current user: public

If you have questions about the server, please let us know.

Query: 3mmr_A mol:protein length:413 Arginase, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# E-value Template Links and tools%idFirst MGSSSSGLVPRGSHMASKNVSIIGSPLAAGQPLGGVQLACDDLRKLGLHNVIDVLGWKYEDIGNIDNGDNEMKQEKKTNNYINNNDNNNDNNNDNNNDNNNNCYIPNGVIKEKKHDLSNNKMNGYVNHNFYGNYEENNVISTNDKYKNNCYYDNIRNIKEIGIFSKNLFDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPETSPSGNYHGMTLAHTLGLFKKKVPYFEWSENLTYLKPENTAIIGIRDIDAYEKIILKKCNINYYTIFDIEKNGIYNTICTALEKIDPNSNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILAETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLELIARVLGYDIVLast
1 0.000e+00UniRef50_A0A268S6T6 Arginase n=7 Tax=Paenibacillus TaxID=44249 RepID=A0A268S6T6_9BACL  ali  31  24...................................................................................................RGGAELGPDELITAGLKREIARLGL--------VLTEEVRVDCPLVADTPIERNRAKYLREVRQVSERVCTEVSRVVAGGVFPLVLGGDHSVAIGTIAGLTSHYSNLGVIWFDAHADLNTEERSLSGNMHGMSLAAAL--GHSAFNLSHIPGVGPFINPSNLVYVGLRDIDEYEKEQIRAHGIKSFTMHDIDRMGIQWVVEQAVA-VAGKGSDGIHLSFDMDCLDPREAPGVGTPVPGGLNYREAHFALELLASTNRITSMELVEVNPLFDHNRHT---------------ARLGVELIASLLGKRIL 305
2 0.000e+00UniRef50_W8ZQD6 Arginase n=16 Tax=Paenibacillaceae TaxID=186822 RepID=W8ZQD6_9BACL  ali  26  1....................................................................MMNMATDMNERLRSGQRKIQLIKVPFWLGGGRAGTELGPESIIEAGLKRQLKAMELELAEEWEVDVP-------GDAAEPAAPGCLMKHKAEVAEMAGLVGEKVYRSVSSGAFPLVLGGDHSVAIGTLAGLSGHYGKLGVIWFDAHGDLNHEGTTPSGNMHGMALAAAVGHGSFTLADIPGAG--PLIRPENVVLVGVRDLDPGEKEFIRSSGMTCFTMHEIDRMGIHAVMEQAIAA-AGRNTDGVHVSFDLDCLDPMQAPGVGTPVPGGLSYREAHYALELLAESGIATSLELVEVNPILDPARRT---------------ARAAVELAASLLGKRIL 314
3 0.000e+00UniRef50_G0QWW2 Arginase n=1 Tax=Ichthyophthirius multifiliis (strain G5) TaxID=857967 RepID=G0QWW2_ICHMG  ali  42  5.....QKYIEKFQKIKTKNIDIIGVCIKEGQNLTGTELAPDCLRKSGLNLVLEFLGWKINDLGNI--------------------------------------------------NLESQDEGQEVH-TKIENKTNQSQDDKQDLQLK--YYTNMKHSETIGQACQQLHEKVKQSSQKSNFPLILGGDHGIATGTISGMLETYENLKVIWIDAHGDINLPETSPSGNYHGMPVAHLLGWFQKKVKGFDWLKF--KLKPENIVFIGLRDLDEEEKDLLNKNKIKCFCMHQIDQFGIGEVMKQAFKYLKIDEDQNLHLSFDIDAVDPSFAPGTGTKSKGGLTYREAHYICRSAAESGKLVSMELVEVNPNLDHHLLHLHGDDKNIKG--SKTVGLAIELIKSALGYTLL 354
4 0.000e+00UniRef50_A0A2R6Y3E8 Arginase n=1 Tax=Candidatus Carbobacillus altaicus TaxID=2163959 RepID=A0A2R6Y3E8_9BACL  ali  32  3...................IAILGVPLDLGAGRRGVDMGPSAIRYAGLNEHLRAIGHAVHDLGNIPVALTQSARDQSLDASGEPRAHDDAEILSMHTSVDHDA-------RHHSHHLSP-----------------PRTSDAGD-----RPSSNIKWLKEVREANISLYEKLLETISDDQFPLVLGGDHSIAIGSLAAHRRHKKRLGVIWFDAHGDVNTPETSPSGNIHGMPLAVALGYGEPSLTAIGDA---PYVHPEDIALIGIRDLDPGEKIFLRKLGIRVFTMHDIDRHGMSRVMEEALDFVTRHTDG-VHLSFDLDALDPLYAPGVGTPVAGGVSYREAHLAMEMLAEADVITSADFVEVNPILDVENRT---------------ARATVRLIGSLLGDTL. 341
