax=root TaxID=1 RepID=A0A2N2D3H8_9FIRM  ali  39  19.SEDIEDCDKVLIGLPMDFTTSFRPGTRMAPFRVREVSEGVEEYSIYQDRSLDEISFYDAGDVCIPFGNVSDSLKRMELTALDLLAMKKKIFSIGGEHLVTLPIIKAYIKTYPDLLVIQMDAHADLREDYLGEVLSHATVMRHILQLVGERNLFQLGIRSGTREELQYASKSSNLYLDCF-LSVMDEVKNKVGDRPVYISLDIDVLDPAFAPGTGTPEAGGVSSRELIQMLNGL--SSLNVVGFDMVEISPPFDIGDNTSILGAKIMREALLAY....... 288
204 0.000e+00UniRef50_UPI000DE34492 agmatinase n=1 Tax=Vallitalea guaymasensis TaxID=1185412 RepID=UPI000DE34492  ali  48  13INSTYHDADIVICGVPFDGTCSNRPGTRFGPDGIRAEIDGLETYSPYQDEDMIDYNYVDVGNIEIPIGSTSKTMGCIHENIKSILEDNKKIITLGGEHLISYPIVKAFAEKYSNLHVIHLDAHADLRSDYLEEKLSHATVMRRIYETLDKGYIFQYGIRSGTKEEFQFAGEH--TKLQAFNLNGIEKVKSMVGNDPVYLSIDLDVLDPSIFPGTGTPEPGGIDFNELINGI--ISLKDVNIVGADIVELSPHYDLSGVSNIVAAKTLREVAIIMSKREEH. 288
205 0.000e+00UniRef50_A0A1G2QQ84 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A1G2QQ84_9BACT  ali  33  21...DYEKAKVVVFPVPYEATTSYISGTKWGPKAMIEASRHLELFDIELKRDVSRIGIFTLPELSCSKNSPREAVKEIKKVVTQLLKDKKFVLMLGGEHGITPGSVAAFKEKYRDLSVLQIDAHSDLRNEYEGTNFSHACAMRRVRDLGVA--VTAVGIRSQEESEADYIRKEKIKTIFYAPKIPVQKIISTL-SKNVYLTFDIDGLDPSIMPSTGTPEPGGLGFYEVLNLIKQVAKA-RRIVGADLVELSPLPGMVAPD-FLAAKLAYKIIGYSVK..... 288
206 0.000e+00UniRef50_A0A2M7SJW3 Agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2M7SJW3_9DELT  ali  29  32....LDTSKVVVLPIPYDQTVSYRAGTREGPRAIINASAQIELYDQELNSEPYRVGIHTLKELEPDMSGPEGMFKRVYDTVSLFNKKKKLLIMLGGEHSLSVGAVKAFSEEYKDLSVIQIDAHADMRDTYCDTKYNHATVMRRVL---DYASTVQVGIRSLSKEEMEFIETRRLSVFFEKDEGWMEEMISHL-SQHVYITLDLDVLNPGIMPSVGTPEPGGLDWHELLNIIRKVAE-NRDIVGFDVMELCPIPGLIAPD-FLAAKLVYKMIGYLFLNRK.. 305
207 0.000e+00UniRef50_F2LTM0 Agmatinase n=7 Tax=Desulfurellaceae TaxID=117942 RepID=F2LTM0_HIPMA  ali  43  9...EIKKTKTVLVGVPYDGTSTYRPGSRFAPQAIREASYGIESYSPYQDKDLRDIRFYDIGDIPLSYGDKELNLKLIEAFIIKLIMKGKKTLALGGEHLITYPLIKAYAKKYKEFAIVQLDAHSDLIDSYRGESLSHATVMRRCSEIVGFENLYQLGIRSMVEED----KLLPHRDVNMGLFDLAEEFLKRIGDKPIYLTVDLDVLDPSIFPGTGTPEPGGITYKEILSFLKLL--RQKKIIGADVVELSPHYDPTGVSSVVAASIVREILLIM....... 275
208 0.000e+00UniRef50_A0A2H6EN77 N(1)-aminopropylagmatine ureohydrolase n=17 Tax=Bacteria TaxID=2 RepID=A0A2H6EN77_9BACT  ali  32  19..TSFNNSKIVILSVPLEKTVSYGKGTAKGPREILKASHFVEFYDEELGKELFSKGICTLKPLDFENQRIETALQKIYKTVKFLINENKFVVTLGGEHSLSISPIKAYLEAYTNLSVLQIDAHSDLRDTYENSKHSHACVMARVAEL--TKNIVQVGIRAQSKEEAEFVKKNKINTFYARDIDWQKKAVSKLK-KNVYITFDLDGFDPSLLPATGTPEPGGLFWNETMSLLK-LVGKEKNIVGFDVVELAPSK-YHPASNFVAAKLVYKILNYAFM..... 295
209 0.000e+00UniRef50_A0A1V2MY25 Guanidinobutyrase n=1352 Tax=root TaxID=1 RepID=A0A1V2MY25_9ACTN  ali  28  38........DVAVVGVPFDSGVSYRPGARFGGNAIREASRLLRPYNPAQDASPFALQVADAGDIAANPFNINEAVETVEAAADDLLNTGARLMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGDTSALSHVGTRGPDDEKMGFGIVTSADVMRRGVDEIADQLRQRIGDRPLYISIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGL--SSCHLVSADLVEVAPAYDHAEITSVAASHTAYELTTIMSRQ.... 315
210 0.000e+00UniRef50_A0A1Y5PFU5 Guanidinobutyrase n=57 Tax=Bacteria TaxID=2 RepID=A0A1Y5PFU5_9MYCO  ali  29  43......GADVRIVGVPFDSGVSYRPGARFGPSHVRAASKLLRPFNPALGVAPFAAQVADCGDIAVNPFNIDEAIAAIDTAMTDLRKDGSTVLTIGGDHTIALPILRSLARDHGRVAVLHFDAHLDTWDTYFGSPYTHGTPFRRASELIDMERSLHMGIRGYSKTDLEFQVIRSDDYEFDGVASIVERMRKRLDGGPVYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLV--GLDIVGADIVEVAPAYDHAEITGIAAAHVGFELLSVLAANR... 323
211 0.000e+00UniRef50_A0A1Q7L3V1 Agmatinase n=22 Tax=Bacteria TaxID=2 RepID=A0A1Q7L3V1_9BACT  ali  31  37..TEPRELEVALIGVSFDGGTTYRPGPRFGPRHIREQSAIIRPWNPVLKVNPFKHRTADFGDLSVNPLSIEDTFGRIERGIRPLLDAGVRCVCVGGDHSISLPILRAVAKKHGAVSLIQFDAHNDLWDEYFGSKYSHGTPFRRAFELLQDGDVLQVGLRGYGEEDFDFARVHKVRMVTAEEFHEMATVRSHLRAKPVYVTLDIDVVDPAFAPGTGTPQVGGLTSVQILELVRAL--RGLNIVGCDLVEVSPPYDNGEITSLLAANLLFELLCVL....... 316
212 0.000e+00UniRef50_A0A2M7UXG6 Agmatinase n=3 Tax=Bacteria TaxID=2 RepID=A0A2M7UXG6_9BACT  ali  34  22...NYKSSKVVIVPVPYESTTYYLSGTKEGPWAIIDASRHMELYDIEKDTNASKVGIFTLEELEPSKNSPKETVLRVENVVAKILEDGKFPFTLGGEHSVTLGAVSAFKKKFHNLSVLQMDAHTDLRNEFEGTKFHHGCVMRRIVDDLKLS-VTQVGIRSTTEEEMIYIKESKKNSIFYGKQYEIEKVISTLK-ENVYLTFDLDALDPSIMPSVGTPEPGGLGWYESLDLLKAVAQS-RNIVGADVVELSPIPGLIAPD-FLAAKLVYKIISY........ 288
213 0.000e+00UniRef50_A0A1V5SX04 N(1)-aminopropylagmatine ureohydrolase n=1 Tax=bacterium ADurb.Bin270 TaxID=1866926 RepID=A0A1V5SX04_9BACT  ali  30  11.SPSYEESKVVVLPIPYEATVSYGKGTALGPAAILDASTQVELYDEQTGCEPYQIGVATLPPLDFSGISHERIGDLITPAVSKILADDKWPLLLGGEHSITPPVVKAVQKKFPDVTVVQFDAHADLRDSYEGSKMNHACAMARVREIVKDA--IQIGIRNLSEPEAKLAREKKYKIFYAHDRGWIKKALDSIKSEEVYITFDLDGFDSSLMPATGTPEPGGIGWYDAVDFMNELFAKKT-VVGMDIVELAPIANLHACD-FLAAKLGYKAIAYL....... 283
214 0.000e+00UniRef50_A0A265EG47 Agmatinase n=13 Tax=Bacillales TaxID=1385 RepID=A0A265EG47_MARHA  ali  38  17.SASYEDSSVVLYGMPMDWTVSFRPGSRFGPNRIRETSIGLEEYSPYLDKHLENYSYHDAGDMMLPFGNPAKSIEIIKETAGRFFADGKFPLGIGGEHLVTWPVMQAACVHDPSVAFIHIDAHTDLREDYEGEPLSHATPVRKICEKIGPENVYSYGVRSGEKEEFDYARTSGMHFSPFEVAEPLKRDLQELQGRSVYVSIDIDVLDPAHAPGTGTAEAGGITSKELLEAIHAIAASGVHVVGADIVEISPPYDSGDQTAIVAGKCIREMLLGWTK..... 291
215 0.000e+00UniRef50_Q1I7X5 Agmatinase n=507 Tax=root TaxID=1 RepID=Q1I7X5_PSEE4  ali  28  37.SRDLRGVDVVVSGVPFDTATSNRPGARFGPRAIRTASVQQAWRHWPWAFDPFDLAVIDYGDCAFDNGTPESVPDSIQAHAERILDAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEEGKRIDHGTMFWHAAGLVDPAHSVQIGLRTTNDDSQGFAILDARQVHRQGTEAIVAAIRQRVGERPVYLTFDIDCLDPAYAPGTGTPVCGGLSTLQALEILGGL--RGINLVGMDLVEVAPAYDHADITALAGATLAMEMLCLYAARHK.. 316
216 0.000e+00UniRef50_A0A2N2DFA7 Agmatinase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A2N2DFA7_9FIRM  ali  38  7....YESADTVIVGVPMDFTASYRPGSRFAPQAVRNVSYVLEEYSFYLDRDLADYRFYDWGDINLPIGNVGESLNRINRVAARLFADGKFPVFIGGEHLISYPVISEACKKNPGLAVIQFDAHADLRSDYLGEGNSHATVMRKACEVIGSGNLYQFGIRSGTREELEYAK-TNTNLYTDAVLEPLMEVAKTLAGRPVYVTVDIDVADPAFAPGTGTPEPGGISSRELISAVHAL--RDLDIIGMDVVEIIPSIDPSERTAVLGAKIIREAILGFTKR.... 276
217 0.000e+00UniRef50_A0A1M4E2P9 Agmatinase n=27 Tax=Bacteria TaxID=2 RepID=A0A1M4E2P9_9ACTN  ali  28  30.....ERADVAVVGVPFDTGVSYRPGARFGPAAVREASRLLRPYHPGLDVSPFEAQVADAGDIAVNPFDIGAAIETIEGAADDL---DARLVTIGGDHTIALPLLRSAARKHGPVALVHFDAHLDTWDTYFGAEYTHGTPFRRAVELLDTEALSHVGIRGYGKKDLEEDRRLGFGIVTAGLDEVIDLLRQRVGERPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLA--GLNLIGADVVEVAPAYDHAEITSIAASHVAYDLVSLLALQEK.. 309
218 0.000e+00UniRef50_A0A257WCW3 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A257WCW3_9BACT  ali  26  17.ATSPTGADVAILGIPYDSSTSNRSGTRFGPRAIREQSLLLWGYNNAQQVAPFELKLVDLGDADVIPVDILATHRAIESAAKRVIDQPATLITLGGDHSISLPLLRAHHAKYGPLAVVHFDAHPDTWDEYPGHKYSHGTPFVRALELIDRDAYVQIGIRGPTPQDYLDALNLGARMITRDVADILAELQGRIGSRSTYVSLDIDCVDPAFAPGTGTPEVGGLTSYEILQLVRGL--KSLNCVGFDLVEVSPPYDHAGITAILAANLAFEFLSLVALQHRR. 305
219 0.000e+00UniRef50_U5MR00 Agmatinase SpeB n=85 Tax=Bacteria TaxID=2 RepID=U5MR00_CLOSA  ali  53  14...EYDEAKMVIFGAPFDSTTSFRPGTRFASKAMRSESFGIETYSIYQNKDLEDMSIFDGGDLELPFGNPQKALDQIEEFASEIINDDKVPCMIGGEHLVTLGSVRAVAKKYPDLHIIHFDAHADLRDSYLGETLSHASVMHRVWDIVGDNKIFQFGIRSGDREEIYWGKDH---VYTSKNFTGLEEVIEKLKGKPVYFTIDLDVLDPSVFPGTGTPEAGGVTFMQLLGAI--LKVSKLNIVGMDVNELSPIYDQSGSSTALACKVLRELL.......... 277
220 0.000e+00UniRef50_A0A2P2BYP6 Guanidinobutyrase n=6 Tax=root TaxID=1 RepID=A0A2P2BYP6_9ZZZZ  ali  28  31..TDVPRADVAVLGVPFDSGVSFRPGARFGPGAVRAGSKLLRPYHPHLDVEPWSLQVADAGDAAVNPFDLDEAIRQIEAAAEATYEHADRLIAIGGDHTIALPLLRAAHRRHGPIAIVHFDAHLDTWDTYFGAPYTHGTPFRRASEEGLLDHASHVGTRGYSRTDLEDDRKLGFDLARRGVDEAIDRIRERVGNHPVYLSIDIDVLDPAHAPGTGTPEPGGLTTRELQMILRGL--TDLEIVGADVVEVAPAYDHAELTTIAAANVVYEYLALFALQAEAG 318
221 0.000e+00UniRef50_A0A0U5ARI7 Agmatinase n=52 Tax=Firmicutes TaxID=1239 RepID=A0A0U5ARI7_9BACL  ali  39  18..STYEDAKAVIYGMPMDWTTSFRPGTRFGPTRIREVSINLETYSPYADRELEEIAFFDAGDIPLPFGSAQRSLDAIEEYVRKVVADGKFPIGLGGEHLVSLAPIKVMAEKYPDLVIVHIDAHTDLRHEMEGEELSHSAIIRRALDYVKPENVYQFGIRSGLKEEFQFAKEN-MHLNKFKVIEPLKACLEELKGRPVYVTYDIDAVDPAYAPGTGTAEPGGISAADAIESIYLL--SELNVVGFDLVEVSPVLDQSERTQILASKMIREVLLTMIK..... 288
222 0.000e+00UniRef50_Q9I3S3 Guanidinobutyrase n=1979 Tax=root TaxID=1 RepID=GBUA_PSEAE  ali  28  32.PAELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFGEKIAHGTTFRRAVELLDCDRVVQIGLRGYTAEDFNWSRKQGFRVVQAEECWLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRG--CQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVL....... 313
223 0.000e+00UniRef50_A0A2H9Q9M0 Agmatinase n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9Q9M0_9ARCH  ali  31  14LETDFKKSKYVILPVPYDGTASYRSGAREGPFEIINASRNLETYDSEFG-DVSNL-IYTLPELQPNLNSVEEMMLRIEETALDQLTQGKYLITLGGEHSITYGVLRAFRKCYPKLSVLHIDAHADLREDYEGSRLNHACVMKRSHARELYPDTVSVGVRSVCEEEAKCISSEKLDVYPMDIESRFDEIVSKLG-KNVYLTFDIDALDPSIMPATGTPEPGGLLWYQALRLLRKVFEKK-NVVGFDLMELCPIPGMHAP-NFTAAKLLYKMIGYHSKFSKK. 290
224 0.000e+00UniRef50_UPI0004AF33E4 agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=UPI0004AF33E4  ali  27  18...SAEGLDVAFVGVPLDIGTSNRPGARFGPRAIRAESPLLRPCNLGTGDSPFKLRVADLGDVAVNPYNLQDSVMRIERYYEALLAHGCIPVTLGGDHTIALPILRAMARRHGPVALVHVDAHADVNDEMFGEKIAHGTPFRRAVEEGLCDKVFQIGLRGYTPDEFDWGASMGFHVIPAPMDDVVARIRAQVGDHPLYISFDIDGLDPAYAPGTGTPEIAGLSSVQALQLIRGCA--GMNIVGADVVEVSPPFDCGGMTALTAANLAFELLCAV....... 297
225 0.000e+00UniRef50_A0A2H0SIE7 Agmatinase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H0SIE7_9BACT  ali  31  12.NQSYKKAKVVVLPISLEKTVSYMPGTKFGPRAIINASRYIELFDIEMGRDLSQIGIFTLPELLFAKKSLEESIKEIKQAALNLLKDKKFILSLGGEHTISYGLISAFKEKYKDFSVLQIDAHSDLRDEYEGTKFSHACVMRRVRDLGI--SVTGVGIRSQDETEIGYMKKKKIKTIFYAPMIPLKKIISSL-SKNVYITFDVDGLDPSIMPSTGTPEPGGLGWYEVLSLIKQVAKE-RKIVGADIVELSPLKGIIFPD-FLAAKLAYKIIGY........ 278
226 0.000e+00UniRef50_A6NUU0 Agmatinase n=16 Tax=Bacteria TaxID=2 RepID=A6NUU0_9FIRM  ali  50  14..CPFEQAETVLFGAPFDSTTSNRPGTRFGPSALRRESYGLELYSPYQDKDLSDCAVLDSGDLELSMGSSELALADIEARAEEILSAGKRPFLIGGEHLVTLGAFRAVHRKYPDVAIIHFDAHTDLREDYLGVPLSHACVIRRCWELTGDGKIFQFGIRSGDREEWRWGRDH-VTCHPF-DLEGLEDVVERLGDAPVYFTVDLDVMDPSVFPGTGTPEPGGVSFDALRRAA-TLVCSRCNVVGCDVNELCPPFDQSGVSNAVAAKVVREMLLALS...... 283
227 0.000e+00UniRef50_W4FKT9 Agmatinase n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=W4FKT9_9STRA  ali  27  165.......CDVAILGLPYDSGCTYRPGARFGPSAVRQASRILRPYHTTLKVNFHDQQCVDAGDVCCNPFNVTETMTTVVDHVSELLQLPSRPVAVGGDHSISYPLLKAHCEAYGPVALVHFDAHLDTWDAYFGETHTHGTPFLRAAELFRPDASMHVGIRGPVYSSDDYARDNMDAIEDMGVAGVVKQIRDRVGQHPIYLSIDIDVLDPAFAPGTGTPEAGGLSTRELFGMLRGL--RGLNVVGADVMEVAPAYDHAEITALAAASIVFELISLMA...... 443
228 0.000e+00UniRef50_A0A1C3JG26 Guanidinobutyrase n=45 Tax=root TaxID=1 RepID=A0A1C3JG26_9VIBR  ali  26  25...DLQDVDIALVGVPFDGGVTNRTGTRHGPREIRNQSSLMRIINQATGVAPFELRVADVGDVPDSPFELVKAHQSIELFFKQIKASGALPIAAGGDHSISLPILRALAQ-DGPVALIHFDAHCDTGDNYFGSKFHHGSPFKIAVELIDPKRTIQIGIRGNDKDMWRFSHETGMRVLYMGVEGILQQIKQTIGDTPAYVTFDVDCLDPAFAPGTGTPEVGGFTSIEALQLIRGL--QDVNVIGADVVEVSPPFDPTGNTALVGATIMFELLCIAAQSRQR. 310
229 0.000e+00UniRef50_A0A2I0QP90 Agmatinase n=8 Tax=root TaxID=1 RepID=A0A2I0QP90_9EURY  ali  38  9.NSEKEDADVCIFGMPFDSTTSFKPGTRLGPRAIRDASYNLEFYSMALERNIRDIKIFDAGD-TGFYTNPQHAISEISEQTRELLKSDKFIVGLGGEHTVSYGIAHAMKEIYKDVAVIQFDAHADLRTVYDFEKFSHACVMNLIGNDIGFENIYQFGIRSGEEEELKFAEKTNFFPLHKYDTAQILEILDELNDKKVYLTIDIDVLDPAYAPGVGTPEPGGITSNEMFKILNSL--KKFDIVGFDVVEVNPMVDMSGITAMLAAKIIREGI.......... 276
230 0.000e+00UniRef50_A0A0D6GSR1 Agmatinase n=182 Tax=cellular organisms TaxID=131567 RepID=A0A0D6GSR1_MYCSM  ali  31  44........DIAVVGVPFDSGVTYRPGARFGPSAIREASRLLKPYHPALDVSPFQAQVVDAGDLGVNPFNIDEAVGQIRDGVTELLDRDQRVVLLGGDHTIALPALQAMHAIHGPVALVHFDAHLDTWDTYFGAPCTHGTPFRRASELGLIGHSAHVGIRGLDDESLGFTVVHCRDIDRIGVDGVISRIHERVGEYPVYVSIDIDVLDPAFAPGTGTPEIGGMTSRELVAVLR--AMRGLNIVGADIVEVAPAYDSGDVTAVAAANLAYELITLMA...... 320
231 0.000e+00UniRef50_A0A1E8Q752 Agmatinase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1E8Q752_9MYCO  ali  25  29.REDVPRCDVAVVGIPFDTGVTYRPGARFGPSHIRQASRLLRPYNPELRVSPFHQQVVDAGDMVANPFDIGVAVDQIDAQATELIDAGAKLVTMGGDHTIAYPLLRAHRRRYGPVALLHFDAHLDTWDTYFDTPVTHGTPFRRAAEEGLPGHSAHVGIRGYSPADLDDDAGMGFTVVHCAEDAVIERLRAQVGDRPLYVSVDIDVLDPAHAPATGTPEAGGMTSRELLAILRGL--DGTNLVGADVVEVSPAYDHAEITGVAAANLVYEFVSLLAR..... 312