5 0.000e+00UniRef50_E6RA13 Arginase n=28 Tax=Fungi TaxID=4751 RepID=E6RA13_CRYGW  ali  30  63..............NKPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISGLGWNVHYESHQNFLDIPYNPLPS---------SSPVASHDGPSTHTTTAQGEKMVQR-----------------------------------LPDPDIGNMKKPRLVSAVNEMVAKEVGDIAEKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTETGNLHGCPVSFLLGLDGCDVEPFNK-WLKPCLKPEDIVYIGLRDIDDAEKKILKENKIKVFTMHHVDKYGIGKVMELALQHINPSGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCLVALDIMEVNPSLDPRSVEKTVAA-------------GCSLTRASLGETL. 397
6 0.000e+00UniRef50_Q5KEH0 Arginase n=6 Tax=Agaricomycotina TaxID=5302 RepID=Q5KEH0_CRYNJ  ali  30  47..SSEKGLTSPTYNYKPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISALGWNVH-----YESHQNFLDIPYNPLPSSSPVTSTEGPSTHTTT----AQGEKMVQR-----------------------------------LPDPDIGSMKKPRLVSAVNEMVAKEVGDIAEKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTESGNLHGCPVSFLLGLDGCDVEPFNK-WLKPCLKPEDIVYIGLRDIDDAEKKILKENNIKTFTMHHVDRHGIGKVMELALQHINPNGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCLVALDIMEVNPSLDPRSVEMTVAA-------------GCSLTRASLGETLL 398
7 4.000e-98UniRef50_A0A0G4H848 Arginase n=2 Tax=Chromerida TaxID=877183 RepID=A0A0G4H848_VITBC  ali  38  35...TSKMARLEKRLLCDKTVAYIGAPFNDGQELKGVDEGPKALRDAGLRAYTMKMGFAFEDWGDINPHAPSRYTTVESSTSLKGDSDDSMEGEGEGEAHGSGE--------------------------------------------SAVYYTNVKNSREVGRACKKIHDATQHAAAEKKFVLTIGGDHSIAAGSIAGLLTERPDLAIIWVDAHGDCNTPETTPSGNYHGMPAAHLLGWFKKLVPGFEWMQKVPTLPENRIAFVGLRDLDPAEKDMMMHSGVHCFTMQDVDRYGISKVMDMALSKIDPEGRRPLHLSLDVDACDPAVAPGTGTKARGGLTYREVHYICEAMAETSRLTSMDLVEINPLIDTPSEDLHGDDPDIKG--TQTVRLGVELIASALGKTIM 392
8 5.000e-98UniRef50_A0A2K6UPL6 Arginase n=17 Tax=Eutheria TaxID=9347 RepID=A0A2K6UPL6_SAIBB  ali  27  1...................................................................................MRASFCGLPTKSEKTKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTP--------VPKDDIYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYISEEIHNTGLLSALDLVEVNPQLATSE-----------EEAKNTANLAVDVIASSFGQT.. 304
9 1.000e-97UniRef50_A0A0D0HQ65 Agmatinase n=4 Tax=Anoxybacillus TaxID=150247 RepID=A0A0D0HQ65_9BACI  ali  22  13...............................................................PRYAQISTFMRLPHSRDIKNYDVAIIGVPYDGGTSYRPGTRFGPREIRSHSSLIRGYSYYSKSDL-----FSRLRIADYGDIDASPY---------NIELTYKLIEDTIESILNENVFPVVIGGDHSISLGILRAVAKKYGPVGLVQFDAHSDTYD-GVYGTEYHHGTPFKRAIEEG--------------LIDPSRSLQIGIRGVSSTDLDYALQSGMKILMMDDINKKGISDVIKNI----EGLGKEPVYVSLDIDAVDPAFAPGTGTPVPGGFDSREIIQLVRSL-KPLNVVGFDLVEVSPPYDNNGITSLLASNLIYEFL.................... 304
10 3.000e-97UniRef50_A0A1Q3SWL5 Arginase n=1 Tax=Chloroflexi bacterium 54-19 TaxID=1895928 RepID=A0A1Q3SWL5_9CHLR  ali  36  2..................RVSIIGAPLALGQSKPGVGLAPAALRKAGLVEALTQLGHSVLDEGDLHFPSGTLHEAKVEIPEAEFD--------------------GPRR----------------------NLFEEGDTTT----TMLSASVTHVKYAREVGESCRIISEKVAERAKAGDFCLTLGGDHSIALGSIPGILTARPDTALIWVDAHGDFNTPETSPSGNMHGMPLAMVLGYASLKLPQFAWLQNEELLTPDRVALVGVRSLDAGERHLLRDAGVNVYSMSEIDRYGIGQVMDRAMTAINGDGRRTFHVSFDIDSIDPSEAPGTGTLVKGGLTYREAHAILEMVAETGLLTSLDLAEVNPELDLNGQTTA---------------LGVELIASALGKSI. 330
11 1.000e-96UniRef50_A0A267MM19 Agmatinase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A267MM19_9CLOT  ali  18  14.............................................................SSPRFCNRGNFMRLPAATNLEELDFAVVGVPFDTASSFRTGSRFGPGAIRNISALIKPN-----NVHLEVNVLDSLKGADYGDLNIVPGY---------IEKSFENIEEGLQPLLDANVIPIILGGDHSISLPHLRAIAKKHGPVALVHFDSHADINDT-VFGEKHNHGTPFRRA--------------FEEKLIDPDHVIQVGMRGYDPDEHKIAEELGFRLIAAHKIREMGIDNLIEEIKDRV---GDKKVFLTFDIDFVDPAYAPGTGTPEVGGFTSHETLTIVRAL-KDLNFVGCDIVEVAPQYDPTEMTAFMAANVAFEFISMLA................ 313
12 2.000e-96UniRef50_A0A1A8VT10 Arginase, putative n=53 Tax=Plasmodium TaxID=5820 RepID=A0A1A8VT10_PLAMA  ali  66  12.......FKEEGNVYVRKSVSIIGSPLSAGQSLGGVNLACDDLRKLGLHKIIQVLGWNYEDLGNVEETSEINEKRKKKHSSIEIEENNSNSNCNSKSKGNNNSNTNGIAGANGYMDHENCNGKENNKLENHSSDDIYKKVNGGGECLTKNYYNNIKNIEIIGKFSEKLYRVMSNEIKKKNFVLNIGGDHSVAFSSILSSLQFYKDLKVIWVDAHGDINIPETTPSGNYHGMILAHTVGLFKKKVPYFEWSENLTYLKPENVAIIGIRDIDIYEKIILKKCNINYYTIMDIEKYGIYNTICTALNKIDPYENSPIHISLDIDSVDSAFAPGTGTIAKGGLNYREINLLMKVLADTKRVVSMDLVEYNPSLDEEDKQVHGDSLPISENATKTGKLCLELIARVLGNNIV 416
13 2.000e-96UniRef50_A0A2G7LP63 Arginase n=46 Tax=Paenibacillaceae TaxID=186822 RepID=A0A2G7LP63_9BACL  ali  33  41...................................................................................................RGGAELGPDELITAGLKREIAS-------LGLNVSKEIRV-DCPSESVVPIERNRVKYLSEVKQVSERVCSEVSGAIARGSFPLVLGGDHSVAIGSLAGLSGHYSNLGVIWFDAHADLNTEERSLSGNMHGMSVAAALG--HSAFNLSHIPGAGPFVNASNLVYIGLRDLDVYEKEQIRALGIKSFTMHDIDRIGIQQVIEQALAVVGE-GTDGIHISFDMDCLDPREAPGVGTPVPGGLNYREAHFALELLASTNRVTSMDLVEVNPLFDQNRHT---------------ARLGVELIASLLGKRIL 322
14 4.000e-96UniRef50_U3JRF6 Arginase n=54 Tax=Gnathostomata TaxID=35060 RepID=U3JRF6_FICAL  ali  31  37..................................................................................................................................VAVFPGCQVHDFGDLNFTQVPNDLILYPRSVGLASQMLADAVSRAVAAGHRCVTLGGDHSLALGSVSGHARQCPHLGVIWVDAHADINTPLTTQSGSLHGQPLSFLLRELRDKVPQLPGFWLKPCLSASDIVYIGLRDVDPAEYYILKNFDIQYFSMRDIDRLGIQKVMERTFEQLLGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYITEEIHNTGMLSAVDMVEVNPLLGASQ-----------EAVKATARLAVDVIATCFGQT.. 306
15 5.000e-96UniRef50_A0A069RBJ7 Guanidinobutyrase Gbh n=12 Tax=Bacteria TaxID=2 RepID=A0A069RBJ7_PEPLI  ali  16  12.............................................................SSPRFCNTGTFMRMPRMTELEGLDFAVVGVPFDTASSYRTGSRFGPSAIRNISSLIKPNNVNL-----QVNVLESLKGADCGDVNVVPGW---------IHETFENIENELKPILDADVIPIILGGDHSISLANLRAIAKKHGPVAMVHFDSHADIND-KVFGMPHNHGTPFRRAHEEG--------------LIDPDHVIQIGMRGYDPDEHRVAEELGFRLIAAHKVREMGIEGLIKEIKDRV---GDKKVFLTFDIDFVDPAYCPGTGTPEVGGFTTLETLTILREL-KDLNFVGCDIVEVAPQYDPSEMTAFMAANVAFEFISMLA................ 311
16 6.000e-96UniRef50_A0A1H8FCQ7 Arginase n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1H8FCQ7_9BACL  ali  30  1..............................................................................MSKHRQPVTVLPVPFHHGAS-RPGADGGPQAVLQAGLMEKLK--QLKRSATLLPPLEWQK------LSKDRRSMERMRNWGRVQTMNEDVAELVLAIAKSGAFPLTIGGDHSISIGTIAGLTQHIQQLGVIWIDAHADMNTPKTTPSGNLHGMALAASLGLGDTRFTNMYG--QNPKLQSKRVVLVGSRELDEGEKRNIYASGISCFTMHDIDRIGMARVMERAIA-IASYGSEGIHVSFDIDCVDPGEAPGTGTPVRGGLNYREAHLAMEMLYDCGRVTSADIVELNPSLDPSGRT---------------ARLAVELIGSLLGERIL 302