232 0.000e+00UniRef50_Q57757 Uncharacterized protein MJ0309 n=20 Tax=cellular organisms TaxID=131567 RepID=Y309_METJA  ali  43  15.NCPYEEAEGVIFSIPYDETTSFKPGAREGGNAIRTASWGLETYSPILDRDLAELKYCDLKDLDL-YGSQEEIFGTIHSVSREILKENKKIIVFGGEHSITYPIIKAVKDIYDDFIVIQFDAHCDLRDEYLGNKLSHACVMRRVYEL--TKNIFQFGIRSGDKEEWDLARKNNL-YLKMDNKDDLEYIKSL--DKPIYVTIDIDVLDPAYAPGTGTPEPCGFSTRELFNSLYLLEEVKDKIIGFDIVEVSPIYDIANITAITAAKIARELMLMI....... 283
233 0.000e+00UniRef50_E1BLC0 Agmatinase n=53 Tax=root TaxID=1 RepID=E1BLC0_BOVIN  ali  29  75..ATPEGLDAAFVGVPLDIGTSNRPGARFGPRRIREESVLLRTTNPSTGAVPFQLRVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDHTITYPILQAIAEKHGPVGLVHVDAHMDMADKALGEKLYHGTPFRRCVGLLDCKRVVQIGIRGSSTDTYRYSRSQGFRVVLAEDCWLMGEVRQQMGGRPIYISFDIDGLDPAYAPGTGTPEIAGLTPSQALEIIRG--CQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFEMLCVL....... 355
234 0.000e+00UniRef50_A0A2H5Z7S5 Guanidinobutyrase n=5 Tax=Bacteria TaxID=2 RepID=A0A2H5Z7S5_9BACT  ali  30  39.SRSLDRVDVAIVGIPFDTGVTYRPGARFGPAAVREHSSRIEQYHPVLGVDLAELSVIDYGDLPVVAGYTERSFQLIEEGIGSLVESGVIPIGIGGDHSISLPELRAVARRYGPVALVHFDSHVDTWDTIWETKYNHGTPFRRAVELVDPGRSIQIGIRGGGQDELDQSRELGFEVWTAREVRRAEAIHRRVGASPVFLSFDIDFLDPVFAPGTGTPEVGGFATWEAQELLWGLV--GLDIVAADLVEVLPDRDPADVTALNAANLIFDMVAVIAATRRE. 326
235 0.000e+00UniRef50_Q90XD2 Agmatinase, mitochondrial n=34 Tax=Euteleostomi TaxID=117571 RepID=SPEB_CHICK  ali  29  54..TSAEGLDAAFVGVPLDTGTSNRPGARFGPQQIRAESVMVRRYNASTGAAPFDLLVADVGDVNVNLYNLPDSCRRIRESYQKIVASGCVPLTLGGDHSITYPILQAVAEKHGPVGLVHVDAHTDTSDMALGEKIYHGTPFRRCVGLLDCSRVVQIGIRGSSPNPYKYCWDQGFRVVPAEECWLMGEVRQQMGDGPVYISFDIDGLDPAYAPGTGTPEIAGLTPMQALEIIRG--CKGLNIVGCDLVEVAPIYDVSGNTALLGANLLFEMLCVL....... 334
236 0.000e+00UniRef50_A0A2H5V381 Guanidinobutyrase n=1 Tax=archaeon HR02 TaxID=2035438 RepID=A0A2H5V381_9ARCH  ali  29  34.TRDLEGVDALFIGIPFDGGVIFRSGARFGPASVRQASLLLRLYNPYLRVRPFDLNVADYGDIDTVPGNIEATYQSISRELGPIHARGITPLVCGGDHSITLPLLREASKVYGRLSLIHVDAHLDMVEQHFSQKYTHGTVFRRAYELIDPYKSVHVGVRGYSEDEISSVESLGFRVIEMGIEAVCSEIKRIAGGGPVYLSFDIDACDPSCAPGTGTPEVGGLTSREALKLLHGLAGLG--FVGFDLVEVAPPYDHGEITAYLAANIIYNFLCLKAFTKK.. 320
237 0.000e+00UniRef50_UPI0009FBD015 agmatinase n=1 Tax=Paracoccus sp. S4493 TaxID=579490 RepID=UPI0009FBD015  ali  30  32.TETAKGLDIGIFGVPFDGGTTNRPGARHGPREIRTASSMQRTYNLATGVEPYEINFGDIGDVPINPLDQHHSLIEIQSFCEEIIRENCLPIAVGGDHLVSLPLLRALGD--PSLGLIHLDAHSDTGDDFTQTKYSHGTPFRRAIELLDPQKIVQVGIRGNSSEELEWAVAQGITIIGMGVEGVSAMIREVVGNAPVYLTFDIDCFDPAFAPGTGTPEAGGLTSYEGLNLLRRM--RGLNFQGADLVEVCPPLDSSGITSILGATVLFEICCLLAESRQKG 319
238 0.000e+00UniRef50_D2AUK3 Guanidinobutyrase n=14 Tax=Actinobacteria TaxID=201174 RepID=D2AUK3_STRRD  ali  28  34.......CDVAVVGVPFDSGVSYRPGARFGPSAVREASRLLRPYHPGLDVSPFALQVADAGDIACNPFDIGEAVETIEHAAGELQDTGARLVTIGGDHTIALPLLRSLARRHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGDTEALSHVGTRGYGKKDLEDDRRLGFDVMRRGVDEVVDALRQRIGGRPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLA--GANLVGADVVEVAPAYDHAEITSVAASHVAYDLVSLLALS.... 312
239 0.000e+00UniRef50_A0A0K3AXM8 Agmatinase n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A0K3AXM8_9PSEU  ali  28  29.....DKADIAVVGVPFDTGVSYRPGARFAPAAVREASRLLRPYNPGLDVSPFEAQVVDAGDIVCNPFDIGKAITEISEQATELLDTGAKLVTVGGDHTIALPLLRSVAAKHGPVALLHFDAHLDTWDTYFGEPYTHGTPFRRAVEEGDTSALSHVGTRGPEDARLGFGIVTSADVLRRGVDEVIEALRARIGDRPLYVSIDIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLA--GLNLVSADVVEVAPAYDHADITSIAASHVAYDLVTLLSM..... 308
240 0.000e+00UniRef50_A0A151MJ81 Serine/threonine-protein kinase PINK1, mitochondrial n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151MJ81_ALLMI  ali  30  565..TSAEGLDAAFVGVPLDTGTSNRPGARFGPRHIRAESVMVRRYNPSTRAAPFHLMVADLGDVNVNLYNLQDSCRQIREAFRKIVATGCIPLVLGGDHTITYPILQAVSEKHGPVGLVHVDAHTDTGDKALGEKIYHGTPFRRCVGLLDCKRVVQIGIRSYSPDPCKYSRDQGFRVVLAEDCWLMGEVRKQMGDKPIYISFDIDGLDPAFAPGTGTPEIAGLTPAQALEIIRG--CKGLNIVGCDLVEVAPIYDASGNTALTAANLLFEMLCAL....... 845
241 0.000e+00UniRef50_A0A1I5U9U9 Agmatinase n=3 Tax=Caldicoprobacter TaxID=715222 RepID=A0A1I5U9U9_9FIRM  ali  44  27....YDESDVIMVGAPMDYSVSYRPGARFAPQKIREVSYAIEEYSPYVDRDLSEVRFFDVGDLELPMGNIVSSLEIIQQAAREVLEDGKKPIFLGGDHLITYPVVKEVYEKYGDLRLLHFDAHADLREEYLGERNSHASVIRLCSQFLPSKNIFQFGIRSGTREEFKWAGEN-LNFYPFEVLQPLKEVIDVLKPYPVYITLDIDVVDPAYACGTGTPEPGGCMPHEIFQAFR--AMKGLNIVGMDLVEVNPVYDTAGVTSILAAKIIREAMLII....... 294
242 0.000e+00UniRef50_L7ZQT6 Guanidinobutyrase n=104 Tax=Bacteria TaxID=2 RepID=L7ZQT6_9BACI  ali  30  32.....DNIDFAVIGVPFDTGGTFAVGTRFGPEAVRSMSSLLRPYNPGLQIDIFQYSGVDYGDLSVNPGYIEDSYEMIANQLEPLLNKNVVPILIGGDHSVSLPHLRAMAKRYGKVSLIQFDSHGDTWDSYFGKKYTHGTMFRRAVELVDPFSSVQIGMRGYSAEDLKDAEDLGYKVITTDQLRALEEIRKRVGKNPVFVSFDVDFLDPAYAPGTGTPEIGGFTTYEAQQFVRQL--KGLNLVGFDIVEVLPDRDPTRVTSLAAANIGFEFISLVAWNKRE. 315
243 0.000e+00UniRef50_A0A0U9HJ14 Agmatinase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A0U9HJ14_9THEO  ali  42  18..EDYDRAKIVIIGAPMDFTVSFRPGTRFGPERIRSVSYGLETYSVYADDALDDKSFCDIGDIELPFGNVKKSLDMIEEAANKILNDGKIPFFLGGEHLVTYPIVKKVAEKYPDLVVLHFDAHADLRDTFFGEKLSHATVLRRVSEQVKNKHIFQFGIRSGVKEEFLYAQQH-TNMYPLEVKTPFLQVLDSLKGKPVYITLDIDAVDPAFAPGTGTPEPGGCTS---CDILEVVASFGLNVVGIDLVEVSPASDLSDRTALLAAKIVRETIIGI....... 286
244 0.000e+00UniRef50_S0AEU1 Guanidinobutyrase Gbh n=530 Tax=root TaxID=1 RepID=S0AEU1_SERPL  ali  28  25VADDAQGLAAAFVGIPLDIGTSNRSGTRYGPRQIRQESVMLRPYNMGTGAPFERLQVADLGDIAINPYSLEDSVRRIELAYNGILSHGCVPLTLGGDHTLTLPILRAVARHHGPVGLIHVDAHSDTNEEMFGEKLAHGTTFRRAYELLEPQRVVQIGLRGYAADDFDWSRRQGFRVVPAEACWLMAEVRQQMGGAPVYLSFDIDGLDPAFAPGTGTPEVGGLSVWQGLEIVRG--CRGLNLIGADVVEVSPAYDRSGNTALLAANLLFEMLCVL....... 307
245 0.000e+00UniRef50_A0A254WWD7 Agmatinase n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WWD7_9CYAN  ali  25  70..CDPKKARYAILPLPYDGTVSYQTGTRNGPRAIITASQQVELFDEEYCKEFTAAGVMTCDPVAPEMAGPKEMHESVYQAARQVLAKKKFLIALGGEHSLTSGLVRAVKQKHKKLSVLQIDAHADLRAEYEGTPYSHAAVMRRVVEMGIP--VVAVGIRNYSLGEHQFMKKHGIKPVSVREVDWLQQVVERL-TDNVYVTIDIDGFDPAYAPGTGTPEPGGLDWFQVTDLLKATAMF-RNIVAADVVEVLPQPGTAQ-TEFLAAKLVYKLIAHIEANRRR. 346
246 0.000e+00UniRef50_A0A1D2R7S3 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon WOR_SM1_79 TaxID=1849365 RepID=A0A1D2R7S3_9EURY  ali  40  15....FEDAEICILGVPFDVTETYRRGARFGPGSIRESSLSVEEYSQGFGLDLGDLRIADLGDIE--AGDVKETLKGIEERISEIISKDKLPVVLGGEHLISLGAVRALKKKHEDLKIIQFDAHLDLRDEYEGERLSHSTVMRRIYDICN--DLYQIGIRSGSREEFDFAKEN-TRIYGADDIASISDVIEKIGDKPVYVSIDIDVLDPAYAPGTSNPEPCGISTRELMDAVHKIGKLG--VVGFDVVEVCPGYDKSEVTPITAAKIVREGILSFF...... 279
247 0.000e+00UniRef50_A0A0F2NG66 Agmatinase n=1 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2NG66_9FIRM  ali  42  13.SDDYQKSRAVILGAPMDQTVSFRSGTRNGPRQIRSVSEVLEEYSPSLDRDLAEFAYTDLGDVLIVPGKLEENLERIAKSADKVFRDGKLLIMLGGEHLVTLPAVKCAASLHSELSVIHFDAHADLREQYLGMSLSHATVMRRISEVIGGDKIFQFGIRSGTREEFAYARANTNIYPELNTENIV-RVAQDLKGRPVYISLDIDVLDPAYAPGTGTPEPCGCSPDQLFSALEAL--SGLNVVGFDLMEVCPPYDQSERTAITAAKLVREAILLFSDK.... 285
248 0.000e+00UniRef50_A0A2H5YY37 Guanidinobutyrase n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5YY37_9BACT  ali  30  28.TTELEGVDIAVVGLPFDTGVTYRPGARFGPAAIREQSSRIECYHPVLDIDVTDVSVIDFGDAPVVPMETETSYASITATLQPLAARGIVPIGLGGDHSVSLPELRAVATRYGPVALVHFDAHVDTWDTIWGNRYNHGTPFRRAVELIDPERSIQIGIRGPERAELEQSRELGFEVWTARVSQVLGAIWRRVGTHPVFLSFDIDFLDPVFAPGTGTPEIGGFTTWEAQEFLWGLV--GLRIVGADLVEVLPDRDPSGVTALIAANLVFDIIAVIAASRRE. 315
249 0.000e+00UniRef50_K4LDU9 Agmatinase SpeB n=16 Tax=Bacteria TaxID=2 RepID=K4LDU9_THEPS  ali  41  18...SYKEARLVLAGLPLELTVSFRPGTREGPQAIRAASQGLEEYSPYLREDLNDHLIFDCGDLALPFGNLQVAFQRIEALCRVLLADAKIPVFLGGEHLITFPVVKTLAEAYSGLKVLHFDAHADLCDDYLGEKYSHATVIRRVCEIVGAGNVYQFGIRSGTKEEFEYGRSCTV-FYPFEILPGLESCLQSLEGHPVYVTVDIDVIDPAYAPGTGTPEPGGVTPQELFRVFELL--EGCRIVGCDFVELAPVYDRSGITSLLAAKLVREALLAFSR..... 287
250 0.000e+00UniRef50_Q9K6B9 Agmatinase n=96 Tax=Bacteria TaxID=2 RepID=SPEB_BACHD  ali  39  16.RSNYEKSKAVIFGMPMDWTVSFRPSSRFGPNRIREASLGLEEYSPYMDKHLEEVAYFDAGDMLLPFGNPQRSLEMIESYVDKLLADQKMPIGLGGEHLVSWPIFKAMHKIYPDMAIIHIDAHADLREEYEGEPLSHSTPIRKACSLIGPENVYSFGIRSGMREEFQYAKDSGMYMAKFEVATPLKEVLPKLAGRNVYVTIDIDVLDPAFAPGTGTAEAGGISSKELLEAIVAIAHSDVNVIGADLVEVAPAYDPSEKTPIAASKFVREMLLGWV...... 289
251 0.000e+00UniRef50_A0A069RBJ7 Guanidinobutyrase Gbh n=12 Tax=Bacteria TaxID=2 RepID=A0A069RBJ7_PEPLI  ali  28  29..TELEGLDFAVVGVPFDTASSYRTGSRFGPSAIRNISSLIKPNNVNLQVNLESLKGADCGDVNVVPGWIHETFENIENELKPILDADVIPIILGGDHSISLANLRAIAKKHGPVAMVHFDSHADINDKVFGMPHNHGTPFRRAHELIDPDHVIQIGMRGVAEEELGFRLIAAHKVREMGIEGLIKEIKDRVGDKKVFLTFDIDFVDPAYCPGTGTPEVGGFTTLETLTILREL--KDLNFVGCDIVEVAPQYDPSEMTAFMAANVAFEFISMLAAKKNK. 316
252 0.000e+00UniRef50_Q5WB32 Agmatinase n=349 Tax=Bacteria TaxID=2 RepID=Q5WB32_BACSK  ali  38  16.RASYEEADAVIYGMPMDWTVSFRPGSRFGPARIREASLGLEEYSPYADKHLEEINYFDAGDIPLPFGNAARSLDIVEEYVDSLLADGKFPLGLGGEHLLSWPIFKAMYRKYPDLAIIHIDAHADLREQYEGEALSHSTPIRKACELIGAENVYSFGIRSGMREEFAYAKEAGMHLYKFDVAEPLKNVLPHLSGRPVYITIDIDVLDPAHAPGTGTAEAGGITSKELLEAQMLLSQADIQIVGADLVEVAPAYDPTEQTAIAASKFVREMLLGWVHKR... 292
253 0.000e+00UniRef50_A0A267MM19 Agmatinase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A267MM19_9CLOT  ali  30  30.ATNLEELDFAVVGVPFDTASSFRTGSRFGPGAIRNISALIKPNNVHLEVNLDSLKGADYGDLNIVPGYIEKSFENIEEGLQPLLDANVIPIILGGDHSISLPHLRAIAKKHGPVALVHFDSHADINDTVFGEKHNHGTPFRRAFELIDPDHVIQVGMRGIAEEELGFRLIAAHKIREMGIDNLIEEIKDRVGDKKVFLTFDIDFVDPAYAPGTGTPEVGGFTSHETLTIVRAL--KDLNFVGCDIVEVAPQYDPTEMTAFMAANVAFEFISMLATKKK.. 317
254 0.000e+00UniRef50_A0A0D0HQ65 Agmatinase n=4 Tax=Anoxybacillus TaxID=150247 RepID=A0A0D0HQ65_9BACI  ali  30  27.SRDIKNYDVAIIGVPYDGGTSYRPGTRFGPREIRSHSSLIRGYSYYSKSDLFRLRIADYGDIDASPYNIELTYKLIEDTIESILNENVFPVVIGGDHSISLGILRAVAKKYGPVGLVQFDAHSDTYDGVYGTEYHHGTPFKRAIELIDPSRSLQIGIRGVSSTDLDYALQSGMKILMMDDIDVIKNI-EGLGKEPVYVSLDIDAVDPAFAPGTGTPVPGGFDSREIIQLVRSL--KPLNVVGFDLVEVSPPYDNNGITSLLASNLIYEFLNTVSLEKK.. 312
255 0.000e+00UniRef50_P70999 Agmatinase n=355 Tax=Bacteria TaxID=2 RepID=SPEB_BACSU  ali  40  20.....EEADAILYGMPMDWTVSYRPGSRFGPSRIREVSIGLEEYSPYLDRDLADLNFFDAGDIPLPFGNPQRSLDMIEEYVDSILEKGKFPMGMGGEHLVSWPVIKAMYKKYPDLAIIHFDAHTDLRVDYEGEPLSHSTPIRKAAELIGPHNVYSFGIRSGMKEEFEWAKENGMHISKFEVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLASVHEIARSEVNVKGADLVEVAPVYDHSEQTANTASKIIREMLLGFVK..... 290
256 0.000e+00UniRef50_K4Z987 Agmatinase SpeB n=58 Tax=Firmicutes TaxID=1239 RepID=K4Z987_PAEAL  ali  40  16.SDDYEGAKAVIYGMPMDYTVSFRPGSRFGPGRIREASVGLEEYSPYLDRSIEELNYFDAGDLLLPFGNAAKSLDIIGEFVGKLLSDGKFPIGLGGEHLVTWPVLQEVYKKYPDLAIIHIDAHADLREQYEGEPLSHSTPIRKAAEMIGGKNVYQFGIRSGSREEWTYAREN-INFFPFDVAEPLKKVLPELAGRPVYVTIDIDVLDPSCAPGTGTAEAGGITSKELLEAVHSIARSDANVIGCDLVEVAPIYDPTEQTPITASKIIREMLLGFVK..... 289
257 0.000e+00UniRef50_Q81JT1 Agmatinase n=646 Tax=cellular organisms TaxID=131567 RepID=SPEB_BACAN  ali  41  18...SFEESEVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSPYLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDAGKFPLGLGGEHLVSWPIFKAMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEFEWAKEVGMNLYKFDVLEPLKEVLPKLEGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKELLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK..... 290
258 0.000e+00UniRef50_A0A160F3E1 Agmatinase n=23 Tax=Bacillaceae TaxID=186817 RepID=A0A160F3E1_9BACI  ali  39  18...NFEESEAVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSPYLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEFVDRILTAGKFPLGLGGEHLVSWPVMKAVYKKYPDLAIIHMDAHTDLREHYEGEPLSHSTPIRKIAELIGPKNVYSFGIRSGMKEEFEWAKQNGMYIAKFEVLEPLKEVLPTLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLAAIHEIARSDVHVVGADLVEVAPVYDHSEQTANTASKLVREMLLGWVQKRK.. 293
259 2.000e-98UniRef50_UPI0005D25114 agmatinase, mitochondrial n=1 Tax=Takifugu rubripes TaxID=31033 RepID=UPI0005D25114  ali  26  71.RETADGLDAAFVGVPIDTGTSNRPGARFGPRQIRVESAMLRAYNSGTRAAPYQIRVADIGDVNVNLYDLQDTCRRIRDAYRTILAAGCTPLTLGGDHTIAYPILQAVAERHGPVGLVHVDAHADTSDLLLGEKIAHGTPFRRCMELLDRERVVQIGLRGYSADAYEWSRAQGFRVVPVEECWLMAEVRSQMGAGPVYLSFDIDALDPGFAPGTGTPEIAGLTPIQGVEIIRG--CRGLSLVGCDLVEVSPAYDT---TVPAAAR................ 340
260 2.000e-98UniRef50_A0A1G3BVS7 Agmatinase n=3 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3BVS7_9BACT  ali  27  17....YKRSKVIIMGVPFDGTATYQTGTKMGPNAILNASVNIEPYDEELG-EIYTLGIFTVGNIEEIHTVPEKVIETVYRTSKEIVKDGKFLVTLGGEHSISQGIIRAYKEKYKRLSILQLDAHLDLMEQFGGTRCSHASVSRRVVEDLKCK-VTSFGVRVVSREEQNFVKKNAISVFYARDIHWHEEAIDTL-DDYVYITLDVDGLDPSIMPATGTPVPGGLGWYRTVDFLRKVYE-NRKVVGLDLVELKPNPG-NESPNFLSANLVYKNIGFYKK..... 291