17 7.000e-96UniRef50_A0A1X9M919 Arginase n=340 Tax=cellular organisms TaxID=131567 RepID=A0A1X9M919_9BACI  ali  32  7...................................................................................................RRGVDMGPSAMRYAGLI-------EGIKELGF------DVVDYGDITIHRSSNGNLKNLQEVIKTSEELCRDLDQILSKGGFPLVLGGDHSMSIGSIAGISKHYKNLGVIWYDAHTDLNTADTSPSGNIHGMPLAINLGLGHPLLT--EIGGYSPKVKRENIVIIGARSIDEGERELIKQEGIKVFTMHEIDRKGMTAVMEEAISYLKDRTDG-VHLSLDLDALDPVDAPGVGTPVLGGVTYRESHLAMEMLAESGMITSAEFVEVNPILDNKNQT---------------ADIAVELVASLLGKKLI 288
18 2.000e-95UniRef50_S0AEU1 Guanidinobutyrase Gbh n=530 Tax=root TaxID=1 RepID=S0AEU1_SERPL  ali  18  11..............................................................MPRFAGIPTMMRLPVADDAQGLAAAFVGIPLDIGTSNRSGTRYGPRQIRQESVMLRPYNMG-----TGAAPFERLQVADLGDI---------AINPYSLEDSVRRIELAYNGILSHGCVPLTLGGDHTLTLPILRAVARHHGPVGLIHVDAHSDTN-EEMFGEKLAHGTTFRRA--------------YEEGLLEPQRVVQIGLRGYAADDFDWSRRQGFRVVPAEACWYRSLAPLMAEVRQQM---GGAPVYLSFDIDGLDPAFAPGTGTPEVGGLSVWQGLEIVRG-CRGLNLIGADVVEVSPAYDRSGNTALLAANLLFEMLCVL................. 307
19 3.000e-95UniRef50_D2AUK3 Guanidinobutyrase n=14 Tax=Actinobacteria TaxID=201174 RepID=D2AUK3_STRRD  ali  20  33..................................................................................RCDVAVVGVPFDSGVSYRPGARFGPSAVREASRLLRPYHPGLD-----VSPFAALQVADAGDI---------ACNPFDIGEAVETIEHAAGELQDTGARLVTIGGDHTIALPLLRSLARRHGPVALLHFDAHLDTWDTY-FGAEYTHGTPFRRAVEEG--------------ILDTEALSHVGTRGYGKKDLEDDRRLGFGVVTSADVMRRGVDEVVDALRQRI---GGRPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLA-GANLVGADVVEVAPAYDHAEITSVAASHVAYDLVSLLALSAPSL.......... 316
20 6.000e-95UniRef50_A0A146HNC2 Uncharacterized protein n=1 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HNC2_9AGAR  ali  29  1........................................................................................MFFAFYAGGQPRPGVDKGPISLVEAGLIEQLADLGWQVNFDGHHQFEEVN-------ALADPPIGKLKNPRLVSRVTESVAKVVGGHAKNGELPVTLGGDHSLAMGTISGTLEQYPDACVVWIDAHADINTVETTDSGNIHGMPVSFLLGIG---TSVPEFAWVKPLLKADRLVYIGLRDVDAGEKRILKEHNIKAFSMHEVDKYGIGKVVEMALDHVNPKRDRPIHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICEEIWATGLLVALDLMEVNPSLDPA-------------SVQQTVTIGCSLVRSALGETLL 297
21 8.000e-95UniRef50_H3SNB4 Arginase n=12 Tax=Bacillales TaxID=1385 RepID=H3SNB4_9BACL  ali  30  19...................................................................................................RPGAEQGPDALLEAGL-------VRHLSQLGLQTIDEGAVLPPSAQDSTQASGTKLKHLEEIAALNSELADRVAEAAASGRFPLILGGDHSIAIGTIAGLTRHYRNLGVIWFDAHGDLNTEDTSPSGNIHGMSLAVNLDQGHPLLTRIR--RQSSRIDPAKVVIIGARSLDEGERAYIRQAGITCFTMHDIDRKGMPYVMEQAL-RILGDGTDGVHLSFDIDSLDPAEAPGTGTPIPGGVSYREAHLALEMMYESGLITSAEFVEVSPPLDSQKRT---------------VRLAIGLIGSLLGEQIL 301
22 9.000e-95UniRef50_Q90XD2 Agmatinase, mitochondrial n=34 Tax=Euteleostomi TaxID=117571 RepID=SPEB_CHICK  ali  14  21.............................................APCRRASRFNVPPSAEFVARPVGVCSMLRLPVQTSAEGLDAAFVGVPLDTGTSNRPGARFGPQQIRAESVMVRRY-----NASTGAAPFDSLLVADVGDVNV---------NLYNLPDSCRRIRESYQKIVASGCVPLTLGGDHSITYPILQAVAEKHGPVGLVHVDAHTDT-SDMALGEKIYHGTPFRRCV--------------DEGLLDCSRVVQIGIRSYAPNPYKYCWDQGFRVVPAEECWMKSLVPLMGEVRQQM---GDGPVYISFDIDGLDPAYAPGTGTPEIAGLTPMQALEIIRG-CKGLNIVGCDLVEVAPIYDVSGNTALLGANLLFEMLCVL................. 334