261 2.000e-98UniRef50_Q10088 Putative agmatinase 1 n=319 Tax=Eukaryota TaxID=2759 RepID=SPEB1_SCHPO  ali  28  67LNDKSQSFDIAFLGAPFDTGTSYRPGARFGPSGIREGSRRLNLYNVPMETNPFWAKIVDCGDIPLTSYDNAVAIKQIENGHFELLTRKPRVITLGGDHTIVLPILRSVSRAYGPVSIIHFDSHLDSWKPFGGGKINHGTYFYHASQEGLVSNNIHAGIRTTNDADCGFEIIEAREIDTIGIDAIIKRIRDRVGDGIAYLSIDIDVLDPAYAPATGTPESAGWTTRELRTILRGL--DGIKLVGADIVEVAPAYDFAEVTTLAAADILFEVMSIMVK..... 379
262 2.000e-98UniRef50_A0A1Y5TLV9 Agmatinase n=13 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5TLV9_9RHOB  ali  24  42.TKDLSGVDLAVTGVPFDQAVTNRPGTRLGPRAIREAST-LQAFDAPYGWPLEEFDVIDYGDLAFDYAKVADFPQALTDHIAPILAAGAGTLVLGGDHFISFPVLRAHAAKFGPLSLIHFDAHSDTWADDDMTRIDHGTMFYKALGLIDPARSVQIGIRTDNPDTLGVNIIDARAVHERGASWVASRVKNIVGNHPAYLTFDIDCLDPAFAPGTGTPVWGGLASWQAAAILRELA--GVHLTGGDVVEVSPPYDVGNATAVAGAHVAMEILALYCWTRR.. 321
263 2.000e-98UniRef50_A0A2M7JXP8 Agmatinase (Fragment) n=5 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7JXP8_9DELT  ali  42  2...............PYDGSASFRPGARFGPSAIRRASWGIETFSPYFQRDLGQCPIHDMGDLELPLGEKKTSLNLIRKALGNILSEKKFPILLGGDHLITLPIIEEILQIYPRLHLIQIDAHTDLREDYLGESLSHSTVMRRILDHLGEDRLFQIGVRSGIEEEFKLAGKMKSIVFL--DPGSLSSMIRRLRNQPVYITLDLDVIDPSLLPGVGTPEPGGLTFQEFISLLKKL--QALHVIGFDIVELTPDYDPTQVSSVTASVILREMI.......... 253
264 3.000e-98UniRef50_A0A060T991 ARAD1C42174p n=8 Tax=Saccharomycetales TaxID=4892 RepID=A0A060T991_BLAAD  ali  27  50.....ESFDIGVIGVPFDTAVSYRPGARFGPRAIRAASMRLRGFNARAGINPYWAKIIDCMDMPVTPVDNKIALTQMTAGYKELLKRPPRLITLGGDHSIVLPALRAYHEVYGPITVIHFDAHLDTWSAWGDTEFTHGSMFWMAAGLLDKDHCVHAGLRTRSDDQSGFARIGSDEI--MGDVGVVSKILDRVKDVPVYISVDIDVIDPGMAPGTGTPEAGGWLTRELIQVIRGL--SGLNIIGADVVEVSPAYDHAEITALAGAQIAYELITSMVQ..... 352
265 3.000e-98UniRef50_H1WBS9 Agmatinase (Agmatine ureohydrolase) n=51 Tax=Cyanobacteria TaxID=1117 RepID=H1WBS9_9CYAN  ali  27  26........KVAILPIPFEATTTYRKGCENGPGAILEASQQLECYDDELEAEIGLIGIYTHEAIADTRESLEEMLRVTTETVKSLADQGKFVIALGGEHGITAGVVEAYRQSSEPFTVVQIDAHGDLRHEYEGSIYNHACVMRRVVEMGLPT--VQIGIRSICKAEADLIRDQEMKVIWGREIDWIQKAIASIPTKRVFLTIDLDGIDPSIIPGVGTPEPGGLSWYDLIAFLRQLFIS-QEVIGCDVMELAPVVD-SVVSEFTAAKLVYKLVGYQALAK... 301
266 3.000e-98UniRef50_C0RIC4 Agmatinase n=613 Tax=root TaxID=1 RepID=C0RIC4_BRUMB  ali  26  36.SKSLKGAEAVVWGIPFDAAVSNRPGARFGPQAIRRASAIFD-NDPQYPFEFENLAVIDYGDCLLNYGNHTKTPSTIEREAAKILKSDAFLLTLGGDHFITWPLLKAHAAKYGPLALVQFDAHQDTW-FDDGRRIDHGSFVARTAGIIDPDLSIQIGIRTHAPEDCGIRIIYGHEVEDMPAAAIADAILKRTNGRKAYLTFDIDCLDPAFAPGTGTPVAGGPSSAKMLSVLRKLTA--LDFVGADVVEVAPAYDHADITAIAGATIAMYYLGLLGERKER. 315
267 3.000e-98UniRef50_A0A1I6L0D8 Agmatinase n=2 Tax=[Clostridium] populeti TaxID=37658 RepID=A0A1I6L0D8_9FIRM  ali  30  33.....DNPDIIVIGIPFDDTSSYRSGSRFGPREIRNASTCLKKYNRCLDVDIFADSIVDYGDIPVIPGYIEKSYTLISECIKKVVHDNAIPISIGGDHGIILPELRGLKEKHGKLSVISFDAHRDCSKSHFGELYGHGTTLRRAIELIEPSTSVILGVRGYSPNDYKIAQDLSFNLIDMEPKDIVKTIRETVGKNKCILTFDMDCVDPAYAPAINTPEIGGFTSRECLYMIRNL--TGINIVAADLVEVNPQYDSGGITNFLAASILFEIISVIVKNLK.. 316
268 4.000e-98UniRef50_Q1Q5Q5 Similar to arginase n=17 Tax=Planctomycetes TaxID=203682 RepID=Q1Q5Q5_KUEST  ali  30  29....YNKSKVILFGVPYDGTVSYQSGTKKGPNAILDASVNIEPYDDELG-NIFKIGIFTVGNLNIEEFNEKKVMEEIFTCSRKVIDDNKFLVTLGGEHSISQGAIKAYKNKYKKLSVLQLDAHLDLLNEFGGSKYNHASVMRRVVEDIGC-RVTSFGVRVTSQEELEFVKKNKVSVFYARNIYWHDEALKTLE-ENVYITLDVDGLDISIMPATGTPVPGGIGWYQTIDFLRKVYEKK-NVVGFDIVELKPNIG-NEAPNFLAANLVYKNIGFYKK..... 303
269 4.000e-98UniRef50_A0A1F9GW69 Agmatinase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_43_9 TaxID=1797867 RepID=A0A1F9GW69_9DELT  ali  29  24.......SRVAVLPIPFEKSVSYGGGASKGPDAIIQASGQVEWYDEEINAEACQVGIATAAPVVCKNITGEEAVKEIAKRTSKLISDGKFPVGLGGEHTVTAGCVMGMLKECKDFGVLQLDAHADLRDSYQGDRYSHASVMRRVREFGLP--IAAVGIRSLCQEEVEYIKREKIAVFYDRVVWPLEGVINAL-PKRVYITIDVDGFSPSVVPATGTPEPGGLPWYETLSFLKQIFAQK-DVIGLDVVELAPIEGLHFAD-FSMAKLIYKLIGY........ 288
270 5.000e-98UniRef50_T0YEH6 Agmatinase n=7 Tax=root TaxID=1 RepID=T0YEH6_9ZZZZ  ali  28  16.SASLKEAHYVILGVPFDRTTSFRPGARFGPDAIRQQSWNFEPYNFETGLDLSEVPVHDLGNAE-EFGSAEEMVRGVRELAKPLWEDGKFPIVFGGDHACAPPVVES-APRDASLGVLYLDAHLDFRESYLGDRRSHACSARRMVEHLGASRVVVLGVRSMSRDEKEDNDRLGMDIHRDGIRSVVTRALERLATDRVYITLDIDGIDPAYAPATGTPEPFGMTPLDVKTVIDLAA---PRLAGLDIMEVSPPWD-QGNTSSLAARLAREAILRVEGHRQ.. 293
271 5.000e-98UniRef50_A0A2H0ZCA8 Agmatinase n=17 Tax=Elusimicrobia TaxID=641853 RepID=A0A2H0ZCA8_9BACT  ali  28  16..STLEKAGFAIVPVPYEMTTSYGKGTKRGPDAIIKASPQVELWDEELKKETCRAGFFTTEPLKIISSE-KFFFSNIGETVDSLLRQRGVPVFLGGEHSVSQGLIPPFKKIHKNLSVLHFDAHADLRSEYEGTKHSHASALYPVSRE---TKTVQIGIRSVGSDEKQYVNKGKVKTFLMHENRLIKKVLKEL-TDAVYLTIDVDGFDPSVMPGTGTPQPGGFGWYEALKIFRAVCAKK-KIVGIDVVEVSPQ-ENSTITEMNAAKLVYRLAGYITEGK... 289
272 5.000e-98UniRef50_A0A2E9VHV2 Agmatinase n=12 Tax=cellular organisms TaxID=131567 RepID=A0A2E9VHV2_9EURY  ali  31  35........RFVIWGYPFDGTACFRKGAADGPEAIRHHSHNFESWLNELGLDLRDVPTHDWGDVETV-ADQEANNSAIGEIVDRIGAAGKFPVGLGGEHSLTPPAVAALKQHYPNLTVVVLDAHLDYRDGYQGAKWSHAATTRRVSEIVGVECVRVIGVRSLSREEQQAAREDDLSYIEAGWVDLREHLSDIVDDGPLYLSLDMDAIDPAFAPGVGTPEPFGMTPYEVLQVLNFLSD---RLVGFDCVETCPPAD-NGNTAALAARLVRHALGAVVKAQTAG 304
273 5.000e-98UniRef50_A0A1Z9T8D2 Agmatinase n=1 Tax=Kiritimatiellaceae bacterium TMED266 TaxID=1987167 RepID=A0A1Z9T8D2_9BACT  ali  31  13...PAEKCLFHIIPAPYEKTVSYGSGTAKGPAAILEASHQLEAYD--GMSCPCEQGIFTH--------TPSQTLEEIELAVSHVLRLGKIPVLLGGEHTVTYAALKALKEAGEKFGVIQFDAHADLRETYQGNAFSHACVMHLAVEMNIP--IFQIGIRSLSIAEVELRRNKNIDGYEVGRNGIPKNLLPEDFPEKVYLTFDVDALDPSIMPSTGTPEPGGLNWFQTMECFEQIVNSRT-VLGCDFVELAPIEKLHAPD-FLVARLIYNFMGLIVRK.... 275
274 5.000e-98UniRef50_A9GKY1 Agmatinase n=11 Tax=Myxococcales TaxID=29 RepID=A9GKY1_SORC5  ali  28  33....YSGADAVLLGVPWDGSVTYRPGARFAPYELRRVSALVQSYHPGHGVDVFRIHVLDGGNVPFPPFHADSVRELIQASVDEVLAAGAVPFVVGGDHSIALPVLRALSRRHGPVTVVHVDAHLDTSTEVWGEPFHHGTPFRNAIEEGLIGRSAQIGIRAGHPEEGAFAAHAGATLYGMDRIDIAAAIRAAAGESPVYVSFDIDGVDPAYAPGTGTPVPGGLTSREAIQLLRGLA--GINLVGMDLVEVCPALDHADITLHLGAHLLFEGLALLATRK... 316
275 6.000e-98UniRef50_A0A0G0WL82 Uncharacterized protein n=2 Tax=Candidatus Daviesbacteria TaxID=1752718 RepID=A0A0G0WL82_9BACT  ali  28  22..TDFEKAKFVVVSATYEVSATYRGGCKDGPPAIISASQYIELYDDEINKETFKAGIHTLPDVIPALGAARDMVDRLYSVTKMLLKKKKVVCTLGGDHSVSIGVVKAYMEKYPGLSVLQFDAHSDTRDEYEGSKLSGATTMRRIHGMG--VKITQVGLRSLSKEDMLFAKKENIKQYNASDLNLTDQILEGLGDK-VYITFDVDFFDPSIMSATGTPEPGGPGWYDALTILKKVAQE-REIVGFDVVELAPDLGPHACT-FTAAKLVYKIMGYILAGK... 299
276 6.000e-98UniRef50_A0A2N5ZD16 Agmatinase n=1 Tax=bacterium BM706 TaxID=2053465 RepID=A0A2N5ZD16_9BACT  ali  30  20....LDNSYFVIMPVGYDATTSYLTGTRRGPLSIIEASINLEWYDMELDNEPYLEGIHTLNFVETDASSPENMYKRVLEASRQVITKDKFFIEVGGEHSVSLGFIQAHKELHGDFTVIHFDAHADVREDYEGCEYSHACVMGNLYKRG-VDNIVQFGIRSMDKEEKDFLRNSEITTITALDIHSINRLLENIKHEKVYITFDIDVFDPSLVWDTGTPEPGGLMWYDIMKTLKAIFEKH-NVIGCDVVEL---RGNEPSNASTVAKLIYKIMGYKTWQK... 293
277 7.000e-98UniRef50_A0A2A4ZGQ4 Agmatinase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A4ZGQ4_9RHOB  ali  29  28.ATSLDGLDVAVLGIPIDIGTSWRSGTRFGPKQIRAESAMIRPYNMATGAAPFDLQVADIGDLAINTFSLPDSXRIIXXSYDAILXXXVXPVAMGGDHSITLPILRXXAXXXGPVAXVHIDAHADVNDXMFGEXETHGTVFRRAXELIXXDKTYQVGLRGTGYAASDFAEAAGWGFQQFPASELWAEIRRDIGDRPVYVTYDIDSLDPAYAPGTGTPEIGGLTTPQALELIRAL--RGVNIVGCDLVEVSPPYDTTGNTALTGANLLYELLCVL....... 309
278 7.000e-98UniRef50_A0A2C9T1L7 Agmatinase n=14 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A2C9T1L7_9MYCO  ali  30  49........DVAIVGAPFDVATTNRPGARFGPRAIRSTAYEPGTYHMDLGLEIFDLEVVDFGDAWCPHGLTEQSHANIRERVHTIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTADIIDGNLASHGTPMRRLIEAVPGTHFVQVGLRGYWPDTFEWMQEQGMVWHTMQEIEVMRRAVALAKADKLYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEH-DVAGVDVVEVAPAYDHAELTVNAAHRVVFEAL.......... 325
279 7.000e-98UniRef50_A0A069DLT8 Uncharacterized protein n=7 Tax=Bacillales TaxID=1385 RepID=A0A069DLT8_9BACL  ali  27  26..KTLDHVDYAIIGNPFDTGAGYAVGTRFGPSAIREMSQRIRTTNPAQGIDSSELSGIDYGDLSIYPGYIEQTYETVQEQLAPIYDKGIVPIILGGDHSISYPHVKAAAAQYGPISLVHFDSHSDAWEPMDERRFSHGNMFYHGAGWINTQTSIQMGMRGHSSTHYEETRALGFDLLTMGTEQLCQRVKDRVKDTPVFLTFDIDFLDPVFAPGTGTPEVGGFTTYEAIQMLRGLA--GINIIGCDLVEVLPDRDPTRVTALNAATIVSEFITLLAIRRR.. 311
280 9.000e-98UniRef50_A0A124BXJ8 Similar to An14g05950 n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A124BXJ8_ASPNG  ali  30  65LSSEAERYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYNVPLQANPFDMRILDCGDIPVTSYDNAWAIQQIEEGHNSVLMRKPFIITLGGDHTITLPLLRSINRAYGPVTVIHFDSHLDSWKPFGGSPINHGTYFYHAAGLLKNDTNIHAGIRGPSDYECGFEIVEAREIDTIGTDGIIKKIRERVGTEPVYLSIDIDTLDPAYAPATGTPETGGWSTRELRTIIRGL--DGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVKK.... 380
281 1.000e-97UniRef50_A0A1V5MSB8 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Planctomycetes TaxID=203682 RepID=A0A1V5MSB8_9BACT  ali  27  19....LTGSRFVILPIRYDGSVSYKRGAGLAPDAIIEASKEIETFDEQLAGEFFQAGIHTHPGIDGTNFSPEQIQEEIYTTVLPLLEMGKVPISLGGDHSVTPALVKAAKQARPNLSVLHIDAHGDFRDRYLGSPWSHASIMRRIYDMGIP--SISLGIRSICREQYDFIRDHDIAIVEKDTDGAIAKILSRLTDE-VYITLDIDGFDPAIAPGTAIPEPGGLSYYPVLRILEAVGRF-RQIVAADIVEVMPIP-NNYVTEFLAARLAYKIIT......... 286
282 1.000e-97UniRef50_A0A0D6FIK0 Guanidinobutyrase n=101 Tax=Bacteria TaxID=2 RepID=A0A0D6FIK0_ALCXX  ali  28  66...DFGDLQVALLGVPMDLGASNRSGCRFGPRALR-AIERVGPYNHVLKCPVRELRVADIGDVPMSRYSLEQSHEDIHAAYEKLVAAGVAPLSVGGDHSVTLPILRALGAR-QPVALVHFDAHCDTGGPFDGSRFHHGGPFRQAVGVLDPTRTIQIGIRGSAEYLWEFSYESGMTVIHAGVDAIIAQARAIVGDAPVYVSFDIDCLDPAFAPGTGTPEVGGVTVREAQAMLRGLA--GLDIVGGDLVEVAPSYDATANTAHAGAQILFEILSLM....... 342
283 1.000e-97UniRef50_A0A256XRR7 Agmatinase n=1 Tax=Thermofilum sp. ex4484_79 TaxID=2012527 RepID=A0A256XRR7_9CREN  ali  32  22.....EKARIVILGVPYDSTSSYRPGSRFGPNAIRLAAANVESYSLRTGLDVDEIGIYDWGDLVVTH-DVKATLKRVADAVADIISVKKFPLILGGEHTITYGVINGLEEHVSNFTLVVFDAHLDLRNEYPGDPLTHATVLRRIHERSKIDKIIILGMRAVSKEEINYLQQNKGELLAITSLDIMREVLDTLRGKDMYLSIDVDVVDPAFAPGVSNPEIEGIDPSHLLDLLKLVFEKCRRIIGADIVEYNPIYDRSGVTAVLVAKLIYEIVAM........ 299
284 2.000e-97UniRef50_A0A2E4W2W9 Agmatinase n=5 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2E4W2W9_9BACT  ali  31  22.RSTFAEAAAVILPVPLERTVSYVPGTRLGPCEILKASTQLELWDEELAIDVHARGVCTLPEMELPFPNQIAALAEIERVAAEIVGTNKFLIALGGEHSITPALVAATSAHYGDISILQIDAHADLRDEYLGDSNSHACAMRRSLEY---ATCTQVGIRSLSTEEAAAVDDLPTTIFYMRERRWIRDVVNTLRSK-VYVTIDCDGLDPSVMPAVGTPEPGGLSWRELLQLLRATFRE-REIVGCDIVELCPIPGFVHP-NVLCARLVYKLLTY........ 291
285 2.000e-97UniRef50_Q7P0S6 Agmatinase n=1020 Tax=root TaxID=1 RepID=SPEB_CHRVO  ali  27  38.SRDLEGVDVAVSGIPLDLSVTFRSGARMGPQAIRAASVQLAELKPYWGFDPEDLAVVDYGDCWFDAHNPLTIKPSIIEHARTILASGAKMLTFGGDHYVTYPLLIAHAEKYGPLALLHFDAHCDTWPDDSPDSLNHGTMFYKAVGLIDPKKSVQVGIRTWNDDFMGLNVLGAPWVHDNGVDATIAEIKKTIGDAPVYVTFDIDCLDPSAAPGTGTPVPGGLTTAQALKIIRNLG--DLNIVGMDVVEVAPSYDQSEITAIAAAHIACDMLCLMRNKKVAG 320
286 2.000e-97UniRef50_A0A1C6F2L2 Proclavaminate amidinohydrolase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C6F2L2_9FIRM  ali  28  20.STDTSGADYTIIGIPFDIRTTYRPGTRFGPDGIRRAFST-DSVNEAVGIDTSKVKGVDYGNLDIWNAE-KAYLGSIPQEMKAILETGTIPIVLGGDHSITFPELLAYKDVYGPVSIIHFDSHTDTWGSDTDKEHHHSTPFRRAIECIDPKTSIQVGMRGFEKSDFDFAHIYAVDIHHMGIEKTAELIREKVGNNKVMVTFDIDFVDPAFAPGTGTPVSCGFTSRQALELIRH-ALIGLDIVGFDLVEVAPNYDAGGITSILASRIVKEFITCVACKK... 305
287 2.000e-97UniRef50_A0A1F9BW69 Agmatinase n=1 Tax=Deltaproteobacteria bacterium RBG_16_49_23 TaxID=1797840 RepID=A0A1F9BW69_9DELT  ali  28  31.......ADAAIFGVPWDEGTGYRPGSRFGPRSIREYSTRFAFWNIENKRDLENIQVVDCGDQDVLYLKVDETFSAITDSIKKILSRKAFPVILGGDHSVAFPVVRAF-RKFAPLHVIHLDAHLDYNDSIEGVLLANGNPIKRISELNFVGRIIQIGMRGIRTREYQDSRARGNKIFTMSEFRRVEEALSSIPGKNCYVTIDMDVLDPSIAPGTSSPEFDGMTYGEIKALLEGIASRG-KVLGFDVVEVNPFLDPIGLTQTAAAMLILEFLGAIFKS.... 314
288 2.000e-97UniRef50_A0A1V6HVI4 N(1)-aminopropylagmatine ureohydrolase n=1 Tax=Acidobacteria bacterium ADurb.Bin051 TaxID=1852786 RepID=A0A1V6HVI4_9BACT  ali  27  16..SDYATSRFVILPVPFERTTSYGKGTANGPAAIVRASQSMELYDEGLGAEIAAHGIATLPPFLPESFGMEAAIAEIRAEARTHIAAGKRLLVLGGEHSLTLGPVRAAADLHGEIGVVQFDAHADLREEYEGTPYSHASVMRRVVEDGHPT--LAIGIRSLSRPEADFARERRLDIVWGHELAAFEALAARLEPERIYLTFDIDYFDPALVPATGTPEPGGGHWYPTLALLRELFRRK-RVVAMDLVELAP-FGPLPASDFLAAKLAYKCMGYWAEGERR. 293
289 2.000e-97UniRef50_A0A1V5V0I8 N(1)-aminopropylagmatine ureohydrolase n=5 Tax=root TaxID=1 RepID=A0A1V5V0I8_9BACT  ali  33  13...DYTNAKVVLLPVPYDGTSTFVKGADKGPQAIIDASDSIELYDIEEDIEIYICGIHTAKAI-TEKESPEKLVQAVYQSVKKYLNDHKTIVVLGGEHTVSVGAIQAYVEKYPDISVLQLDAHADLRFSYHDSLFNHACVMNRTKEM---ANIVQVGIRNVCMEEKEFIDKESVFYAHRKDDTWMDKAIDRL-NDHVYLTIDLDCFDPSVLPSTGTPLPGGMNWWQVIDFISKVNESK-HIVGFDIVELCPPYDKS--SDVLAAVLTYQIITKIIKK.... 281
290 2.000e-97UniRef50_A0A2N2Y1U7 Agmatinase n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A2N2Y1U7_9BACT  ali  29  13..TDYDKASVVVIPIPFDGTSTWGKGADKGPAALLDATANMELFDIEKWQELYTCGIFTDKPIA-PHKTPEDMVYDAYKVTRKHLLAGKYCMTLGGEHSVSIGPIKAYQELTENLTILQLDAHGDLREEYEESMNNHACVMARAREKSP---IVQVGIRSICIEESETIDKS--RVFFAHDIWWMDKAISLL-TEKVYITIDLDVFDPAEVPATGTPEPGGLKWYQVIRFLEKVHAA-RNVVGSDVVELCPN-DHSKPSEFLAAKLTYKLIGM........ 278
291 2.000e-97UniRef50_A0A168NCE5 Uncharacterized protein n=11 Tax=Mucorales TaxID=4827 RepID=A0A168NCE5_ABSGL  ali  27  81.....EDYDIAVIGAPYDIGVTFRTGARFGPSAIREGSKRIKGFNYEIKVNPFWAKLVDCGDIPFEPFDAEHAMGQIEAHAKYVLQRPPKPVTLGGDHTILLPVLRAMHAAYKPITVIHFDSHLDTWAPEKQSRFNHGNPLYHAAKEGLTTNSMHVGIRSSLYDEEDIQRDKANDIFTMGVEGMVERIKEVIGPKELYLSIDIDVIDPSMAPATGTPESGGLLTRELKYILRGL--NGYDIVGMDVVEVAPAYDQAQLTSFLAADLIYEIMSMMVKR.... 383
292 2.000e-97UniRef50_P72703 Agmatinase 1 n=82 Tax=Terrabacteria group TaxID=1783272 RepID=SPEB1_SYNY3  ali  24  21..TSYADAAVVVVPIPYEATTSYRKGCEHGPEAVLEASDQLEAYDEELGTSPCDLGIYTCAPLADSNKHPDAMVTEVCDGIAPFVEDGKFVVAIGGEHAITTGVVRAMQRTSEPFTVVQIDAHGDMRDKFEGSCHNHACVMRRVLELGLPT--LPIAIRAICQEEADLIREKNIPVFWAREMAWINEAIASITTQKVFLTIDMDGFDPGFMPGVGTPEPGGLGWYEGLNFFRRLFQTK-QVIGCDLMELAPVRG-SVVSEFSTAKLAYKLMGYWGESQRK. 304
293 2.000e-97UniRef50_A0A093YKB5 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A093YKB5_9PEZI  ali  27 1219.......YDIAIIGSPFDTAVSYRPGARFGPRAIRAASARQRGFNPRAGFNPYWATIKDCGDIPINPFDNELALRQMTEAFAELASQNPRLITLGGDHSLALPALRALNQIYGPVAVLHFDAHLDTWHPSEQSHFNHGSMYWIASGLVANGSSVHAGLRGWEDYEDDFFRISADDIDDIGPAGVAKLILEKIGTEPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV--EGLNVVGADIVEVAPAYDRGEQTALVAAQVAYEILTSMVKR.... 1521
294 2.000e-97UniRef50_M1VX99 Related to agmatinase n=1 Tax=Claviceps purpurea (strain 20.1) TaxID=1111077 RepID=M1VX99_CLAP2  ali  27  470LTHPAEKYDIAIVGMPFDTAVSYRPGARFGPRAIRQASARFRGFNARAGINPYWARVIDCGDVPVTPFHNDIAQEQMTQAFKALRSRGKKLVTLGGDHSLALPALRALRELYGPIRVLHFDAHLDTWPSYWGSPFNHGSMFWMASQEGLLSNSVHAGLRTGTDNDADWVRFSADALDDMGTKGLVDAIMSVLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRILRGI--EGLNVVGADVVEVSPAYGRGEETALAGAQVVYEIVSSLVKR.... 790
295 3.000e-97UniRef50_A0A2B2AR72 Agmatinase n=4 Tax=Bacillus megaterium TaxID=1404 RepID=A0A2B2AR72_BACME  ali  26  21.TREINGADIVVMGVPFDVGTSNRPGARYGPRSIREMSLHVGNFYYPWSYDVEKHKIIDYGDVGLGVQNTQFMIQDTYEHAKSILASGAKLLTLGGDHTIPYGMVRAAKEKYGKLALLHFDSHQDSL-ASDGTQIFHGSFAHDLAEEIDAEKSVQVFIRTEMPNECGYNIIHANEALEMKSAELADKIKSIIGDQPVYLTFDVDSLDPAYAPGTGTPVVGGPSTYQIRSLLRNL--EGLNIVAADLVEVAPMYDPAQVTPLAAATIAGDLIYLLAEN.... 298
296 3.000e-97UniRef50_A0A1B7ITN7 Agmatinase n=516 Tax=root TaxID=1 RepID=A0A1B7ITN7_9ENTR  ali  28  34......DADVAILGAPNDMGTQWRAGSRFGPRGIREASTLFSFYDHEDDLTQDQVRMVDVGDADIVHTDMVSSNANIELAVRKILASGAMPVVLGGDHSIHAPVIKAYAGR-GPIHIVHFDAHLDFVDERHGVRYGHGSPLRRASEMDHIVGMTQLGIRNVSRSDYDAARAAGSNILSVRDVRRLEAVLAQIPEGNYYLTIDIDGFDPSIAPGTGTPSHGGFQYYEVLEIIQALARSGGNIIGMDLVEVAPAYDPTGVTSILAAQLLMNSIGFIFYERKQ. 321
297 3.000e-97UniRef50_B9WIN5 Arginase, putative n=4 Tax=Saccharomycetales TaxID=4892 RepID=B9WIN5_CANDC  ali  26  45..ESEKQFDIGIIGVPFDTAVSYRPGARFGPRAIRDASQNLRGFNPKALFDPYWAKIIDCGDIPVTPMDNSAAYKQMSEAFKDLLNNTEIPIALGGDHSVLLPHLRALHRIYGPLNVIHFDAHLDTWPTSEKNDINHGSMLWKAYEEGLTKHNIHVGVRTRDDDEQNFVRIEADDIWLKGPQWVVDKILTTIKDTATYISVDVDVLDPGFTSGTGTQEPGGFLPRELIYLLRSI--EGLTVVGADVVEVSPAYDIAEITATNGAQIAYEILTSMVKR.... 345
298 3.000e-97UniRef50_A0A256ZNX9 Agmatinase n=1 Tax=Candidatus Bathyarchaeota archaeon ex4484_218 TaxID=2012511 RepID=A0A256ZNX9_9ARCH  ali  33  23...DFEEANYIFVGFPFDKTSTYRFGSRKAPNTIREASLNIETYSFRSGLYFEDLKIHDLGNLKID-KNFKKTFSNLKLAVSTIFSLKKFLVVLGGEHTLTFSVGEALPT---NVGIISFDAHLDLRNEYLGKKFSHTTFMRRLAEKIGGDRLFFVGVRAVCKEELEFLENEKIKCLTSTVGEILKKIKEFASNSGLYLTLDMDVLDPSYAPAVSNPEPEGLDPSLLYNILYGIGV-NVNVVGLDLVEVSPDYDF-GVTSILAAKTIFETLCSVEKGRR.. 299
299 3.000e-97UniRef50_Q6CIB4 Guanidinobutyrase n=10 Tax=Saccharomycetales TaxID=4892 RepID=GBU1_KLULA  ali  28  59.....KKFDIGVIGVPFDTAVSFRGGARFGPQAIRKASQRMRGFNFRADINPYWASVVDCGDVPVTPMDNCLALKMMTAAYENLLSHEPRFVTLGGDHSIILPALRALRKTYGRLAVIHFDSHLDTWAPSDTSEFTHGSMLWIAHGLLTENNNIHAGLRDYDDDDVGFHRIEADEIMDGGIKSIVEKIKSKIPSDPVYISVDIDVLDPSAAPGTGTMEVGGWMTRELIRIIREL--EDLNLVGADIVEVSPPFDPTEITSLAGAQIAYELITNMVKK.... 363
300 4.000e-97UniRef50_A0A094IAD1 Uncharacterized protein n=4 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094IAD1_9PEZI  ali  28  629.......YDIAVIGSPFDTAVSYRPGARFGPRAIRAASARQRGFNPRAGFNPYWATIKDCGDIPINPFDNELALRQMTEAFVELAHRKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHPSEQSQFNHGSMYWIASGLIANGSSVHAGLRTRLSGDQGFFRISADDIDDIGPAGVAKLIVEKIGTEPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV--DGLNVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMVKR.... 931
301 4.000e-97UniRef50_V5FMH2 Uncharacterized protein n=1 Tax=Byssochlamys spectabilis (strain No. 5 / NBRC 109023) TaxID=1356009 RepID=V5FMH2_BYSSN  ali  28  69........DIAILGFPYDTSTSYRPGARFGPRGIRAASSRGRSYNSPWGVDPFEQGIIDCGDIPITPFDAEHAFKQMEQGYRQILYHGPRVLSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGSAITHGTFFWHASGCISKGTSVHGGLRTFSDQDVGFTLIEAQEIDEIGMEGIINKVRATVGDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGL--EGVHLVGADVVEVSPPYDVAETTSIAAADLLVDILALMVKDKVFG 373
302 4.000e-97UniRef50_A0A1F9FD69 Agmatinase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9FD69_9DELT  ali  30  16..SDYKTAKTVILPAPFEASTSYQEGTKLGPKAILEASQQVELYDIELARDCHTQGIHTLETFDFSKTDAPTACKMLYEKTKKVLEDGKFPIMLGGEHTISYGMFEALFEKYPNLSIFHIDAHTDMREAYEGNPYSHASVLYLMRK--SCKKTVSIGIRSMCEEERLYVNENKVPVYYDFQTQKPKDLLKHL-TQDVYVTIDVDGLSPTLVPSTGTPEPGGLGYYETLDILREIF-KNKNVVGCDFVELMPIPGLVHGD-FAVAKLIYKCIGY........ 285
303 4.000e-97UniRef50_A0A1V5GYH6 Agmatinase n=1 Tax=Deltaproteobacteria bacterium ADurb.BinA179 TaxID=1852872 RepID=A0A1V5GYH6_9DELT  ali  42  13.........VAILGAPLDSTASYRPGSRFGPAAIREASYGLETFSLDLNADLDDCSYMDLGDLELPFGDPNPALGLIEEQVIKIYSENRIPLMLGGEHLVSLGAIRAAAKTHRDLAVVHLDAHADLRDDYLRQKMSHATVMRRVYELLGGDSLSQIGIRSCTHGEYGLVKTLKAD---------PDEIILRSGTRPCYVSCDLDILDPSVFPGTGTPEPGGLSYRDLSSIMIRLI-RGLNIVGLDVVELAPNLDPTG........................ 250
304 5.000e-97UniRef50_A0A084YY28 Proclavaminate amidinohydrolase n=53 Tax=Bacteria TaxID=2 RepID=A0A084YY28_9GAMM  ali  27  34......DADVAILGAPNDMGTQWRSGARFGPRSIREASTLFSFYDHEDDTTYDQVRMVDVGDADIIHTDMEGSNANIEFAVRKILESGAMPVVLGGDHSIHAPVIKAYAGR-GPVHIVHFDAHLDFVDERHGVRYGHGSPLRRASEMEHIVGMTQMGIRNVSRDDYDAARNAGSQILSVRDVRRLEGVLDIPAGTAYYITIDIDGFDPSIAPGTGTPSHGGFTYYEVLEIIQALSRSSGNVIGMDLVEVAPAYDPTGQTSILAAQLLMNSLGFIFHDR... 319
305 5.000e-97UniRef50_A0A2H0PND1 Agmatinase n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16 TaxID=1973974 RepID=A0A2H0PND1_9DELT  ali  28  27LSPQPRKVDWVLYGVPFDFGTSYRPGARFGCRSIREQSAYIKPYHLFYKEDLERFSIVDGGDAPVAPYDLEKNLSLHEEFSSAWRAQDAKTFAIGGDHSISVGNMRATSKALGKLACIHFDAHTDTVDRLWDNAYTHASPIRRGVEEGDPKKSVSIGIRGNSATELDWGRDQGLEYICIEDLDLLRAFKKKIGNDPVYLTFDIDCMDPVFAPGTGTPAIGGFTTAEIISALR--VFKGIQLVAADMVEVAPGLDPTQVTSLLAAHLVFEILCL........ 308
306 5.000e-97UniRef50_A0A1V4MQE8 Agmatinase n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MQE8_9DELT  ali  29  20....YSTASIAILPVPYDGTSTWMKGADRGPRALLEASANLELYDIETDSEVFKHGIVTLEPVLC-PEEPGAMVSAAYERARHILEEGKFIVGIGGEHTVSVGLVQAAANRFHDLSVLQFDAHADTRNEYKGSRYNHACVMSRIGEICP---YVQAGIRSMDISELKTL--NRDRTFFSHEIDVTSRAIKAL-TENVYITIDLDVLDPSIMPSTGTPEPGGLDWYTLLYFIESVVREK-NVIGIDTTELLPNPDNRAPD-FLAAKLIYRILSMIFLKRDK. 290
307 5.000e-97UniRef50_A0A2R6AY06 Agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2R6AY06_9ARCH  ali  26  40..KDLTDIDVAFVGVPFDDATSYRPGSRLGPSAVRELSRGLRTYNASLRVAPFEVVNVVDYGDVDVPGYVQDTFERVTDVLHKVHSAGVTPLVCGGDHSISLPSLRAAHRVHGPLYVLDFDAHFDFSDSFWGKKYTHSTWVRRALEEGLISNIVELGIRGYSADDFRWAEENGIEVYTMDMIEILKDILGGVPGSPIYVSIDIDAVDPAYAPGTGAPEIGGFTGNQLLGCIRML--RGYKLVSLDVTEVSPLYDPTGLTSILAANVFYEAISVLALNKKQG 329
308 5.000e-97UniRef50_A0A2E4HPH0 Agmatinase n=2 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2E4HPH0_9ARCH  ali  34  31LSNNHKD-KINIFGVPFDATSTYRIGSRFAPNAIREAFQNIEIYSKRLEKDLENVNIKDLGNLAKV-GDINEMNKMVEEITREIITDGKIPAILGGDHSLTNGSVRAIN----NCTLVVFDAHLDCRDEFEGLKLSHATFLRRLYEDGCISNLIHIGTRAATKDEWDFVNKDDITIIDMEKIYDLNTGLKRFKDNDIYVSIDLDVMDPAFAPAVGNPEANGMSSREILEFIY--CLDDFKLTGFDIVELIPTYD-NGSTSALAAKLLSELIC-IADKR... 303
309 6.000e-97UniRef50_A0A094GW84 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094GW84_9PEZI  ali  28  417.......YDIAVIGSPFDTAVSYRPGARFGPRAIRAASARQRGFNPRAGFNPYWATIKDCGDIPINPFDNELALRQMTEAFVELAHRKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHPSEQSQFNHGSMYWIASGLIANGSSVHAGLRTDDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGTEPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV--DGLNVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMVKR.... 719
310 6.000e-97UniRef50_R5W6S2 Agmatinase n=1 Tax=Clostridium sp. CAG:167 TaxID=1262777 RepID=R5W6S2_9CLOT  ali  30  24..KDAKDADVALYGMPFDISTTNRTGCRFGPEGIRQY-GQCKPYHEELDINFDDFKAVDTGDFAIPLSYVDRDMDAVENQLYELLEKGVKTIGVGGDHTLSYPELLALKRKFGKVAFVHFDSHTDTWDENGNTLINHGTPFRLAHDCIDMDHAIQIGMRGGTLEDHDFALEHGMQIHEMGMSACAKRIREVVGDTPVFVTFDIDFLDPAVAPGTGTPIVGGFTTAEALQILRE-GLTRLNIVAMDLVEVAPAYDPTGQTQVVANEILREFLSILSYNKKVG 314
311 6.000e-97UniRef50_A0A0L0HPL8 Agmatinase n=6 Tax=Fungi TaxID=4751 RepID=A0A0L0HPL8_SPIPN  ali  26  83......DYDIAILGLPFDTATSYRPGARFGPAGIRQGSKRLGGYNVPQNVNPFWAKIIDCGDVPVTPYDNALAIEQMQYGHKELLHRTPRLVTLGGDHTIVLPILRSIASAYGPVSVVHFDSHIDTWKPVFGGKYNHGTYFYHASGLIKNGSSIHAGPSDYDDALCGFHIIEARDIDEIGTKGIAERIKKAVGDNLVYLSIDIDVLDPAFAPATGTPETGGWTTRELRTIIRSL--DGVKLVGADVVEVAPAYDTNELTTMAAADVLFEVISLMVKN.... 382
312 6.000e-97UniRef50_D5SKW9 Proclavaminate amidinohydrolase n=2 Tax=Streptomyces clavuligerus TaxID=1901 RepID=D5SKW9_STRC2  ali  28  134........DVVVVGAPYDGGTSYRPGARFAPRAIRHESSLIHGVGIDRGPGVFDIDVVDGGDIDLSPFSMDLAMDTATVALTRLLERNDAFLMLGGDHSLSLAALRAVHARHGRVAVLHLDAHSDTNPPVYGGTYHHGTPFRWAIELVDPERLVQVGIRGPRPDSLDYARGHGVSIVTAADRGIAEQIRRTVGGLPLYVSVDIDVVDPAYAPGTGTPAPGGLSSREVLTLLDVVGQLRP--VGFDVVEVSPAYDPSGITSLLAAEIGAELLYQYARA.... 411
313 6.000e-97UniRef50_A0A1Y2JZN6 Putative agmatinase n=2 Tax=Magnetofaba TaxID=1472292 RepID=A0A1Y2JZN6_9PROT  ali  26  9.NASLEKADVAILSVPYEGAVSYGGGAANGPSAILEASTQVELYDETLNKEIRNLNVHTLPPLDVAGLNSEELAEQVRLAAKPHVDAERFLATLGGDHSISIGVLRAYWEKYGDFTVLQFDAHADMREEYDGNPLSHACVMRQVYDMGIPF--VSVGIRSLSAFEKKHLTWRGLRIFWAKDIAWLDELTALLGSK-VYITFDVDAMDPAIMPATGTPEPGGLDWYTVNDVLDRVCAS-RQIIGCDINELAPIPGLHAPD-FLCARLLYRILGL........ 288
314 6.000e-97UniRef50_Q32C02 Agmatinase n=1171 Tax=root TaxID=1 RepID=SPEB_SHIDS  ali  27  22LPMNFQDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTY--ANGCEFDHGTMFYTAEGLIDPNHSVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGL--KDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKSE. 306
315 7.000e-97UniRef50_A0A2C5YQ83 Uncharacterized protein n=1 Tax=Ophiocordyceps camponoti-rufipedis TaxID=2004952 RepID=A0A2C5YQ83_9HYPO  ali  29  67......QFDIAVIGVPFDTAVSFRPGARFGPRAIRHSSARFRGFNPRAGINPYWAKIIDCGDMPITPFDNQIALEQMTQAFRELGKRKARLVTLGGDHSLALPALRALKEIYGPVRVLHFDAHLDTWDPYSYTQFTHGSMFWMASQEGSSSPSVHAGLRSWADNESDWVRFSADDMDEKGTSGIIDGIVKTLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGI--EGLNLVGADVVEVSPAYGRGEETALAAAQVVYEMVTSMVKRGSKG 376
316 7.000e-97UniRef50_A0A2J0L942 Agmatinase n=1 Tax=Candidatus Moranbacteria bacterium CG17_big_fil_post_rev_8_21_14_2_50_44_12 TaxID=1974673 RepID=A0A2J0L942_9BA  ali  31  30...NFKKAKIAIAQIPYDSTSSYGIGQRNGPYAILKASRYVELLDSHGGKDPTD--VFTLDEIVVSRNSVPEAMAGIEQAIKEIVSKNKIPLVLGGEHSISYGVVKALKKKHEDISVLQFDAHADLLGEYEGSKFSHACVMRRILDLGVPA--VQIGIRNMNTEIEAYLKKNAKNIHFTPEIPPIEKILKGL-SKNVYLTFDLDALDPSIMPAVGTAEPGGLYWNETIGAIEKI-GKKVNLVGADVVELCPIPGF-EAPNFLAAKLVYQIILAILNKK... 306