23 7.000e-94UniRef50_A0A1B8EI92 Uncharacterized protein n=168 Tax=Fungi TaxID=4751 RepID=A0A1B8EI92_9PEZI  ali  19  44....................................................QRKWNDEWAFSGISTFAHLPHQKCLVHPENLYDIAIIGSPFDTAVSYRPGARFGPRAIRAASARQTAN--RGFNPRAGFNPYTWATILDCGDIPIN--PFDNELAYRQMTEAFSELAHRPSKSGSQKPRLITLGGDHSLALPALRALNELYGPVAVLHFDAHLDTWHPAKYPSAWSEQSHFNHGS--------MYWIASNEGLIANGSSVHAGLRGSGWDDYEDDDRQGFFRISADDIDDIGPAGVAKLIVEKI--GTDIPVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV-EALNVVGADIVEVAPAYDRGEQTALVAAQVVYEILTSMVK............... 376
24 7.000e-94UniRef50_E1BLC0 Agmatinase n=53 Tax=root TaxID=1 RepID=E1BLC0_BOVIN  ali  16  28.........................................ARPVAGLCDPSRRLSRQASDAPRNQPPICSMMRLPVQATPEGLDAAFVGVPLDIGTSNRPGARFGPRRIREESVLLRT-----TNPSTGAVPFQFLRVADLGDVNV---------NLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDHTITYPILQAIAEKHGPVGLVHVDAHMDMAD-KALGEKLYHGTPFRRCV--------------DEGLLDCKRVVQIGIRGSSTDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQM---GGRPIYISFDIDGLDPAYAPGTGTPEIAGLTPSQALEIIRG-CQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFEMLCVLPKVTV............ 360
25 8.000e-94UniRef50_A0A1E3PXJ3 Arginase n=17 Tax=Dikarya TaxID=451864 RepID=A0A1E3PXJ3_LIPST  ali  29  14..............................................................................YRFYGRKNVAILGCPFNGGQARSGVETGPLHVLEHGLEEQLQSLDWTITSCKNLTFTP---------PASDPDEGKLKRPRFVSESTHKVASEVADIIKSGSFPLTIGGDHSLAIGTVSGVFSQFPDACLIWIDAHADINTPASTPSGNIHGCPVSFVMGLADPCPPQFEW--VKPLLKANKLAYIGLRDVDSGEREILKKHNIAAYSMHHVDKFGIGKVVEMALERVNPDGSAPIHLSLDIDALDPQHAPATGTPVRGGLSLREACYICEALAETGNLVSMDIMECNPVLGIDERS-----------VTSTISAACSLVRCAMGETLL 320
26 1.000e-93UniRef50_A0A1A5YR96 Arginase n=5 Tax=Paenibacillaceae TaxID=186822 RepID=A0A1A5YR96_9BACL  ali  38  60....................................................................................................................................................DPGSPRIKYLPEIKEMSGLVGEQVYRAVSAKTFPIVLGGDHSVAIGTLAGLTGHYNRLGVIWFDAHGDLNTEATTPSGNIHGMVLAVAMGFSRFKLTDIPGAGT--LINKKNVVIIGTRDLDPGEKELIRSQGIACYSMHDIDKHGIAKVLEEAVA-IASDGTDGVHLSFDMDCLDPLEASGVGTPVPGGLSYREAHFAMELLAETGKITSMDLVEVNPMLDHDKKTT---------------RLAVELTASLLGKKIV 300
27 1.000e-93UniRef50_A0A1M4E2P9 Agmatinase n=27 Tax=Bacteria TaxID=2 RepID=A0A1M4E2P9_9ACTN  ali  19  20.......................................................................FARLPRLDQVERADVAVVGVPFDTGVSYRPGARFGPAAVREASRLLRPYHPGLD-----VSPFERAQVADAGDIAV---------NPFDIGAAIETIEGAADDL---DARLVTIGGDHTIALPLLRSAARKHGPVALVHFDAHLDTWDTY-FGAEYTHGTPFRRAVEEG--------------LLDTEALSHVGIRGYGKKDLEEDRRLGFGIVTAADVLRRGLDEVIDLLRQRV---GERPLYLSIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLA-GLNLIGADVVEVAPAYDHAEITSIAASHVAYDLVSLLA................ 305
28 3.000e-93UniRef50_A0A021X7H5 Guanidinobutyrase n=673 Tax=root TaxID=1 RepID=A0A021X7H5_9RHIZ  ali  19  20....................................................................HSTFMRLPAVETAVGLDIALVGIPWDGGTTNRAGARHGPREVRSASSLMRS-----THHASKTQPFTIANIADVGDLPI---------NPIDLMDALKLIEGGMRTVIEAGALPLAVGGDHLTTLPVLRAVA-ASGPVGLIHFDAHSDTNDTYFGDNPYTHGTPFRRAIEE--------------SLIDPRRTVQIGIRGYAPDEHDWAVKQGIRIIYMEEFVERGVAAVMAEARQIV---GDAPTYVTFDIDSIDPSMAPGTGTPELGGFSTREAQHLVR-LLEGVNIVGADVVEVAPPFDLAGMTSLAGATIMFELLCVMARLVAR........... 316