317 8.000e-97UniRef50_I2K389 Arginase family protein n=20 Tax=saccharomyceta TaxID=716545 RepID=I2K389_DEKBR  ali  29  145.AFDDEKFDIAVVGAPFDTGTSYRPGTRFGPTGIRMGSRRLAPYSVYSGFNPYWAKIVDCGDPPVTPLDNRIALDQIYRAERAIRNHKPKVFTLGGDHTITLPAVKAAYEKYGKISVIHFDSHLDTWNPYSYQAMNHGTYLHWAHEKGXSDNCIHAAIRGPYPGDCGFDRILARDIDKIGADGIIKKIKERIGDAPVYITVDVDSMDPAFTPATGTVEPGGWSSRELLTVLDGL--EGLNVVGGDVVEVSPPYDSAEITSLAAAQVADSIISLMVLK.... 448
318 8.000e-97UniRef50_A0A1L3SYR8 Agmatinase n=2 Tax=Rhizobiales TaxID=356 RepID=A0A1L3SYR8_9RHIZ  ali  25  36.TKNVKGADAIVWGIPFDAAVTNRSGARFGPQAIRRAAAIFDPFHRDL---FADLAVVDYGDCLLDTGNHQKTPGKIERDAAKLLKSGAFLLSLGGDHFVTWPLLKAHAARHGKLALVQFDAHQDTW-FDDGKRIDHGSFVARAVGVIDPERSIQVGIRTHAPEDFGIEILHGYDLDEMKAADIAKAIVERTGGAKTYVTFDIDCLDPAFAPGTGTPVAGGPSSAKMLSVLRQLG--DLDMVGADIVEVAPAYDHADITAIAGATVAQHYLGLLAEKKAR. 315
319 9.000e-97UniRef50_A0A1Z7YUG2 Agmatinase n=1 Tax=Gammaproteobacteria bacterium 42_54_T18 TaxID=1856293 RepID=A0A1Z7YUG2_9GAMM  ali  29  40..RDLEGVDISVYGIPSDISTSNRPGARFGPRAIREQSLLLGVYSPHKHSLRDNMKMVDYGDLAFEFGYVEELLRVSHEHIGRMVDAGTHTLGLGGDHLVTYPAIKEHARKHGPLSLIHFDAHSD--DTNMGA-LHHGSMFWYACELIDPTRSIQIGVR-HTLPEHDFNVLSGEDIIDMKGTEIAQRIREVVGDNPCYISLDVDGMDPAFTPGTGTPVPGGLTSMQQRQILWHL--KGLNVVGADVVEVSPPYDPTGQTANIAAGCAIDLMHVLAESRK.. 316
320 1.000e-96UniRef50_F2NGJ0 Agmatinase n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=F2NGJ0_DESAR  ali  25  11.PISVREAEIVVVPIPYEATTSYGGGTRYGPEAILSASRQVELWDEEGDWDPSQIRLATAAEITPDAGGPGPMLEKIKKRVKPWIAEGKLLISLGGEHTIAQALVESYLTRHPDLTVVALDAHADLRDTYEHSPFSHACVMRRVWELGRP--LTLIGVRSYSAKEYDFIRVKARSLVDPDYLQLTLEHLRRLKG-PVYISLDVDALDPAVMPATGTPEPGGLNYYQTLTILKAIVERGP-VVGLDLTELAPIPGHR-VSEFTAARLIYKFLGYLYQGRR.. 291
321 1.000e-96UniRef50_A0A1I1HD76 Guanidinopropionase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I1HD76_9RHOB  ali  27  36....LAEVQVGLIGVPWDSGTTNRPGPRHGPRQLRDMSTMIRAQNGATGRPFERINCADLGDVSPNPADIQDSMARITTFYDAVREAGVLPLTAGGDHLTSLPVLRALSKPA-PLGMIHFDSHTDLFKDYFGGTYTHGTPFRRAVELLEPKRVVQIGIRGYDDEDRDFADAVGIRVIPIGPEDVMTEAKEIVGTSPTYISYDIDFVDPAFAPGTGTPEVGGPNSHQALLVARLL--EGVNIAGADLVEVSPPFDPSGGTAFLAVSIMFEILCNMA...... 315
322 1.000e-96UniRef50_A0A0T5ZHV7 Agmatinase, agmatinase n=11 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0T5ZHV7_9CHLR  ali  29  54........DVAIVGAPFDDAVSHRSGARFGPRAIRQATYTDGEHSLQLDVEPWELDVVDAGDANIVPAWLERAHAVIYRKVRDVAACGAVPIVLGGDHSITWPSVTAVAEAVAPIGIVHFDAHADTAPDDWGVLAGHGTPMRRLIEAVLGKNFVQVGLRGYWPEVFAWMQAQGMRWHKMREIEVIDDAIAEALDGPIYLSLDVDVVDPGMAPGTGTPEPGGLLSRELLRAVRRIVGR-VELAGMDIVEVSPPYDHAEITAMLGHRAALEAISALAVKKRDG 340
323 1.000e-96UniRef50_UPI000688AB93 agmatinase n=1 Tax=Ensifer aridi TaxID=1708715 RepID=UPI000688AB93  ali  28  35......ELDIAISGVPFDLGTAFRIGSRFGPACVREQSRHVRRIHQTFGFSPFDLRVADVGDAPVRSFSIRDSLALIEDHFRKIKDLEITPLTIGGDHTISLPILRGIVQ-HGPIGLIHIDAHSDTLDSIQGEQYCNGTPFRRAVELVDPKRLVQIGIREFDKDDHDWAKANGIRMISMNEIDIVEETRSIVAERPCYLTLDIDSLDPSVAPGTGAVEPGGFTVREMERLLEGL--MGVDLIGADIPEVSPLYDEGGRTGRVAATLAFDLLCLLAKA.... 313
324 2.000e-96UniRef50_A0A1F3BHC6 Agmatinase n=1 Tax=archaeon RBG_16_50_20 TaxID=1797286 RepID=A0A1F3BHC6_9ARCH  ali  34  18.SKPLEEAHYVIVGVPLDHTSTYRTGSRFAPRAIREASLNIETFSLRTGIDIEHVAMHDAGDLHIVD-DATETLRRLSLVTKDILGAEKMPIFIGGEHTITLGSIRSLPKS---VGVVSLDAHGDLRDEYGGGKYSHATVLRRISEVVGTDGVFVCGVRALCKEEVEFIEENKIEMREMGISKVSQRVTDFSKKDHVYLTIDTDVLDPAFAPGVANPEFDGITPSELISITSAVARE--RMIGFDLVEVCPNYD-TGVTAVAAARVLFEVIAQAEKTR... 294
325 2.000e-96UniRef50_I4Y8K0 Putative agmatinase n=1 Tax=Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66) TaxID=671144 RepID=I4Y8K0_WALMC  ali  28  54.....EKFDIAVNGLPLDTSVSYRTGARFGPSGIRQGSRRQDPWSHYWKQNPYKRGIIDCGDVPVIAVDNNMAYKSIEAAHDTLLNRHPMLLTFGGDHSVELPILRSLKKVYGPIALIQIDSHIDTWDNHNEAPVSHGNMLWHAHEEGLLSSSIQAGIRTFTNEDIEDNEKFGIEVDEMGTKGISERIKERIGDKPAYITFDIDSLDPAFAPATGTPEPGGLTTREAKAILRGL--EGLNLVGADIVEVSPAYDTSELTQMVAAEVAYELLNLL....... 351
326 2.000e-96UniRef50_A0A1Q3SK96 Agmatinase n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3SK96_9CHLR  ali  31  18....YEDSKVIIIPAGLENTTSYMQGTKKGPAAIIEASTQVELYDEELKFEPIQMGIFTLEELPLEGKSQEDSLDLIQSAFKKVYDDGKFAVTLGGEHSVTIPLIRDLKERYPDLVVLSFDAHGDLRITYHGE-LSHACVMRRISDMEVP--VYVVGVRSISPEEVQYVAKTGILYDYERSEKAFD-VQELLKGKHVYVTVDLDAFDPAEMPAVGTPEPGGLRWREFFSIFKQVAEQ-TEVVGLDIMELCPMPG-QERADFYAAKLIYKMLGFL---RRAG 289
327 2.000e-96UniRef50_P19268 Uncharacterized 32.2 kDa protein in hmfB 3`region n=4 Tax=Methanobacteriales TaxID=2158 RepID=YHMF_METFE  ali  34  23.........FGLLGVPFDSTSTYKPGSRFGPLMIRQASYNFENYSLHYRKKL-DVPIIDLGDIEVILGDFKNTCRNISEKVQEVLKKGMIPIVLGGEHSITYGVVKTF--DLSDVTILHFDAHMDMANTYAGKKFSHATVMRRIYEL-HPKKIVQIGVRSCTKEEHEFVLNENIKYYTSRDIEKFNMVLNEINDGPFYVTVDIDVLDPGYAPGVGNPTPVGITPYHMEKFIEKIARK--KIIGIDIVEVATDR-IGDPAAMNAAKILYDFLFAI....... 283
328 2.000e-96UniRef50_A0A0F2QBW8 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium BRH_c20a TaxID=1629719 RepID=A0A0F2QBW8_9CLOT  ali  31  29......EANAAVFGVPFDASAGYRPGARFGPRSIRDLSTRLCFFDIDLKKRLENAVLVDCGDVDVISVNSEYTFKETVKIVEKIIKKGAIPVALGGDHSISIPCIEGFKNQ-GPLDIVHLDAHLDLRDSLLGAKHGHSSVIRRAMEMEHVEKVASVGIRGLSEDDYYWAKEQGNQIISYGEQAGLESVLASLDKNNCYVTIDIDVLNVSEAPGTGTPEAEGLTYTELKKLLQGLASTK-KIVGFDLVEVNPLFDPTGITSLAASRLIIEFLGAIIK..... 313
329 2.000e-96UniRef50_A0A076GY86 Arginase n=3 Tax=Synechococcus TaxID=1129 RepID=A0A076GY86_9SYNE  ali  38  17..RNPDHCQVGLFGVPYDGTTSFRPGTRFGPAAIREVSQGLESYCPQLDRDLDDIAFADLGAVEIPFGAPQPVVDAVLKATQAVLSKGLKPLILGGEHSISSGAVEAVAAKHPDLVLLQLDAHADLRETWLGARHSHACAMRRCLDVLPSGDLLQLSIRSGTREEFQELRRTGRLI---ANAQSLETALVPWRGRPLYLTVDLDWFDPSVLPGTGTPEPGGYHWQDFADVIDVLKRH--RLVAADVVELAPQLDSSGVSSVLAAKVCRSLLLLL....... 283
330 2.000e-96UniRef50_A0A1G5SG98 Agmatinase n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1G5SG98_9PROT  ali  28  48...............PLDIATTNRSGARLGPRAIRNASLSLAWERPPWNIDPTALRVIDCGDCEPVTDDL-LSVAHIEAHIANIIGAGAAALVLGGDHFVAYPSLRAHAAVHGPISLIHFDAHTDTWPS-SGNGINHGTMFYQAAGIVNPASSTQIGIRTTNDDTLGFHIVSAADVHQTTGRDIASQIRARVGGKPVYITFDIDCLDPAFAPGTGTPVPGGLSSFQALSIIREL--KGINLVGMDVVEVAPAYDHAEITALAAAQIAVELLCLYAESHRQ. 312
331 2.000e-96UniRef50_A0A1Q7MEN9 Agmatinase n=9 Tax=Archaea TaxID=2157 RepID=A0A1Q7MEN9_9CREN  ali  34  21....YDKSHFVFFGVPYDKTSTYKAGSRFAPGSLRDVSANMELYSVRSGVDLERVAVHDWGDVDIVE-DLGRTLDRVKSVCSELVESKKIPIMAGGEHSIT----KAAAEALPDTGLVSFDAHLDLRDEFLGEKLSHATFMRRVSEQLGPHHIMEVGIRAFSKPELDFSKKSGVTMITAGISKTAQRIRGFLSGSHSYVTVDIDVLDPAFAPGVGNPEPDGLSTDELLTLVD--AAMEKNTVGFDLVEVSPQLD-TGQTAAVGVKVIFEAVAALSAR.... 293
332 2.000e-96UniRef50_A0A2U3DXY6 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DXY6_9HYPO  ali  26  303LTDPTVDYDIAIVGAPFDTAVSFRPGARFGPRAIRQASSRFRGFNPRASINPYWAKIVDCGDIPITPFDNDIAREQMTQALKQLLSPKPKLMTLGGDHSLTLPALRALKEIHGPVRVLHFDAHLDTWPSYWGATFTHGSMFWMANQEGLLSNSVHAGLRTRDDSSQNWVRFSADDMDDIGTQGIIDGIMRVLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGI--EGLNLVGADVVEVSPAYGRGEETALAAAQVVYELLSSMVKR.... 614
333 3.000e-96UniRef50_A0A2B7WII0 Agmatinase n=3 Tax=Pezizomycotina TaxID=147538 RepID=A0A2B7WII0_9EURO  ali  28  65LASDQESFDIAFLGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYNVPLAANPFDIKVLDCGDIPVTSYDNTWAIQQVEEGHNSLLMRKPRIITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDTWKPFGGAPINHGTYFYHAAQEGLLRNNIHAGIRGLSDYECGFEIVEAREIDTIGTAGIIKKIRDRVGTNPVYISIDIDTLDPAFAPATGTPETGGWSTRELRTILRGL--DGINFIGADIVEVAPAYDTNELSTMAAADVLYEILTMMVKK.... 380
334 3.000e-96UniRef50_Q0W940 Agmatine ureohydrolase n=70 Tax=Methanomicrobia TaxID=224756 RepID=Q0W940_METAR  ali  33  12...SFEDAAFVIYGVPFDNTSSFRAGSRWAPDEMRKMSYNFETYNPDFGVDLTDVPIHDMGNCD-TYASIEDTLLEVYQTSKQIVDAGKIPIMMGGEHSLTYPCVESL---GKNVGFVVMDAHLDLRTEYRGIKHNHACVSRHVIENL-ADKYVTIGVRSGPKEEWDYVRDNKDDVYSRGIEAVLKEADEYLGCDRIYLSLDMDAIDPSYAPGLGTPEPFGMTPREVRTVIRHFAPITA---AFDLVEISPEYDAGSITSVLGAKLIRDFIAAKWKA.... 285
335 3.000e-96UniRef50_A0A1Z9AWJ0 Agmatinase n=1 Tax=Candidatus Pelagibacter sp. TMED106 TaxID=1986796 RepID=A0A1Z9AWJ0_9PROT  ali  30  17..FNFKE-KVVVVPFGLEKTVSYGGGTKNGPKEIIKASHQVELYDEELNCEPYKIGIKTLKPFK-INKDIKKALKKISSVNEEILNKKLFPITFGGEHSITPGCIAPFVKRYKKLCLLHFDAHADLRESYNGEKFSHASAIKRCLDYNNVS-LISFGIRNISKSELPFLKKHRINIFWAKDKWNLKKFKRLIKNKTVYLTFDVDGLDSSIMPATGTPEPGGLLWDETLNIIK-IAAKNSNIVGVDINELAPIKGFNSY-NFLVAKLAYKILSY........ 287
336 3.000e-96UniRef50_A0A2E0BLS7 Agmatinase n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2E0BLS7_9RHOB  ali  30  24..TDFGNADVVIQGLPYDLGVSNRPGARFGPRSIREASCQLAWGEWPWGFDPFDIAVMDTGDIEYSYGNSKEFFRNAAKQTNKIVSAGAIPFTLGGDHSISSALLMEVSKAHGPVSLLQFDAHADTG---IGPKIQHGAMFKIAADAINPAKSIQIGLRTPFNSTLGFNTITAVEAMYQSSKILSERIETVIGKSACYVSIDIDCLDPSHAPGTGTPIPGGLTTLQLLEILRALGGTKLNIVGLDLVEVAPDYDHAQITSLAAAQICQESLCLISRTK... 300
337 4.000e-96UniRef50_A0A1V6QBE5 Uncharacterized protein n=2 Tax=Penicillium TaxID=5073 RepID=A0A1V6QBE5_9EURO  ali  30  513LASEAEKYDIAFLGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYNVPLQANPFDMRIMDCGDVPVTSYDNAWAIQQIEEGHNSILMRKPFVITMGGDHTITLPLLRSINKAYGPVTVIHFDSHLDSWKPFGGSPINHGTYFYHAAGLLKNDTNIHAGIRGPSDYECGFEIVEAREIDTIGTDGIIKKIRDRVGTDPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGL--DGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVKK.... 828
338 4.000e-96UniRef50_A0A0A8JGQ8 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family n=2 Tax=Firmicutes TaxID=1239 RepID=A0A0A8JGQ8_BACSX  ali  29  20ICTDLDDADVAIIGVPYDMGTAYRAGARLAPRRIREASTLGGFYDHERNVFLKGVKIVDCGDVDILHGDLTYSFKNIEEDVRKIVKKGALPVVIGGDHSITAAIGKGLNQV-GDFCVIQIDAHLDWSDAPGGQKLGQGSPMRRLSEMDYVNGMAQLGIRGVGKKDFEDANEYG------SVIKSVKQIREIIGDERYYITLDIDGLDPSIAPGTGTPSAGGFLFHEIQTILETIANKG-EVIGFDLVEVAPDYDPSGITSHLAQQLINEFLGFIFKAKEK. 310
339 5.000e-96UniRef50_A0A1Q8U0H8 Agmatinase n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1Q8U0H8_9ACTN  ali  29  26.SRDLTGVDVAVVGVPFDGTVTYRSGGRLGPRAVRTASGIVGGYNPAQAVAPFELRCVDYGDVPVVPGNTERSHAAIERTVRRVLDAGATPLLFGGDHSCTLAHLRAFREA-GPVAVIDLDAHTDCADEYFGERYSHGSWLRRAIELVDPSVSIQIGLRGSVDGPETYADELGLEYVTTDDVETAALVRERVGDRPVFLSLDLDVVDPAFAPGTGTPEPGGLMSYETISLLRQLGP--LDFVGFDIMELVPAYDAGEITAVLAGNLGFE............ 301
340 5.000e-96UniRef50_A0A2G9NPL0 Agmatinase n=4 Tax=Candidatus Pacearchaeota TaxID=1801617 RepID=A0A2G9NPL0_9ARCH  ali  30  11.NSEFEKASLVVLPVAFDSTSTWKKGSSKGPEAIIESSREIELYDLDLNYNPEKMNIFTLPILK--PKNIEEMQKKVKEGAKKVIDGEKFLIMIGGEHSITLPAVEIFAEKYSDLTVLQLDAHADLYDEFENQKYGHMNVMKRIKE--KNINVVQAGIRCISQDEIDDVKKNNYKNIFYKKLD--KKAIKLCK-KNVYLSIDLDILDPSIMPSVGTPEPDGILWKELMQFLTRLFKEK-NVIGVDVVELCPIKDLHHAD-FTAAKLIYKIIGMKFK..... 277
341 6.000e-96UniRef50_Q6MHV0 Agmatinase n=16 Tax=Proteobacteria TaxID=1224 RepID=Q6MHV0_BDEBA  ali  27  35......DYEVGIFGIPYDGGVSYRPGGRFAPAKVREVSSLGRGFHMRMENFFENLKVADIGDCPTVPIDQKQTYEKIEKFVGEVLSHNKRFLAVGGDHSTTLPVLRALRKKYGPLAFIHFDAHLDTYPAAWGQEYHHGAFARHAVELVDPKKMVQIGIRGPLADDLNFVNKHGIRVITVDEIRPITEFLKTLPTTPTYISYDIDNLDPSCAPGTGTPVPGGLTTYEVQRIFRAL--KIPNLVGGDVVEISPPFDHADITALAGMDALFEMLHLFPTKK... 315
342 7.000e-96UniRef50_A0A0S8JPP7 Uncharacterized protein n=1 Tax=candidate division BRC1 bacterium SM23_51 TaxID=1703761 RepID=A0A0S8JPP7_9BACT  ali  28  4.......AAVCILPVPYDGTASYQPGARFGPAALIAASHQVELFDEQLQRETYRIGIHTCPPVPPNASGPAAMVDDVRQACETLLDQGKFVAVVGGEHTAALGAIAAHKRADRPFGVVQFDAHRDLRSIYDSSPWSHACVAARIIEWQLP--LAQLGIRAWSREEQETAVSASVAALTAREVPSLDRALADLPEE-VYLTFDLDVLDPSIMPATGTPEPGGLPWYRTLELVEQLA-RCRRVIGLDIVELAPISGLAAP-SYLAARLLYRLIGLVAR..... 275
343 8.000e-96UniRef50_A0A1F8RMY9 Agmatinase n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8RMY9_9CHLR  ali  27  20..SDYDSARVVILPVPYDATASGWGGAREGPAAIIEASANMELYDIGINREPHLVGIHTLPDMAVHAGGPEATVGRIEEVVGELLDGGKFVVALGGEHTVAVGAVRAHARRTPGLSVLALDAHADLRDSYMDTPYSHACTLRRVMESAP---VVQVGLRSAQREEHDLIRERGLAFHSPQEYRAAESIAAQLSDE-VYVTIDLDVFDPSQVAAVGTPEPGGLLWDEVSELLET-AARQRRIVGFDVTELAPALGPRAN-AQLAAKLTYRLIGLALR..... 289
344 9.000e-96UniRef50_A0A2E7NHL5 Agmatinase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E7NHL5_9BACT  ali  26  31LCEGFDGLDIALAGVPFDGGSSFRAGARHGPAQMREMSRLIRQAHYSTNIAPFEIRIGDVGDAPINPLDMSASLESIETFFSAIRXAGALPLVAGGDHTITLPILRAIA-VDAPVGLLQIDAHSDTQDRMFGKIYANGTPIRRAIELLEPSHIIQIGIRGFSTDELDWAREQGITIMTIDDVGIMNAAREVLSDLPTYVTVDMDAIDPAFAPGVGGLEPGGMTVRDVQLLLRGM--EGLDXVGADXNEVSPPLDPTGNTAVVACNLMFELLCLLAARVR.. 317
345 9.000e-96UniRef50_D5U2U1 Agmatinase n=9 Tax=Desulfurococcaceae TaxID=2272 RepID=D5U2U1_THEAM  ali  32  18...PKANSAWILLGIPFDSTTTYKPGTRFAPDSVRSASCNLEFYSLLTGLILEDDRINDLGNLVLPPGEVEKSLRIIEDAVRELLYPDALTIFIGGEHLITYPIVKAFDKTID--TLVVFDAHLDLRSEYLSSKYNHATFLRRIVEELDL-NVLHIGSRAYSKDELDYVKSSGLKVLNILESKDLEAVGKEFENGRTYVSLDIDVIDPAYAPGVGNPEPLGMDPLTLLKVVKKIFESNNKVIGFDLVEVNPLVDVNDVTSALAGKIILEVMAM........ 287