29 4.000e-93UniRef50_A0A1E8Q752 Agmatinase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1E8Q752_9MYCO  ali  16  23.......................................................................FARLPRREDVPRCDVAVVGIPFDTGVTYRPGARFGPSHIRQASRLLRPYNPELR-----VSPFAHQQVVDAGDM---------VANPFDIGVAVDQIDAQATELIDAGAKLVTMGGDHTIAYPLLRAHRRRYGPVALLHFDAHLDTWDTY-FDTPVTHGTPFRRA--------------AEEGLFVPGHSAHVGIRGYSPADLDDDAGMGFTVVHCAEFERTSTDAVIERLRAQV---GDRPLYVSVDIDVLDPAHAPATGTPEAGGMTSRELLAILRGL-DGTNLVGADVVEVSPAYDHAEITGVAAANLVYEFVSLLARGAAR........... 316
30 8.000e-93UniRef50_A0A257WCW3 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A257WCW3_9BACT  ali  20  1.............................................................MPLPFSGIATFARAPYATSPTGADVAILGIPYDSSTSNRSGTRFGPRAIREQSLLLW-----GYNNAQQVAPFKELKLVDLGDADVIPV---------DILATHRAIESAAKRVIDQPATLITLGGDHSISLPLLRAHHAKYGPLAVVHFDAHPDTWDSEYPGHKYSHGTPFVRALEEG--------------LIDRDAYVQIGIRGPTPQDYLDALNLGARMITVDEFRMRDVADILAELQGRI---GSRSTYVSLDIDCVDPAFAPGTGTPEVGGLTSYEILQLVRGL-KSLNCVGFDLVEVSPPYDHAGITAILAANLAFEFLSLVA................ 300
31 8.000e-93UniRef50_UPI0009FBD015 agmatinase n=1 Tax=Paracoccus sp. S4493 TaxID=579490 RepID=UPI0009FBD015  ali  20  15............................................................DSLPRFSAPATFMRLPHTETAKGLDIGIFGVPFDGGTTNRPGARHGPREIRTASSMQRTYNL-----ATGVEPYEICNFGDIGDVPIN--PLDQHHSLIEIQSFCE-------EIIRENCLPIAVGGDHLVSLPLLRALGD--PSLGLIHLDAHSDTGDYDFTQTKYSHGTPFRRAIEER--------------LLDPQKIVQVGIRGSSSEELEWAVAQGITIIGMDQFHQLGVEGVSAMIREVV---GNAPVYLTFDIDCFDPAFAPGTGTPEAGGLTSYEGLNLLRRM-RGLNFQGADLVEVCPPLDSSGITSILGATVLFEICCLLAE............... 314
32 2.000e-92UniRef50_A0A0K3AXM8 Agmatinase n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A0K3AXM8_9PSEU  ali  20  19.......................................................................FARLPRLDQVDKADIAVVGVPFDTGVSYRPGARFAPAAVREASRLLRPYNPGLD-----VSPFERAQVVDAGDI---------VCNPFDIGKAITEISEQATELLDTGAKLVTVGGDHTIALPLLRSVAAKHGPVALLHFDAHLDTWDTY-FGEPYTHGTPFRRAVEEG--------------ILDTSALSHVGTRGYGRADLSEDARLGFGIVTSADVLRRGVDEVIEALRARI---GDRPLYVSIDIDVLDPAHAPGTGTPEAGGMTSRELLEILRGLA-GLNLVSADVVEVAPAYDHADITSIAASHVAYDLVTLL................. 306
33 2.000e-92UniRef50_A0A0A0ATK1 Uncharacterized protein (Fragment) n=18 Tax=Amniota TaxID=32524 RepID=A0A0A0ATK1_CHAVO  ali  18  1............................................................................................................................YNGSTGAAPFDSLQVADIGDVNV---------NLYNLPDSCRLIQESYRKIVASGCVPLTLGGDHTITYPILQAVAEKHGPVGLVHVDAHTDTGD-RALGEKIYHGTPFRRCVEEG--------------LLDCSRVVQIGIRSYDPDPYKYCRDQGFRVVLAEECWSKSLVPLMAEVRKQM---GDKPVYISFDIDGLDPAYAPGTGTPEIAGLTPAQALEIIRG-CKGLNIVGCDLVEVAPMYDVSGNTALLAANLLFEMLCVLPRV.............. 243