346 1.000e-95UniRef50_A0A257MN11 Agmatinase n=12 Tax=Methanothrix TaxID=2222 RepID=A0A257MN11_9EURY  ali  30  35....LEEAEYVVVGLPFDGTASFRSGSRDGPDAIRLASFNFESYDSYYGVDLSELDICDLGNMEL-GADPAYAQETIKEGI-ELLPERAAPIFLGGEHSITPAIVEGLGRARSALGVLVLDAHLDLREEYGCTASSHACASRRILEKDVVAGYASIGIRSGSREEFGWAAENNISYFTARDDAVLDQALRSLQCERLYLSIDLDVLDPAYAPAVGNPEPFGLTSWDAKRVIERLA---PRLVGLDINELTPAYDRGE-TALLAARLAREFIAARAKA.... 315
347 1.000e-95UniRef50_A0A1V4WVA0 Agmatinase n=5 Tax=Syntrophorhabdaceae TaxID=513556 RepID=A0A1V4WVA0_9DELT  ali  42  21.........IVVLGCPLDVTSSFRGGSKFGPESLRKASWTLETYSPYLNLDLDEMDLFDAGDLELPQGNLAGSLDRIEKSAARLVAPGRKPLFLGGEHLVTYPLVKSMMRFFPLLQLVHFDAHCDLRDEYEGEKLSHATVMKRVRELG-VSRMHQIGIRSGTRQEFT----------ELSPVRSPEALAEGLDRDPIYISFDIDVLDPSLMPGVTTPEPGGLMFKEVMDYLSVL--KGMDIVGADLVELAPDYDTTFVSSVCAAKVAREIVMLLHSGIK.. 278
348 1.000e-95UniRef50_A0A0M9DZ15 Agmatinase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A0M9DZ15_9DELT  ali  30  21....PETCLFHIIPAGYEASVSYGTGTKNGPKAIIEASQQLELFNGH--SVPADKGIYTHPPLLFN-KSCEENIFLIENTVSSVLKKNKIPVILGGEHTVSVGAFRALSKMKDRIGIIQLDAHADLRDSYEGNKYSHACVMKRALD--HNFSIAQFGIRSLSYDEHLLRKEKNIFHIDADEQDIPKHILPDLFPENIYITFDVDCLDPSVISSTGTPVPGGLLWYQALNLLKKI-TKDRNIVGFDVVELAPIA-MHHASDFATARLVYEIMGMVSQ..... 288
349 1.000e-95UniRef50_A0A0S8JCI5 Uncharacterized protein (Fragment) n=1 Tax=bacterium SM23_57 TaxID=1703763 RepID=A0A0S8JCI5_9BACT  ali  43  22..........VLVGCPYDGTSSFRPGARFGPSAIRQASVGLETYSPDLDMDLEDGSFEDIGDLELPMGDCQKALEIIARQVRSILDRGKLPFCLGGEHTISIPAITEIQKRHSSLKVVQLDAHLDLRQEYLEEEICHATVMRRIGDMVGMQNILQLGVRSGTREEWQLARDHKT------IKDSSEDILQWVGDSPGYLTVDLDVFDPGVMGGIGTPEPGGWMYGDFLKVIMKL--QSFEWVGVDVVELSPHYDPSGASAIL................... 265
350 2.000e-95UniRef50_A0A1F4SGZ5 Agmatinase n=1 Tax=candidate division WOR-1 bacterium RIFOXYB2_FULL_37_13 TaxID=1802579 RepID=A0A1F4SGZ5_9BACT  ali  31  11..KNYKKSEFVILPCPYEKTTSYGKGTQKGPEAIIKASKYLEAFDEELAIEPSVAGIYTENPV---------SISTLYSKTLKTLKNNKRPIILGGEHSLSVEAVRAARKIYPDLSVLCFDAHADLRNKYQGNKQSHACTVRRILEICP---VVQVGVRSLSREEFDFAETSGNTVHTAHD---IKKLISLL-SKNIYISFDVDVFDPSVMPSTGTPEPGGFFWNDILVLLKQVC-KNKNIVGADFVELMPIKNFNAPD-YMIAKLIYKLIGYI....... 283
351 2.000e-95UniRef50_K9NHJ4 Agmatinase n=239 Tax=Bacteria TaxID=2 RepID=K9NHJ4_9PSED  ali  30  31...DALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFYDHEDDVTASDVRMVDVGDADIVHTDMATSNKNTEYAVRKILDAGVMPVVLGGDHSVHAPVIKAF-EGRGPIHIIHFDAHLDFVDERHGVRYGHGNPLRRASEMNHIVGMTQMGIRNVSRDDYEAAHEAGSKILSVRDVRRVEGVLALIPQNNYYITIDIDGFDPSIAPGTGTPSHGGFLYYEVLEIIQALARSKGNIVGMDLVEVAPVYDPTGMTSILAAQLLLNSIGFIFHERGK. 321
352 2.000e-95UniRef50_A0A139AWW5 Arginase/deacetylase n=2 Tax=Fungi TaxID=4751 RepID=A0A139AWW5_GONPR  ali  28  9..ENAEKFDIGVLGIPFDTAVTYRPGARFGPAAIRTGSRRIKGYDTNWGFSPFWAKVVDCGDLPITGFSNTKAYDQMYRGYLHLITRHTFPVTFGGDHSISYPILKALHEVYGPIAVLHFDSHLDTWSATKEEELHHGTMFWHAWGLTQHGKNVHVGIRTRLVDEGDYADDKKVEYYKLGIDGIIREIKETIGEAPCYLSLDIDVVNPGEAPATGTIEPGGFLAREIQAILRGL--NGLNIVGADVVEVAPVYDHAEITATLAANLAFDMLATMVKR.... 311
353 2.000e-95UniRef50_I2JQM8 Arginase family protein n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JQM8_DEKBR  ali  27  48.......YDIGIIGVPFDTATSYRPGARFGPQAIRLASQRMRGFNTRAGINPYWASLVDCGDIPVTPMDNKVALDQMTAAFEELLAHPPRYVALGGDHSIILPHLRALHEVYGKIAVIHFDAHLDTWTPSEQSKFTHGSMLWMAEGILSDDYNVHVGIRGVSWEDFDEDDDQGWLRFSADDVWVLDQIVASIKKRPVYISVDVDCMDPGFTPGTGTIEPGGMMPREVIYLLRHL---DLDLVGADVVEVAPAYDQAEITATNAAQVVFELVTTMVKRGK.. 354
354 2.000e-95UniRef50_A0A2N7PIF2 Agmatinase n=1 Tax=Caldimicrobium thiodismutans TaxID=1653476 RepID=A0A2N7PIF2_9BACT  ali  31  10...DHPKARVALIPVPFELTTTWLKGTKEAPFEILKVSAQLEFFDEETRSSPEDLGFYTYP-LEEFPLNVHKALEKIEDLTHRALKEKFFPILVGGEHTITYGAVKALKAYYPDLKVLHLDAHLDFRKTYLEDEFNHATVLRKIYELSIPT--LSVGIRAISKEEFEEAEFLGLSIIYSYEIRVLKKIEEFLKEGSIYLTLDMDVLDPSLAPGVGTPEPGGLLWFQILEILKRV--SQAKIVGLDIVETRPISGY-PFTEFLAAKIIYKFSAYL....... 280
355 2.000e-95UniRef50_A0A166S1B9 Arginase/deacetylase n=3 Tax=Fibularhizoctonia sp. CBS 109695 TaxID=436010 RepID=A0A166S1B9_9HOMO  ali  27  73........DIAILGFPFDTAVSYRPGARFGPFAIRAGSRRQRGYSLSWGMNPFDATVIDCGDIPISPFDNALALDQMEVAYSTLLNRHARIVSLGGDHTIVLPILRSLNKIYGPISVIHFDAHLDTWPGYQGSRINHGTFFAVAQEEGLISNSIHVGVRGIVDVEHDFELITTDDIDDLGIPEIIRRVRARIGDSPVYLSFDIDVIDPGLAPATGTPEAGGFTTREVKRIIRGLA--GLNFVGADIVEVAPAYDHADITGIAAADLVSDFLSMF....... 375
356 2.000e-95UniRef50_A0A1W6JZY6 Agmatinase n=2 Tax=Acidianus TaxID=12914 RepID=A0A1W6JZY6_9CREN  ali  33  22.....DKSPFTIIGIPMDITSSFRPGSRFAPSAIRDAATNIEFYSLRTGIDMGDIGFNDVGDIALHPSDVEENVKRIKDVISFFSDQGKIPISIGGEHSITIGTAQGTKAD----CVISFDAHLDLRDDYLGYKYDHACVMRRLTESGL--KIIEIGNRAVSKEELEYAKNAEIPFITIGPREVARKIINFTECKRIYITYDMDAIDPSFAPGVATPEPEGLSPSIILDIVNLIA--DKRVVGFDIVEITPSYDPTGITSILGAKMIMETAAII....... 289
357 3.000e-95UniRef50_A0A1E3QKG1 Uncharacterized protein n=8 Tax=saccharomyceta TaxID=716545 RepID=A0A1E3QKG1_9ASCO  ali  27  78......DFDIGIIGVPFDTATTYRTGARFGPKGIRAASARLRGYNPRAGINPYWAKVIDCGDIPVTPMDNNLALRQMTVGFEELLEAGARLVAMGGDHSILLPHLRALKKAYQEIHVIHFDAHLDTWPSFWHSKFTHGSMLWMAAGLINANNNVHLGLRTDEDEDLGFTRISADDIHQSGVNYVVDKILETIKNKPVYLSVDIDCLDPGFAPGTGTIESGGLLPRELIYILRKL--EGLNLVGADVVEVNPAFDHSEVTTTNGAQVVYELVTSMVKRGK.. 390
358 3.000e-95UniRef50_A0A0P1INP9 Guanidinobutyrase n=33 Tax=Bacteria TaxID=2 RepID=A0A0P1INP9_9RHOB  ali  28  38......EVELGLIGIPWDGGTTNRPGARHGPRQLRDFSTMIRAMNPVTGVAPFSLNCADLGDVAPNPVDIGDTLERVTAFYADIHDRGIAPLTAGGDHLTTLPVLRALAKS-GPLGLIQFDSHTDLFDTYFGHKFTHGTPFRRAVELVDPKRFVQVGIRGYNTEDIEWGEAQGIRIFDRGIDDVLAEVRSIVGTAPTYCTYDIDFVDPTYAPGTGTPEIGGPNSFQAQQVIRKMA--GVNLVGADLVEVAPPFDPEGGTAWLGISLMFELLCVLAQA.... 317
359 3.000e-95UniRef50_A0A1L9SLM0 Uncharacterized protein n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A1L9SLM0_9EURO  ali  30  61..EPYERFDIGVIGVPFDTAVSYRPGARFGPRAIRAASRHLRGFSTYSGLNPYWAKVLDCGDVPVNPFDNDLALRQMTEALEELSAKRPKLLILGGDHSIALPALRAMNKAYGPVAVVHFDAHLDTYPSVWSSKFTHGSMFWQAEGLVLNDSSIHAGLRTIRDDEQGFLRLTTEDIDDIGPQGIVDRIIERVGTRPVYLSIDIDVLDPSIAPGTGAPEPGGWTMREMNRIIRGM--DKLNIVGADIVEVSPAFDHTENTAFAAAQLGYEIILNWVKK.... 400
360 3.000e-95UniRef50_A0A1F9A2P6 Agmatinase n=1 Tax=Deltaproteobacteria bacterium RBG_13_43_22 TaxID=1797825 RepID=A0A1F9A2P6_9DELT  ali  32  15...SPETADVLIQPIPYDSTTSFQPGTRFGPEAILQASSQVELWDEELDWEPMAHRTCTLSDIPRNHHSPEMMIRDIDEHMRPFWKQKKMILALGGEHTVAFPLVRGVKRSYPDPVVLVLDAHADLRESWEGSSFSHACTLKRIAELDCP--IFHLGLRSLSKEEQKYLKGQSLEILFNNGLDRFRHDLTAMADRNFYLSLDIDVLDPSLVPGTGTPEPGGLTWHHLMHIFKIIVSQGP-IRGIDVCELMPLPG-SRLSEFVAAKLIFKLLSYLF...... 290
361 3.000e-95UniRef50_A0A1W9RVX6 Agmatinase n=1 Tax=candidate division KSB1 bacterium 4484_87 TaxID=1970772 RepID=A0A1W9RVX6_9BACT  ali  29  14...PYQSASTVVIPVPFERSTSYLKGTAHAPQAILEASDSLEFYDIETDSEPFLSGIHTTPAISSENESTPEFFERLKNAVSDMLRDDKFFVILGGEHSLSYPVVHAFVEHFPRISVLHIDAHADLRDEYLGDPLSHACALRRIRDV--TSETVSVGIRSMSAKEAKYVKKERPVIFYDHQLHPIEEILAALNDD-VYITFDLDGLNPAEMPSVGTPEPGGLSWHETLALFDELFQRK-NVLGMDVVELKPDS-VNVHSDFLAAKLIYKAIAL........ 283
362 3.000e-95UniRef50_I4Z1M5 Agmatinase n=5 Tax=Bacteria TaxID=2 RepID=I4Z1M5_9RHIZ  ali  27  65...DFGGLDVALVGVPMDLGVTNRNGSRFGPRAVRTI-ERVGPYDHVLRCPFSKARIADIGDVPMSRYDLALCHADIEAFYKRLVEAGVRPLSVGGDHSISSSILKAVGER-QPVGMIHIDAHCDTAGPYEGAKFQHGGPFRLAVGVLDPERTIQIGIRGGAEYLWEFSYESGMTVIHAGIEALIERTRAVVGDGPTYLSFDIDSVDPGFAPGTGTPEVGGLTPREVLELLRGL--KGINFVGGDVVEVAPQYDATTNTAHVAAQVLFTILCLMV...... 342
363 3.000e-95UniRef50_A0LDK6 Putative agmatinase n=1 Tax=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) TaxID=156889 RepID=A0LDK6_MAGMM  ali  29  14.PATLEEARVVILPLPYEGTVSYGTGTSQGPRAILEASKQLEVWDELHGRELPELPTHTLQPPSLENLNPEQVVQRIYATTLPHLQAGRMVVGLGGEHSVTEGVIKAYQTIHGDFTVVQIDAHADLRNSYHDTPHSHACIMRRVWDMGL--NAVQLGIRSISREEIRHVRYNGLRIFWARDIQWLDRMGALLKPK-VFLTIDLDGFDPSVVPGTGTPEPGGLDWYMVGEIIDRITAQ-CEIIGFDITELAPIP-NQQASEFLAARLVQRILGYI....... 294
364 3.000e-95UniRef50_A0A1V5ZI01 N(1)-aminopropylagmatine ureohydrolase n=1 Tax=Candidatus Latescibacteria bacterium ADurb.Bin168 TaxID=1852850 RepID=A0A1V5ZI01_9  ali  31  29......EARVCILPIPYESTTTYRGGTRSGPAAIVDASRYVETYDEETLCDLADIPILTLPGVSPLLGAAEAMSERIRDVAREVVSPDRLLISLGGEHAITAPLVEAHLEKFGHLTVVHLDAHADLRESYEGSRMSHASVIKRVAEHTD---VLSVGVRSISSEEMHWLRQQRVRVIFAHEIRSDQSLLERVLGENVYLTIDVDVLDPGVMPGVGTPEPGGLSYDQVVHVIKRL-TKGCSIVGADLVELAPVPG-NVVSEFTAARIVAKIVAY........ 294
365 4.000e-95UniRef50_A0A2V3JUQ0 Agmatinase n=1 Tax=ANME-2 cluster archaeon TaxID=2056317 RepID=A0A2V3JUQ0_9EURY  ali  35  12..STYEDARFVIFGVPFDATSSFRRGSADAPDAMRKASYNFETYNDFYGIDLADIPTHDLGNLDLAYLDLGRGLDDMGDAVRGVIRDSKVPIVLGGEHTLTYGCTRAFSEVYDDIGIIILDAHLDLRDEYLGAKQSHACVSRNIIDDL-TDRCVLIGVRSGSAEEYRYARENGIMWHSADEVSVMGQAIAALSDRRIYLSIDADVIDPGYAPGVGNPEPFGLDPRDLRAAIRMVA---PHVCGFDIVEISPGYDHGE-SVILGARLVREFIAAKSTRQKVG 298
366 4.000e-95UniRef50_Q5SJ85 N(1)-aminopropylagmatine ureohydrolase n=30 Tax=Deinococcus-Thermus TaxID=1297 RepID=SEPBH_THET8  ali  28  10..TPYEEARVVVLPVPYDLSLSFLPGARRGPEAILLASRELEPFLLELGAAPEEVGIHAAEPVPWVAGMAEESHRLIREEALRHLRAGKWVVALGGDHSVTHPLVQAHREALGDFSLLHVDAHADLYPEWQGSVYSHASPFYRLLTEGFP--LVQVGIRAMDRDSLRLARKKGVALFPAHRIHRLDEILRALG-KRVYISLDFDALDPSLMPSVGTPLPGGLSYRQVVDLLEAVFREK-EVVGMDFVELSPNQFHAEMT---AAQLVYHAIGL........ 278
367 4.000e-95UniRef50_A0A136K1U5 Agmatinase n=1 Tax=Acidobacteria bacterium OLB17 TaxID=1617423 RepID=A0A136K1U5_9BACT  ali  29  12..SSLDTAEILVWPVAYEGTVSYGTGTEAGAMAIVDASRNMELYEEETDAEVYKLGIHTLAEFKPRPT-PAEMMGDLYEEAKRLVGLDKFVCMLGGEHSVSAPVIRAHAEKYENLSVLQIDAHADLRDSYDGTEHSHASIMARVVKDLKI-PSVQVGIRSISSEEARSLKELPTRIFWARDIDWIDDAVNSL-TENVYLTIDIDGLDPSIVPTTGTPEPGGLGWYETLELIRKLAGSK-RVVGMDLVEYSYVPGQDAV-AFLCSKLVYKSLAYIFR..... 285
368 4.000e-95UniRef50_A0A2H5YU77 Guanidinobutyrase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5YU77_9BACT  ali  28  84........DVAFVGVPLDTGTTFRSGTRWGPEAMRRISSLSGGANLVLGVDLESLTMVDVGDVSVIPANIEKSFDQIDKAIGYIIERGVFPVVLGGDHSIGYPDIRGLARYDGNVGIIHFDRHSDLSEYNMDERM-HGTPFFHATNIPPPTNLVQIGIGGWSRDGLRNARERKATVITIDDIDRIERICEYANARCVYLSFDIDCMDPAFAPGTGTPEPGGLLPREVFQMLRLIAREG--LVGMEVVEVSPPYDVADVTSLLGTRVIMEVLGTLVLNRKLG 367
369 4.000e-95UniRef50_A0A2H5W3Y0 Guanidinobutyrase n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W3Y0_9BACT  ali  27  24..EDLAWADIAVLGVPIDMATTNRPGARYGPRAIREASMLY-TYDEERKTILQGYHLLDCGDVPVLASELQVTFDRITAAARMLFERPLFPVFLGGDHSMTYPILRAWPG-HAPVHVVHFDTHMDVLDQLDGARFTHGSPFRHVMTLPFFDGLTQVGIRGILNDEV-YHRELGFTVLTTGDIKLPAAWTDRLRGKNVYISIDIDVFDPSIAPGTGTPEPGGLTYWEARLLLREVCTRN-RVIGLDVVEVAPPYDVAGLTAHLAARVIIDVLGYVLGNKHK. 323
370 5.000e-95UniRef50_UPI0007131E7B agmatinase n=2 Tax=Rhizobiales TaxID=356 RepID=UPI0007131E7B  ali  28  26.ATSLKELDAAIIGLPSDSGGPYRTGARFAPNAVRAMSVMLRPINPYRGNIFEALRVADVGDANVVPGYEIQSLERIEESVSALVSAGIVPFGIGGDHSITLAELRALAKVQGPISLVHFDSHTDTWDSYFGQKYSAGTPFRRGVEEIDTASSIQIGMRGFQKTDIRQSIELGYEVLTLGPRALADRIASRVAGKPVFISFDMDFVDPSAAPAVQTPEAGGPTARETLQIIRAL--HGIDLVGCDVVEANPLYDSTGITALLAATIMAEFLALLASRR... 314
371 5.000e-95UniRef50_C3ZD81 Uncharacterized protein (Fragment) n=2 Tax=Chordata TaxID=7711 RepID=C3ZD81_BRAFL  ali  28  4..................................................PFDSLQVADIGDVFINMYDLKDAVKKIREAYSKIVANGCKPLTLGGDHTLTYPILQAIKTKYGPVGLVHVDAHADTSDKQLGEKISHGTPFRRAVELLDCQRVLQIGLRGYSSDDYGWSRQQGFRVVQAEEIWLMEEVRAQMGDGPVYLSFDIDALDPAYAPGTGTPEIGGLTSHQGLEIIRG--CRGLNLVGGDLVEVSPAYDPSGNTALTAANLLFEMLCVL....... 235
372 5.000e-95UniRef50_A0A2N2GWL7 Agmatinase n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-22 TaxID=2013750 RepID=A0A2N2GWL7_9DELT  ali  28  20.....DSPEIVLLPVPYDSTTSYRPGSRDAPAAIIEASRNMETYDEALDVDVADLPIGTLEPLMPRMAGPQAMGEAIEAAVAHHLEAGRMVVTLGGEHSVTIGAARAYAARFPGLQFLHIDAHADLREEYEGTPENHACVARRLVDLGP---LVEVGIRSLSAPEMDFVRARNLRIFWAREIEWVSAVVGALDPAPLYVTLDVDVLDPSIMAATGTPEPGGLLYHHLTRLLQAVF-TGRRVVGFDVVELMPIPGMIAPD-FLVSRLLLRMLALYASTR... 293
373 6.000e-95UniRef50_UPI000416D35F agmatinase n=1 Tax=Syntrophorhabdus aromaticivorans TaxID=328301 RepID=UPI000416D35F  ali  42  20.........IIMLGCPLDATSSFRGGTKFAPDSIRKASWTLETYSPYCKRDLDEMMFHDAGNLELRPGDLEYSLDFIEGAVSEIAGKGRKPLVFGGEHLVTYPILKAMQQFFRDMQVVHFDAHCDLRDEYEGQRLSHATVMKRVKESG-IEDFSQIGIRSGTRQEFEELL----------PVDSPAALAARLDNRPVYITFDMDVLDPSLVAGVTTPEPGGLMFNEAVGYFSVL--MGMNIVGADIVELAPDYDTTFVSSVTAAKVAREILMLLHA..... 274
374 6.000e-95UniRef50_A0A0W0SCJ6 Agmatinase n=7 Tax=Legionella TaxID=445 RepID=A0A0W0SCJ6_9GAMM  ali  29  31.TRNLQGVDLAVYGVPFDLSTFNRSGARFGPRSIRDLSCYLSTCWPHTYRLNEKFKIIDYGDIGFFPGQINHMLENVEGAINELCSHGIFTLGLGGDHLVAYPAIKALAGKHGKLSLIHFDAHTDT---VQMPHLTHGSMFYYAAGLIDPEYSVQIGIRTSVPETPKLHVITANQCFQMGSQGVVEQIKKIVGDRKCYISLDVDCMDPAFTPGTGTPMPGGLSSAMQREILWGLV--GLNMVGGDVVEVSPPYDVAQTTALVGATVAIDMLHILGDAK... 307
375 6.000e-95UniRef50_A0A256ZQK4 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon ex4484_2 TaxID=2012506 RepID=A0A256ZQK4_9EURY  ali  28  15...EYKKAGVVFLLAPYEATVSWGKGTSKGPKAVMDAFLNLELFDEELVSSPFEVGISLL-ELELEGMKPLEAVRMVRDKTAGVLGDGKFPVLVGGEHSLSVGMVEAFIERYSDLSILQLDAHADLRDEFRGEKYSHACVMSRVREMADA---VQVGVRSLSREENELIKKRGYTLLWARDIKWFREAIDALED-NVYLTIDLDVFDPSIMPSVGTPEPGGLDWYLLLDFLKLLCRE-RNVVGFDVVEFSPIKDFSSPD-YLAARLLYKLVGYVFA..... 284
376 6.000e-95UniRef50_D9PZQ8 Agmatinase n=8 Tax=Acidilobales TaxID=871006 RepID=D9PZQ8_ACIS3  ali  35  23......KSKYRIIGVPYDSTTSFRPGTRFGPDAVRLAAAGLESNSAFIDVYLEDLSPLDEGDVAVSIGDTGETLARVEAVVRELASAG-LPVMIGGEHTVTLGALRALADRKP--CVVMFDAHLDLRNEYLGLKVGHATFMRRALEQVNIPRLIYIGARAFSREELEFARSKDNDLITLGPINVASNVLSALKCESTYLTVDMDAFDPAYAPGVGNPEPLGLAPYEGLYLVSRIVDE--RLIGMDVVEVSPHYDPGGGTAALAAKVLIEAMLKHYVSRAK. 301
377 6.000e-95UniRef50_A0A257LB21 Agmatinase n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A257LB21_9BACT  ali  28  19..CSYEKSKYVIQSAPYEYTSSYLAGSFKGPAAMIKASQFVELYDEELDQESYKGGICTLHPMDFTDRVDLKAVKHIEKHTQRLLADNKFPVTLGAEHTITYGTVRAVKQFVPDVHVLQIDAHSDLRQEYHGNKYSHASVMARIHDLEVP--LTQIGIRAQCIEESQLIKDSAIHTFYAHNVRWAKEALKTLG-ENVYISIDADGFDPSIVPAVGTAEPNGMLWNETIEFLKMVIA-KRNVVGFDVVEIAPVKG-NILTEYTMAKLIYKLIGYQTLKDK.. 296
378 6.000e-95UniRef50_A0A2S0UX88 Agmatinase n=4 Tax=Bacteria TaxID=2 RepID=A0A2S0UX88_9GAMM  ali  23  14..TDNQAFKVALLGIPFDDNSSFERGPALAPSKIREVLNNGSLNSTELGINLRESKLWDAGNVEITSSDN--FIENIEQRCDELLAQNTRLVTLGGDHSISYPILKSYRKYFDKLSILHIDAHSDLYDSFKGNRYSNACPFARVMEDGLCDRLVQVGIRTLNLHQTEQIKKFNVESLEMRNWPLSQPLK---FDHPVYLSLDIDGIDPAFAPGVSHREPGGLTTREVINLIHQI---NMPLVGADIVEYNPNKDIDNMTSQLAAKLVKEVAGKM....... 279
379 7.000e-95UniRef50_A0A1D2W6G1 Agmatinase n=4 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A1D2W6G1_9EURY  ali  32  24.TTNLKNVDVALIGIPFDQGTTNRSGTRFGPRAVRIASQNYGAYDLEQKKHLHDVTLIDYGDVPILPTSTATNMKMIYDTFKKVIESNVFPVGFGGDHSITFPILEAF---DVDFDIVHFDTHLDFTDNVSNVKFSHASPIKRASGLKTVNNITQIGIRGFTKANYDEAKKYNSKIITASDVGIQWTLGKIPETENIYVTLDIDALDISAVPGTGTPEPGGLNYLQMREILQNLPVKG-NIIGFDVVEVNPLYDAGNITSQVASRLALDLLGSIYSK.... 309
380 8.000e-95UniRef50_A0A066PKC8 Agmatinase SpeB n=19 Tax=root TaxID=1 RepID=A0A066PKC8_9PROT  ali  27  27......DAAHVVAGIPLDVGVTNRAGTRSGPAAIRVASRMLAGHHPHYRVMVDDMDLADAGDFAIALGDLPGSLALIEAQAAQIGH----LVALGGEHGITLPLLRALAKRGGPVGLVHFDAHADTWAENFGQVYSHGSVFYHALGLVDPRRMIQIGIRSPLNEAHDWTLAQGVDVHEQGVDRVAERIRAVAGTGATYLSFDIDCLDPAFAPGTGTPEIGGLASWQAQALLRRLG--GIDFVGMDLVEVAPAYDVSEITALAGATMVWEYLALLASQGR.. 304
381 9.000e-95UniRef50_A0A1F9L148 Agmatinase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9L148_9DELT  ali  26  19........RIAILSAPLASSVSWLGGTELGPQAIIDASPALEVFDDELLSETVRLGIATRPCPDFTAITAAEACRQIQAAVAAELAGGMFPVLLGGEHTVTVPAVKACLAKYPDLHVVQIDAHLDLRQEYEGNENSHACVMRRLDDLGIPF--TQIGIRSFSREEYELVKARGLRPFFLHEADWIAQVCAGIKG-PVYLTCDVDGLDPAIIPATGTPEPDGLTWRETIDLLRALAAKH-RLVGMDFVELAPRPG-AEHAAFTVAKLIYRTLGYVFREGQPG 290
382 9.000e-95UniRef50_A0A0M0BE93 Uncharacterized protein n=1 Tax=miscellaneous Crenarchaeota group archaeon SMTZ1-55 TaxID=1685133 RepID=A0A0M0BE93_9ARCH  ali  29  6..TSFDEAKFIIIPVPYDSTVSYQSGSRNAPHSILTASRNLELFDLELAQEPYQRGVFTLNEVEPIRGDVSATMDLICHLTKDMLDRGKIPILLGGEHTITLGAVTAFPN---EVVVVDLDAHSDLRESYQGDPICHASVMRRIWEQG--KELLEIGVRSMSREEYTFIIIYRDAIRRRGLDDVVADIRQRIEGRQVYLSIDVVVFDPSEAPGVSTPEPDGLSFGEVTAIVRAIC-HASHVVGLDVVEVAPIPG-SAVTEFLAAKILYKTLGYL....... 276
383 1.000e-94UniRef50_A0A2G5WYS3 Agmatinase n=10 Tax=Sporosarcina TaxID=1569 RepID=A0A2G5WYS3_9BACL  ali  27  27......DADIAVLGVPYDTGVGFLSGCRFGPRRIREVSTHYAFYDPERDEVFGDVKIVDAGDADVIHGDIEQAFTAIEYAVAKIREKGAIPAIMGGDHSISIPVARALKDE-GDITVIQLDAHLDWSDAPGGQTLGNGSPMRRMSEMDHIKDMVQIGLRGLRKEDFDAAKAYGSELISARDSAGVEGILNKIKADKYYVTIDIDCFDISLATGTGSPSPGGFSFDFLNDILIGIAEKG-NVVCFDLVEVAPQYDPTGATTRVAAMTMLNFMGHILKNKEK. 311
384 1.000e-94UniRef50_A0A0A0ATK1 Uncharacterized protein (Fragment) n=18 Tax=Amniota TaxID=32524 RepID=A0A0A0ATK1_CHAVO  ali  29  1...........................................YNGSTGAAPFDLQVADIGDVNVNLYNLPDSCRLIQESYRKIVASGCVPLTLGGDHTITYPILQAVAEKHGPVGLVHVDAHTDTGDRALGEKIYHGTPFRRCVELLDCSRVVQIGIRSYDPDPYKYCRDQGFRVVLAEECWLMAEVRKQMGDKPVYISFDIDGLDPAYAPGTGTPEIAGLTPAQALEIIRG--CKGLNIVGCDLVEVAPMYDVSGNTALLAANLLFEMLCVL....... 240
385 1.000e-94UniRef50_A0A218NMJ2 Agmatinase n=6 Tax=root TaxID=1 RepID=A0A218NMJ2_9ARCH  ali  29  18..SDYDKAKVVAIPIPYDSTTSYRSGSREGPHAVIEASRNIELYSEILEKDISRMGIYTTEEILPDVSSPENMVKRIESEVSHFLDDEKIPLVIGGEHTVMVGSLRAVSNKYGKFSVLHFDAHSDSRDSFMGSKYSHACVMARARELCD--SCYSVGVRSIDEEDYRKYKDYMKDINSMDDDSIADMIIRSTK-KKLYFTFDLDVMDPSEMPSVGTPEPDGMRYKQISNILSKVFPEK-EVIGMDFTELCPIPGFTAP-NYIAAKLIYTALGYAFVANKK. 294
386 1.000e-94UniRef50_G8TSM6 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=G8TSM6_SULAD  ali  31  34......DVSVAVIGVPFDGGTTFQSGARMGPWAIRQASWGLYPYSRVHRISLADARLADAGDLRVVPMSVPDTLMLVEHQLGA-FPGGTRFLALGGDHSVTLGLLRDVVRRRGPVGLIHFDAHSDLWDELWGQRYNHATVFRRAWELILPDRTIQVGIRGSHPDEDGEADRLGITWLSQGTRTTIHQIRNRVGRGPVYLSVDLDVVDPAYAPGTGTPEAGGPSSHMLLSVLRGLA--GLSFVGADVVELAPPLDPTIASGLVAATVAQEALFLL....... 308
387 1.000e-94UniRef50_A0A1Q2MIW1 Agmatinase n=57 Tax=root TaxID=1 RepID=A0A1Q2MIW1_9BACT  ali  30  14..TSCEKSKIVILPVEYDHTSTWIKGSEKGPSALLEASKNLEFYDIETDSEVYKRGIYTDHPIRG-FIRPEEMVQAVYDRVREHMADDKFCVCIGGEHSISIGAMMAHCEKHPEATIVQFDAHSDLRDEYHGSEYNHACVMARGRELGP---VVQIGIRSMDVEEKGSADFE--SIFLAKDIAWIDRMVSLL-SENVYVTFDLDCLDVGIMPSTGTPEPGGIGWYTALEALRAIA-QNSNIVGMDISELCPNP-VNKAPDFLAAKLLYKMITYKFE..... 282
388 1.000e-94UniRef50_A0A1J4UN40 Agmatinase n=1 Tax=Candidatus Micrarchaeota archaeon CG1_02_55_22 TaxID=1805250 RepID=A0A1J4UN40_9ARCH  ali  26  17.NASFDAASVVVLPVPYDGTASYGSGAKEGPHAIISASRYLELSDYETGANASKQGIFTLDELEPARGNVVETCKRVEDAITQILESGKFPLTFGGDHSVAIGCIRAAAKKHSDLSVLALDAHLDCWDEFEGSDHSHASVHARVAGLGVRESIV--GYRSAGENELAFCKEHGVKTFSSRQDGSLTTALEYLG-ENVYVTLDLDVLDPSIMPAVGTPEPDGLSYNSVVNILEKVFSSK-KVVGMDVCELAPLQGNRAPD-FTAAKLAYNALCL........ 295
389 1.000e-94UniRef50_Q9YBG0 Agmatinase n=3 Tax=Aeropyrum TaxID=56635 RepID=Q9YBG0_AERPE  ali  33  24..RSREESLFSVIGVPYDSTSSFRPGQRFAPREIRRASIELESNGYYVEGDIDRVPIADEGDVAAVPGSTLLTLERVARVVEDLAREGKVPVVLGGEHLVTLGALRGLAAAGVKPCVVVLDAHFDLRNDYLGERFSHATVFRRVLEELGVK-LLYIGVRAYEAGEERLAVESGIDYVPMRRMDIVGAARRFTGDEKIYISIDMDFYDPAYAPGVGNPEPGGASSREGLALASQLG--DRRVCGIDVVEVSPPYDPGGATSLLAAKTLQELLISVWQR.... 303
390 2.000e-94UniRef50_Q2T3W4 Agmatinase n=267 Tax=root TaxID=1 RepID=Q2T3W4_BURTA  ali  27  51...............PLDLATTFRSGARLGPSAVRAASVQLAELNPYWGFDPFDLAVIDYGDCWFDAHHPLSIKPAIVEHARTILQSDARMLTLGGDHYITYPLLIAHAQKYGPLSLIHFDAHCDTWADDAPDSLNHGTMFYKAVGLIDPKASVQVGIRTWNDDYLGINVLDAAWVHEHGARATLERIESIVGGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLG--GVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCLW-RQRKAG 318
391 2.000e-94UniRef50_A0A2R8CES8 Agmatinase n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2R8CES8_9RHOB  ali  26  43.SVDMTGVDIGVYGIPFDLTTSGRPGARLGPSALREASAQLAWGEWPWGFDPFDLSVVDCGDVPFRRGQVEQMRDSAVAMARHISGAGAGTLMLGGDHCTTYTAIKAHAERHGPLALVQFDAHRDTQKS---NWFDHGTFVHHAMGLIDPEHSVQIGIRTHYDNDDPIKVLYRDWMHDHGWRGALEKMRQVVGNRPAYLSIDIDSLDPAYAPGTGTPVVDGLTPNDIIQFLRG--SVDVNFVGMDIVEVSPPYDHADITALLGASLALEYICARAARRKE. 320
392 2.000e-94UniRef50_UPI000D7FEAFF Arginase/deacetylase n=1 Tax=Tilletiopsis washingtonensis TaxID=58919 RepID=UPI000D7FEAFF  ali  29  66........DVALLGMPFDGGVSYRPGARFGPKAIREASRRQRTWSLEYEQAPYEALFFDCDDVPITPYDPAVALAQMEAAYVTLLQRTPLVIVLGGDHTVVLPILRALHKTYEPIAVLHFDAHLDTWKVYNQSRINHGSFFARAADEGLIDRSVHAGLRCRTDDQVGFERVMTSDLDLLGREGVIERIRSRIGDRPVYLSIDIDVLDPSAAPGTGTLETGGWTTRELHGILRGL--RGLNWIGADIVEVSPPYDHAEITAYAASDLVFEIANLFA...... 371
393 2.000e-94UniRef50_A0A2D7HZ37 Agmatinase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D7HZ37_9DELT  ali  27  50.THDLTGADVAILGVPADLTVSNRPGTRFGPRSIRAASAHLSWGEWPWGFDPFRLAVVDVGDVVFEAGYVDSLLSATEERADWILSQDVSMVTLGGEHLISLPVMRAHARKHGPLAMVHFDAHSDTW--VDDLPLNHGTMFHEALELIDTDHSIHVGIRTHNHEDHGIETLDGFWVDEHGAEATAARIKERVGDRKAYLTFDIDCLDPCYAPGTGTPVTGGPSTAWARRVFASL--HGIDFIGMDIVEVAPDYDVAEVTSLAAATLVYDYLCLMAK..... 324
394 2.000e-94UniRef50_G9A401 Agmatinase n=66 Tax=Alphaproteobacteria TaxID=28211 RepID=G9A401_RHIFH  ali  26  36.SKQLKGADAVVWGIPFDAATSNRPGARFGPQAIRRASAIFD-NDPQYPFEFADMATIDYGDCLLDYGNHAKTPATIEREAAKILKSGAYLLTLGGDHFVTYPILKAHAALHGPLALVQFDAHQDTWPDEKG-RIDHGSFVGRAAGLIDVERSIQIGIRTHAPEDCGIRIVYGYEVEEMRAEEIAETIVRHVGSHSAYLTFDIDCLDPAYAPGTGTPVAGGPSSAKILSVLRKLGA--LHIAGSDVVEVAPAYDHADLTAIAGSTIAMYMLGLRAEAERRG 318
395 2.000e-94UniRef50_R7U7L0 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7U7L0_CAPTE  ali  26  10.ASDTEGLDACFVGVPFDAGTATKTGSKLAPTQIRVESDVVRPFNQDTGADPHNIRVADVGNIACSPFDIREACKTIKEKCDGIVKGGCRPIVLGGDRTITYPILQSMKEKHGPVGMIQIDAHCDTSLPLFGSEIWHGSPFRLAVGLLDCHKVWQIGIRGGSITCAKWGQDKGFNVVPAFQLWLMRDVREKMGNTPVYLTIDIDGLDPSIAPGTGVPELGGLTSTQALEVIRG--CRGLNVVGGDLVEVSPPHDLHNITSTIAAHLLFEMLCIL....... 291
396 2.000e-94UniRef50_A0A1Y5TSU5 Proclavaminate amidinohydrolase n=19 Tax=Bacteria TaxID=2 RepID=A0A1Y5TSU5_9RHOB  ali  28  39......DADVAVLGAPYDFGCQWRSGARFGPRAIREASTLFSFYDFEDDIPAETTKIVDIGDADIIHTDTINSHANIEAGVRAILKSGALPVVLGGDHSINIPCINAFDDQD-PIHLVQIDAHLDFVDERHGVRYGHGNPMRRAAEKEYVTGLTQLGIRNVSKEGYEQAREMGSDILSLGVQGVLDRV---PEGKRYYVSIDIDAFDPSIAPGTGTPSHGGFQYYEVLEFLDGLSKRGT-IVGIDLVEVAPDYDHSGSTSTLAAQVLMNLIGRILHNR... 322
397 2.000e-94UniRef50_A0A0G0QGI5 Arginase n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0QGI5_9BACT  ali  27  16...PPEEAEVLVLPIPLEATVSYGKGTGRGPRAIITASQQVEQYDHELGYEVQKVKIATLPAINFPEQNAEKAQDIISNVAKNW--TNKFLLSLGGEHSITPAIVSEYKKKYPDLSILYFDAHTDMREEWDGTKWSHACAARRLQDNHGIKNIVWVGTRNTSLGEQQYINKEQVNY---GDKYDLKKILSQLSP-NVYISFDVDCFDVSTMPATGTPEPGGIGWYQAMEIFEAVTREK-NVVGADIAECSPIPGFHGYD-FLVAKLAFKLIGYKFRR.... 284
398 2.000e-94UniRef50_A0A1B3NLP0 Agmatinase n=42 Tax=Proteobacteria TaxID=1224 RepID=A0A1B3NLP0_9BRAD  ali  25  63...DLGGLDVAIIGLPMDLGVTNRAGTRLGPRAVR-AIERIGPMDHVMGTPLGMLKAADIGDVPFSRYSLESCHEDIEATFRTIVEAGVSPLAVGGDHSITYSILRAVGAR-RPVGMVHIDAHCDTSGPYEGSKFHHGGPFRQAVGVLDPQRVIQIGIRGGAEYLWEFSYESGMTVIHAGIEAVIAKARAVIGDGPTYVSFDVDSLDPAFAPGTGTPEVGGLTPREALAILRGL--KGADIVAADVVEIAPQYDATSNTAHCAAQVLFTELCLIAEARALG 346
399 2.000e-94UniRef50_F8JCJ5 Agmatinase n=3 Tax=Hyphomicrobium TaxID=81 RepID=F8JCJ5_HYPSM  ali  28  49........DFAVLGVPLDIATSNRPGARLGPDAVRCASAQLAELKAYPGNPLSYVNVVDLGDAWLDYGFPQTIPAAIEDAATKVVETGAFLCSLGGDHFISYPLLKAHAKVHGQLTLIHFDAHTDTWTPRVGRELNHGTMFAQAIGLIDPAKSSQIGIRTWVDDPKGMNIFDNMVVADKGASAVASMVKALAGDNPCYLTVDIDCLDPAFAPGTGTPVTGGLMPRELLAMLRQL--DGLKIVGCDVVEVAPSYDQGGVTALAAATVVYEQACRVARQ.... 323
400 3.000e-94UniRef50_A0A2E7HH87 Agmatinase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E7HH87_9PROT  ali  24  36.TKSLVGADVVVSGIPYDIGTTNRAGTRFGPRAIRQASSHIAWFDFD---PFHRLAVIDWGDHDFDIGCTEGMMASVEASTATFLEAGCFPMTMGGDHLVTYPLLKAVAKQHGKLSLVHFDAHTDTSKS---DKLNHGTMFWHAMGLIDPGRSIHTGIRMAVGWDDGFDKIGGWDAARLPAKEIGQRIRDVVGKNKAYLTFDIDFLDPAYAPGTGTPVVGGPTTMQALDILMEL--RGINFVGMDLVEVAPEHDNGEITSLAGASMMYHVLHLLAENR... 312
401 3.000e-94UniRef50_A0A0M6YD72 Agmatinase n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M6YD72_9RHOB  ali  28  43.SLDFETADLAVYGIPFDLTTSGRSGARLGPSALREASTQLAWGEWPWGFDPFDLSVVDAGDIPFRRGQVQQMLDSATEFARRICAGGASTIMLGGDHCTTYTALKAHAEKHGPLALVQFDAHRDTQESDF---LDHGTFVYHAIGLIDPSRSIQIGIRTYYEDNDPMTVLYRDWLHEHGWRGALEKIRALVGDRPAYLSIDIDSLDPAFAPGTGTPVVDGLQPNDIISVLRDTV--DINFVGMDLVEVAPPYDLSGSTALLGASLILEYICARAAR.... 317
402 3.000e-94UniRef50_A0A1V6LXU1 Agmatinase n=2 Tax=Candidatus Brocadia sapporoensis TaxID=392547 RepID=A0A1V6LXU1_9BACT  ali  27  29....YNNSGVVVIGVPFDGTATYQPGTKFGPNAILNASVNIEPYDDESG-EIYTIGIFTIGDVEEIHTDAKKVVDTLYKASKAIVKDNKFLVTLGGEHSLSQGVIRAYKEKYRKLSILQLDAHLDLMEQFGGTSFSHASVSRRVVEDLKCK-VTSFGVRVVSKEELMFVQKKKISVFYAKDIDWHDQALETLED-HVYITLDVDGFDTSIMPATGTPVPGGLSWYRTIDFLRKVY-KNKKVVGFDVVELKPNPG-DEAPNFLVANLVYKNIGFYKK..... 303