34 2.000e-92UniRef50_Q7PCM2 Arginase n=11 Tax=Plasmodium TaxID=5820 RepID=Q7PCM2_PLAYO  ali  66  12.......HIDEQNIYVKKCVSIIGSPLAAGQSLGGVNKACDNLRQLGLYDVIKAMGWKYNDIGNIGESISINTFLNSANAEKGIKKEAEKEAEKGAKKEAEK------------------EAEKGAKINGN----------------ESNYYSNIKNAQVIGKFSEQLFQIMSSEIKKKNFILNIGGDHGVAFSSILATLQTYKNLKVIWIDAHGDINIPETSPSGNYHGMSLAHVLGLFKKKVPHFEWSENLLHLKPENVAIIGIRDIDKYEKIILKNCNINYYTMFDIDKKGIYNIICEALNKIDPDQNSPIHISLDIDSVDSIYAPGTGTIAKGGLNYREINLLMKSISDTKRVVSMDIVEYNPLLDENDKAVHGDSLPIDPNATKTGKLCLELIARVLGNDIV 377
35 3.000e-92UniRef50_L7ZQT6 Guanidinobutyrase n=104 Tax=Bacteria TaxID=2 RepID=L7ZQT6_9BACI  ali  17  14...............................................................PRFCGVKTFMRLPHVKTEDNIDFAVIGVPFDTGGTFAVGTRFGPEAVRSMSSLLRPYNPGL-----QIDIFQYCSGVDYGDLSVNPGY---------IEDSYEMIANQLEPLLNKNVVPILIGGDHSVSLPHLRAMAKRYGKVSLIQFDSHGDTWDSY-FGKKYTHGTMFRRAVEE--------------QLVDPFSSVQIGMRGYSAEDLKDAEDLGYKVITTDQLRALTPNQLGEEIRKRV---GKNPVFVSFDVDFLDPAYAPGTGTPEIGGFTTYEAQQFVRQL-KGLNLVGFDIVEVLPDRDPTRVTSLAAANIGFEFISLVA................ 310
36 3.000e-92UniRef50_Q9I3S3 Guanidinobutyrase n=1979 Tax=root TaxID=1 RepID=GBUA_PSEAE  ali  18  41......................................................................................AFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNM-----ATGAAPFDSLNVADIGDV---------AINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVND-HMFGEKIAHGTTFRRAVEED--------------LLDCDRVVQIGLRGYTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKV---GGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRG-CQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVL................. 313
37 4.000e-92UniRef50_K5ABK5 Arginase n=8 Tax=Paenibacillus TaxID=44249 RepID=K5ABK5_PAEAL  ali  36  76.........................................................................................................................................................KAKYVPEVIAMSDALAEQVQAVVESGRFPLVLGGDHAIAIGTLGGLTQQYHKLGVIWFDAHADLNTEDTSPSGNVHGMSLAVAL--GRGSLTDGQWKWPGNHLDPKNVVLVGSRDLDPGERSYIREQGIACFTMHDIDRYGMLHVMQEAI-RIASDGTDGVHLSFDVDSLDPIEAPGTGTPVRGGVSYREAHLALELLHESGIVTSAEFVEVNPSLDTDNRT---------------ARLALDLIGTLLGDRIL 311
38 4.000e-92UniRef50_A0A2H5V381 Guanidinobutyrase n=1 Tax=archaeon HR02 TaxID=2035438 RepID=A0A2H5V381_9ARCH  ali  19  20...............................................................PRFTGPYTFARLPHTRDLEGVDALFIGIPFDGGVIFRSGARFGPASVRQASLLLRLYNPYLR-----VRPFDALNVADYGDIDTVPG---------NIEATYQSISRELGPIHARGITPLVCGGDHSITLPLLREASKVYGRLSLIHVDAHLDMVEQHFSQ-KYTHGTVFRRA--------------YEEGLIDPYKSVHVGVRGYSEDEISSVESLGFRVIAMMSVEEMGIEAVCSEIKRI---AGGGPVYLSFDIDACDPSCAPGTGTPEVGGLTSREALKLLHGLA-GLGFVGFDLVEVAPPYDHGEITAYLAANIIYNFLCLKAFT.............. 318
39 7.000e-92UniRef50_W4FKT9 Agmatinase n=2 Tax=Aphanomyces astaci TaxID=112090 RepID=W4FKT9_9STRA  ali  17  153.......................................................................FARLPRLDQVTFCDVAILGLPYDSGCTYRPGARFGPSAVRQASRILRPY-----HTTLKVNAFHDQQCVDAGDV---------CCNPFNVTETMTTVVDHVSELLQLPSRPVAVGGDHSISYPLLKAHCEAYGPVALVHFDAHLDTWDAYFGET-HTHGTPFLRA--------------AEEHLFRPDASMHVGIRGYSSDDYARDATLGFSMLNMDAIEDMGVAGVVKQIRDRV---GQHPIYLSIDIDVLDPAFAPGTGTPEAGGLSTRELFGMLRGL-RGLNVVGADVMEVAPAYDHAEITALAAASIVFELISLMATSSAKILSA....... 452