403 3.000e-94UniRef50_A0A1V6CQY1 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Planctomycetes bacterium ADurb.Bin126 TaxID=1852903 RepID=A0A1V6CQY1_9BACT  ali  26  15.ACEAAKARYAVLPVPYEGTVTFMRGTADAPAAIIDASAQVEEYDEELAQDFRAAGIVTLSSI-MPAETPEEQMRRVASTARAVMRSGKFLLTLGGEHSITAPLVRAAAEQHGEISVLQIDAHADLRDTYKGSTHSHACVMRRVLEVTD--HVAQVGIRNFSQEECAECPRQVERFITPSDPDWIDRVLSLLG-EKVYVTVDVDGFDPAYVPGTGTPEPGGLTWRQVTALLRRICAE-RQVVSADIVEVVPLPG-QKVSEFLAARLAYKIIAY........ 284
404 4.000e-94UniRef50_B6BS05 Agmatinase n=77 Tax=Bacteria TaxID=2 RepID=B6BS05_9PROT  ali  29  22........KVVVVPFGLEKTVSYGGGTKNGPKEIIKASHQVELYDEELNCEPYKIGIKTLKPFKID-KNIKKALNKMSKINQEILDKNLFPITFGGEHSITPGCIDPFTKKFKDICLLHFDAHADLRESYNEEKFSHASAIRRCLDYSNVS-VISFGIRNISQSEIPFLKKNRIDIFWAKDKWNLNKFKKLIKNKTVYLTFDVDGLDSSIMPATGTPEPGGLLWDETLNIIK-IAAKNSKIVGADINELAPIKGFNSY-NFLVAKLAYKILSY........ 287
405 4.000e-94UniRef50_A0A1Q9N7S4 Guanidinobutyrase n=1 Tax=Candidatus Odinarchaeota archaeon LCB_4 TaxID=1841599 RepID=A0A1Q9N7S4_9ARCH  ali  30  17LNISYNDAEFIVLGVPLDSTSSYIPGARFGPDSIRRASINIETYDYTTGFDVRESKLADIGDIDVDYSSIDLTLDKITKVLSEILTDRKKPIILGGEHTITLGVCRAV----KPQMMICFDAHLDLREEYAGARISHATFMRRVFEEGIVEKTLFIGTRAVSREESKFMKKSGHRVITA------KEVYEKDSPSHVYISIDMDVLEPAVAPSVGNPEPGGLSYNFVSEVIEKL---DGVLIGVDLTEVTPLYNID-ITSIYAAKLIFKAISSMSKSK... 294
406 4.000e-94UniRef50_C5BAV1 Agmatinase n=22 Tax=Proteobacteria TaxID=1224 RepID=SPEB_EDWI9  ali  25  22LPLDFGDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEGKRWPWNFDRLKVVDCGDVVFSFGDAQEMSDNLQAHAERLLASGKRCLTFGGDHFITLPLLRAHAKHFGKMALVHFDAHTDTY--AHGSKFDHGTMFFHAEGLIDPQHSVQIGIRTEYDHDNGFTVLDAAQVNDRSVEDVLAEVKRIVGDLPVYLTFDIDCLDPAHAPGTGTPVIGGLTSDRALKLVRGL--QDLDIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKK... 304
407 5.000e-94UniRef50_A0A0S8AWP5 Uncharacterized protein n=2 Tax=Gemmatimonas sp. SG8_28 TaxID=1703357 RepID=A0A0S8AWP5_9BACT  ali  26  31.........IAILPVPYEATVSYMGGTCFGPRALLHASRFVEVYDHELDAEPYQVGVTTLPELVLSGAGPHAALEELRHAYETLLDERKFVIMLGGEHAISPPILTHAARTRGRLSVLQLDAHADLRPEYEGTPLSHASVMYRVSEQVD---LMPVGIRSLTVDERALMRDRGIEPHELHTPGWIERVLDGLGDE-VYLTFDVDYFDPSIMPATGTPEPGGGSWYPTLTLLEAVFREK-RVVGCDVVELAPIPGVVDPD-FTAAKLVYKLVGFWERYQR.. 298
408 6.000e-94UniRef50_A0A1G2FQ31 Agmatinase n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2FQ31_9BACT  ali  26  12.AKSFLGAQIIIVSFGFEGTTTYGHGADKGPEAIIEASNQVELFDEELWQETYKVAIATMPEKKPV-------LKNLELAVREILKNKKLPIVLGGEHSITPFIIGEYKKAFNDFSILQFDAHADLRDGYLGEKYSHAAAMRRCLDL-DGINLVQVGIRSNEDDELNFWEKNQTRIKTFWAKDVIDEIVKSLKDK-VYITFDVDAFDCALMPSTGTPEPGGLDWYETLDILRAVCAKK-KIIGADFVELAPIKNFHAPD-FLVAKLIYKFIGYLFNK.... 296
409 7.000e-94UniRef50_A0A284R5A1 Related to agmatinase n=1 Tax=Armillaria ostoyae TaxID=47428 RepID=A0A284R5A1_9AGAR  ali  27  129........DIAFIGAPFDTGTSYRPGARFGPAGIRTGSRRLTLYNVPLESNPFQLKIVDCGDIPVTPYDNKVAIKQIEEGHKALLKHHPRVITLGGDHTIVLPLLRSIYSAYGPISVIHFDSHLDTWKPFGGAPINHGTYFYWASQEGLIKNCSHGAIRTTNDDDAGFKRIEAREIDVIGTDGIIKKIRETVGDAPVYLSIDIDSIDPAFAPATGTPETGGWSTREIRTILRGL--DGLHLVGADIVEVAPAYDTNELTTIAAADVLFEVLTVMAK..... 448
410 7.000e-94UniRef50_A0A1Z9AJM6 Agmatinase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z9AJM6_9GAMM  ali  29  36.TQDIAGADLVVSGLPFDLATTFRPGARFGPQAIRAASVQLEIADHAFDDPFSHLAVADYGDVDFVSGYPDQAVAVIEAHAQKLLAEDVTMLTFGGDHFVTYPLLKAHAKKYGPLSLIHFDAHVDTWPD-DGEQLDHGSMFLRALGLIDPHTSVQIGIRSFSEDDYGFTVMSSPWVAENGVRATVLEIQKVVGRRKAYLTFDIDCLDPAFAPGTGTPVAGGLSSLDALTILRGLGQ--IDIVGMDVVEVAPAYDHSEITAIAAATLAHDFICLKAWQKKR. 317
411 7.000e-94UniRef50_A2QBG2 Aspergillus niger contig An01c0490, genomic contig n=149 Tax=Eukaryota TaxID=2759 RepID=A2QBG2_ASPNC  ali  25  54LTNPDTPFDIGIIGTPFDTAVSYRPGARMGPRAIRTASARHRAFHAAAQINPYWAKVLDCGDIPVTPFDNAVAIHQMTEAYRELGSRKPKLITLGGDHLVALPALRALRESYGPMALLHFDSHLDSLHPDMQSQFNHGSVFWNAMGLISNSSSLHAGIQDLDDDDKGFLRIAADEVDSIGAAGIIDRIHQHIKDQPVYMSIDIDVLDPAFAPGTGAPEPGGWTTREMIKILRGV--MDLNIVGADIVEVAPAYDPGGETAYLAANLAYELVTGMVAREQK. 366
412 8.000e-94UniRef50_A0A1V5QNT6 Agmatinase n=1 Tax=Acidobacteria bacterium ADurb.Bin340 TaxID=1852787 RepID=A0A1V5QNT6_9BACT  ali  39  13.SREPDEADIALFGVCWDGTSSYKAGSRFAGFAVREASFGMEEFSFYQQQSLLDVPFCDYGDLFLPPGQKERVLADVASAVAEIRAKGQFPLGFGGEHLMAYPLIMAAFEAHPDLAVIHMDAHADLRPELWDDPWTHATFLGRVADRIGWDRITQFGIRSGSREEWELAQAHGT--LRPFTVDALAAHLKTLGDRPIYLTLDMDVLDPSLYPGTGTPEPGGITWDLLVAGLKLL--KGHRLVGGDCLELAPHYDPTGVSAMTMAKTLREIILLAHQRAR.. 286
413 8.000e-94UniRef50_A0A2D8RLE7 Agmatinase n=1 Tax=Opitutaceae bacterium TaxID=2006848 RepID=A0A2D8RLE7_9BACT  ali  36  23..........VILGVPYDRTASFRKGTAKGPDGIRTISAAIETYSPVQDKDLEYIVYADIGNLDVDEGAPDSVGEALKLAVDEIYRQKALPIILGGEHSISPGAIQAAFQRYPDLVVVQFDAHADLRESYEGTGNSHACAMRRTLDFLPSERLLQIGIRSGTREEYQELEKSG-RYIPADAATLDERLAEDFSSRPIYITFDIDIFDPSEIPGTGTPEAGGIRWGDF-ESLRAVFDR-RNIVGLDIVELAPELDPTGISSALAAKMLREWLLTIVKRR... 290
414 9.000e-94UniRef50_A0A1Y0N5M4 Guanidinobutyrase n=4 Tax=root TaxID=1 RepID=A0A1Y0N5M4_9BURK  ali  28  26.........YALAGIPFDGAVTNRPGARFGPQEIRRASLMLDGLHPVFEVSP-LAHLGDAGDMALPNASPLKVVREAIETQAALLMDKHHCVFLGGDHSVTLPLLRALKRRHGQVALIHFDAHCDTWEDHFGEPSGHGTWTFEAIGLVVPEKTVQIGLRSGERAAREYVKDQGGLIFTARDLGVISQIRERLGDTPCYLTLDIDCLDPAFAPGTGTPEPGGMTSSQVLTLLEELAP--LHFVGMDCVEVAPAYDHAELTSNAAATFVWTYLSGIAKASK.. 306
415 9.000e-94UniRef50_A0A0G3W637 Agmatinase SpeB n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0G3W637_9CLOT  ali  28  16.....DEADVVVLGIPFDSAVSNRKGAAEAPDKLRELSRILPPVTEE-GLLLKNFKVYDHENVEII-LDWEKYFKQVEDTASSLMKTGKTCLFIGGDHAVTIPLETAFAKVHEKIGIIHFDSHPDIIDTYDGHPWSHACTQRRALELIAPEDLTFVGLRSYMEEELAYFQKHAREVYRKGIDDVLDILKEKYKDTKLYVTLDIDVLDPAFAPGTGTPEAGGLSTRELMEMVREIILT-LPVAVVDIVEVAPPLDSSDITSWAALKIIYEIFGAVYKKKMR. 299
416 1.000e-93UniRef50_A0A0L0NGJ5 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0NGJ5_9HYPO  ali  28  70.......YDIAIIGAPFDTAVSFRPGARFGPRAIRQASSRFRGFNPRASINPYWAKIIDCGDIPITPFDNNIAREQMTQALTQLLSXKPKLMTLGGDHSLTLPALRALKEIYGPVRVLHFDAHLDTWPSYWGATFTHGSMFWMANQEGLLSNSVHAGLRAWADNEDDWVRFSADDMDEIGTAGIIAGIMDTLGTDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGI--EGLNLVGADVVEVSPAYGRGEETALAAAQVVYELLSSMVKR.... 383
417 1.000e-93UniRef50_A0A0A7LD43 SpeB protein n=8 Tax=Euryarchaeota TaxID=28890 RepID=A0A0A7LD43_9EURY  ali  29  12..SDYDSADAFLLGIPYDRTSSFKSGAAEAPAHIRRASYNFEELHFEHGLDLPRLNIFDQGDCEHVFL-PEDMMEEVKFFISPAIRDKKFTVAVGGEHSINMPIIQCFKKN--DIALITIDAHLDSRDEYLGTPYSHACVTRRAAEHLGIDNVFALGVRSISKEELERDDVTSFEIKEKGIERAVKKALDSVKSEHVYLSLDIDGIDPAYAPGTGTPEPFGLDPLDVKRTINLI---GGRLVGFDVTEVCPPADPSGITSALAARFINEVLAVHSK..... 283
418 1.000e-93UniRef50_A0A1V6CC10 N(1)-aminopropylagmatine ureohydrolase n=1 Tax=candidate division TA06 bacterium ADurb.Bin131 TaxID=1852827 RepID=A0A1V6CC10_9BAC  ali  32  19......KARFIILPIPYEGTISFKPGTRFAPEAIIFSSRYMELYEEETNTQPWENGIITLSEITQDXXXXXXXXXXXXXXXXXXXXXNKFVFALGGEHSISFPIISEYKHKYPDLRVLHFDAHADLRKQYEGSKFSHASVMRRISEL--NCEIYSFGIRSLSNEEAKDLQELNVHIHFAHNQALIDKA-DSLPDGNYYISIDIDCFDPSVVPDTGTPEPGGFTWYEITDFLRKFASTH-KIIGADIVELAPS-NHYCASAFLAAKLVYKLIAYICAN.... 288
419 1.000e-93UniRef50_A0A2N6N5J7 Agmatinase n=36 Tax=Proteobacteria TaxID=1224 RepID=A0A2N6N5J7_9COXI  ali  26  20...SYKNAKAVIIPFGLEQSVSYGRGTAKGPQAMIQASHEVELFDEALWYEPYRIAIVTLEE-PKIENEIVKALQQLERLVERVLEDKKFPFIFGGEHSITAGSIRPFIKRYPNLVILHFDAHADLRDGYHGEYFSHASAIRRCLDYPNIE-VVSAGIRNISAEEIAFANQKRIHIYWAKDKWDIKKIIASFENRPIYLTFDLDGFDTSLMPATGTPEPGGLFWNDALEIIAAASQVGT-IVGADINELAPIP-HFHSCDFLAAKLAYKILSLAF...... 292
420 1.000e-93UniRef50_A0A021XBK7 Guanidinobutyrase n=9 Tax=Rhizobiales TaxID=356 RepID=A0A021XBK7_9RHIZ  ali  24  37........DIGLCGVPFDLGLNYRSGPRQGPAGVREASRIIRRIHPVTGVRPYDLTVADIGDAPINPLNKDASIDQIQAYFQEVKDAGIRPIAIGGDHTIPTPILRALA-SDRPVGILHIDAHADVMDTMCGTKVNHATFMRRAYELIDPRRVVQLGLRGFGDDDVQFGYDKGYNIITMGRAAVIEKINSVLGDGPFYISLDIDSIDPAYAPGTAVPEIGGLLPRDLQVIIRSL--QGKDLVGADISEVAPVYDPTGITCVTAANMMFEMLCVMAKAVEK. 316
421 1.000e-93UniRef50_A0A2N1W4D0 Agmatinase n=1 Tax=Candidatus Goldbacteria bacterium HGW-Goldbacteria-1 TaxID=2013807 RepID=A0A2N1W4D0_9BACT  ali  32  13.NDDIAAAEVVLAGIPYDVTSTFRHGSEEGPDSARAYSDSIETFSPDRFDDIADHKIADAGNLVLASQKPEEAVTEMEAYAESFIEKGKKVLYVCGEHLITYPLVKSYFKKHPGLKVVYFDAHADLRDNYDGNKLSHSTPARRICEMIGTENIFMFGIRSFEKQEMAYIRDN--RILCDPNMEEFLNVMDTIKNSPVYISIDVDVIDPGFLPGVGTPEAGGLSYKDFLRAVEGFSGLK-NIVAADINELSPKYDPMGASSVFVAKMIREMLLVMAGN.... 285
422 1.000e-93UniRef50_UPI0003B75FCC agmatinase n=3 Tax=Rhizobiales TaxID=356 RepID=UPI0003B75FCC  ali  26  30......DADIALLGVPYDGGNGWRPGTRFGPREIRNLSVRYGAWGDQSGRFLENIRMVDCGDVDIAFYDFERNSRLMTSSVEAILDQGAFPVIIGGDHSVTYPNVRAFSR-FKTIDIVHIDAHMDWRDNIDGVRHANAMPMRRIKELPFIRNMVHIGIRDISAEQVRDAESAGAIVITRDEVEGVRGILNRFPEGNVFVSIDIDGLDPSIAPGTGSPTPDGLLYHEVRGLLEGVAATG-NVVGFDLVEVNPMVDEGGRTCLLSSVMIMEFLGMIFANRE.. 315
423 1.000e-93UniRef50_F0G135 Agmatinase (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=F0G135_9BURK  ali  29  1.........................................................ADIGDVATNPYDLKDSVRRIEQAYDRIVANGCRPITLGGDHTIAWPILRALHRKYGKVAVVHVDAHADVNDTMFGEKIAHGTPFRRAVELLHGDKVTQIGLRGYHADDFDWCREQGFTVVQAEECWLMAQVRERVGDTPVYLSFDIDGLDPSFAPGTGTPEVGGLSVQQGLEIVRGM--KGLNIVGADLVEVSPPYDPAGTTALVGANLAFEMLCVM....... 225
424 2.000e-93UniRef50_A0A2H0XPV7 Agmatinase n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H0XPV7_9BACT  ali  27  6.NVEFDKARVVILPLPYDGTGSYRGGASRGPKAILDASQELELYDEEMDWTPADVGIFTLSP-PELPVAPELMIDRVYSIIKGLIKKNKFVVSLGGDHTVTIGAAKAYKELYPNIDFFVLDAHSDLRDKYEGNKFSHACTSRRLSEMGRVK---IVGVRSISKEEIDYIRSPPCEIAYMKDIRWMDDVIGGL-SDNIYLSLDLDVLDSGIMPSVQTPQPGGFSWYGILGFLKTLIRKK-NVLGFDVVELSPIQGNPAPD-FLAAKLVYKMIGY........ 276
425 2.000e-93UniRef50_A0A2H9SCL3 Agmatinase n=6 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9SCL3_9ARCH  ali  29  54...DYDSAGYVVVPVPFDSTACYGGNARNGPLAVMQASRQLSFYDWESKSAPIEKGIFCTRELEPVRGDARLTVERVRQACEEIVDDNKKPVLLGGEHLISLGGVQAC----KPDSVLVLDAHADAWNELEGSKWSHACVSRRMHEEGACVSVA--GVRSISEEELDYSKKKGFNVFYA-NKSTVGDVVKSLKGR-VYISVDVDVLDPSVMPSTGTPEPGGLSWEQVCSLLEAI-GQKRKVVGFDLVELAPIP-FLEAPNYLAAKLLYKMVGWF....... 314
426 2.000e-93UniRef50_A0A0F0CUJ3 Agmatinase n=3 Tax=Bacteria TaxID=2 RepID=A0A0F0CUJ3_9BACT  ali  31  19......NSKIVLLPVCYDKTSTWIKGAGKGPIALLEASPALEFYDIDTDSEVYLNGIYTAPPIKFN-GSPELLSKIVEKKILNFIDENKFTVLLGGEHSVSIGAIKAYASRFKDLSILQLDAHSDLRDEYESSKYNHACVMARAKEVAP---IVQAGIRSASSEEKNNMDYNN--IFFAKDIAGWEKKIIKKLKKNVYVTIDLDVFDPSIMKATGTPEPGGLLWYEVINLLKAVS-KNRNIVGFDVVELCPPAG-SKSDIFTAAKLVYTFLSYIFIKGAK. 287
427 2.000e-93UniRef50_A0A0C2JA98 Uncharacterized protein n=1 Tax=Sporothrix brasiliensis 5110 TaxID=1398154 RepID=A0A0C2JA98_9PEZI  ali  27  51LAASHDKPDIALLGFPYDTSTSYRPGARFGPRGIRAGSARGRSYNTVWGVDPYEQGIIDCGDIPITPFDAAHAFKQMEQGYRQVLWKHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGSALTHGTFFWHASGCIAKGTSVHGGLRTIDRDVVGFTLIEAHEIDEIGMEGIVARTRAAVGDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGL--EGVNLVGADVVEVSPPYDVAEVTSIAAADLIVDILAAMVKSKDK. 363
428 2.000e-93UniRef50_H0EBD0 Agmatinase n=9 Tax=Bacteria TaxID=2 RepID=H0EBD0_9ACTN  ali  24  32.PADLHGVDAAIVGAPMDDLVSDRPGARFGPRAIRAASCPPGPHLEAGVDAFEILEVIDFGDAPVLPADPERSHAAIEATVGQVLAAGAIPIVLGGDHSIAEPDVRACAAKHGPVGLIHFDTHTDTGRTVFGVERSHGTPMYRLVEHVDPTRYVQIGLRGYWPQEFGWQRERGITSLFMHDVR--DRGIKAVGSRPVFLSVDVDVLDPAFAPGTGTPEPGGMTSADLLWACRTVAAE-VELVGMDVVEVLPERGSRDVTALVAERIVRETLTGVAMRR... 322
429 2.000e-93UniRef50_A0A0M9UC89 Agmatinase n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A0M9UC89_9CHLR  ali  27  19....LETARAIVLPIPYEATVSYEAGTRRGPAAILEASAQVELYDREFDDEPAHYGVHTLPALLPNFASPEAMVADIAEAVAMYAQPGRLLVVLGGEHTITAGVMQGVAQVYGPLTMVQLDAHADLRNEFEGSPYSHACVARRVLDAGYGE-VLQLGIRSVCTEEMDVIREERVRVWFAEDVHTLDELAERVRGKRVHLTIDVDGLDPSIVPTTGTPEPGGLTWYQTLAIVRTVAEA-ADVVSVDCVELSPRAGLH-MADFAVAKLLYKTMNYVLMK.... 297
430 2.000e-93UniRef50_A0A1G2F5V3 Agmatinase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2F5V3_9BACT  ali  28  15...SIEQSDVVIVPFGLEKTIEYGKGTRKGPQRIIEISPNLEFFDEELEKNVYEVKIATLEE-PNIXXXXXXXXXXXXXXXXXXXXXNKFPLVLGGEHSLTLGPARAALKKYGEISILQFDAHADLRDEYEGTIYNHASVMRQCLKLNSV-NLVQVGIRNISTDEFEFWKENQARIFWAKDDWKINEIVESLG-ESVYLTFDIDVFDSSLMPSTGTPEPGGLQWYQTMEILREVAKKK-KIIGADVVELSPISGFYAPD-FVAAKLVYKIIGYIASKKR.. 298