40 9.000e-92UniRef50_A0A1V2MY25 Guanidinobutyrase n=1352 Tax=root TaxID=1 RepID=A0A1V2MY25_9ACTN  ali  21  39.....................................................................................VAVVGVPFDSGVSYRPGARFGGNAIREASRLLRPY-----NPAQDASPFALAQVADAGDI---------AANPFNINEAVETVEAAADDLLNTGARLMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTY-FGAEYTHGTPFRRAVEEG--------------ILDTSALSHVGTRGYGKQDLTDDEKMGFGIVTSADVMRRGVDEIADQLRQRI---GDRPLYISIDIDVLDPAHAPGTGTPEAGGLTSRELLEILRGLS-SCHLVSADLVEVAPAYDHAEITSVAASHTAYELTTIMSR............... 314
41 9.000e-92UniRef50_A0A151MJ81 Serine/threonine-protein kinase PINK1, mitochondrial n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151MJ81_ALLMI  ali  17  556.....................................................................CSMLKLPVQTSAEGLDAAFVGVPLDTGTSNRPGARFGPRHIRAESVMV-----RRYNPSTRAAPFHSLMVADLGDVNV---------NLYNLQDSCRQIREAFRKIVATGCIPLVLGGDHTITYPILQAVSEKHGPVGLVHVDAHTDTGD-KALGEKIYHGTPFRRCV--------------DEGLLDCKRVVQIGIRSYSPDPCKYSRDQGFRVVLAEDCWMKSLVPLMGEVRKQM---GDKPIYISFDIDGLDPAFAPGTGTPEIAGLTPAQALEIIRG-CKGLNIVGCDLVEVAPIYDASGNTALTAANLLFEMLCALVKTA............. 851
42 2.000e-91UniRef50_A0A093YKB5 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A093YKB5_9PEZI  ali  20 1189.....................................................RKWNDEWAFSGISTFAHLPHQKCLVYPDELYDIAIIGSPFDTAVSYRPGARFGPRAIRAASARQTAN--RGFNPRAGFNPYTWATIKDCGDIPIN--PFDNELALRQMTEAFAELAHRPSKSGSQNPRLITLGGDHSLALPALRALNQIYGPVAVLHFDAHLDTWHPAKYPSAWSEQSHFNHGS--------MYWIASNEGLVANGSSVHAGLRSGDWEDYEDDTRQGFFRISADDIDDIGPAGVAKLILEKIGTEI--PVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV-EGLNVVGADIVEVAPAYDRGEQTALVAAQVAYEILTSMVK............... 1520
43 2.000e-91UniRef50_A0A0D6GSR1 Agmatinase n=182 Tax=cellular organisms TaxID=131567 RepID=A0A0D6GSR1_MYCSM  ali  20  31.......................................................................FARLPQRFEVLDHDIAVVGVPFDSGVTYRPGARFGPSAIREASRLLKPY-----HPALDVSPFAQAQVVDAGDLGV---------NPFNIDEAVGQIRDGVTELLDRDQRVVLLGGDHTIALPALQAMHAIHGPVALVHFDAHLDTWDTY-FGAPCTHGTPFRRASELG--------------LIVKGHSAHVGIRGYDRADLLDDESLGFTVVHCRDIDRIGVDGVISRIHERV---GEYPVYVSIDIDVLDPAFAPGTGTPEIGGMTSRELVAVLRAM-RGLNIVGADIVEVAPAYDSGDVTAVAAANLAYELITLMA................ 320
44 2.000e-91UniRef50_P33280 Arginase n=87 Tax=Pezizomycotina TaxID=147538 RepID=ARGI_NEUCR  ali  31  60.......................................................................................................QCKPGVDAAPSALIESGLLTQLREELGYRLHGDDEVHLYTDVPKEDPPHRNMKNPRAVSNVTKRIAEQVHSHAKEGRLVLTLGGDHSIAIGTIAGSAKAGREIAVIWVDAHADINTPETSGSGNIHGMPVSFLTGLAEDKEEFFGWLKPDHLLSVKKLVYIGLRDVDPGEKRILRENGIKAFSMHDIDKHGIGRVMEMALGHI--GNDTPIHLSFDVDALDPMWAPSTGTPVRGGLTLREGDFICECVHETGSLVAVDLVEVNPTL----------AAPNDVGAHETVRAGCSLVRCALGESLL 358
45 3.000e-91UniRef50_Q10088 Putative agmatinase 1 n=319 Tax=Eukaryota TaxID=2759 RepID=SPEB1_SCHPO  ali  18  62.......................................................................PYWKCLNDKSQSFDIAFLGAPFDTGTSYRPGARFGPSGIREGSRRLNLY--GGYNVPMETNPFNWAKIVDCGDIPLTS--YDNAVAIKQIENGHFETRKPTSYSEKDGPRVITLGGDHTIVLPILRSVSRAYGPVSIIHFDSHLDSWKPKVFGGGINHGTYFYHAS--------------QEGLVSNDSNIHAGIRTTLSGDYDNDADCGFEIIEAREIDTIGIDAIIKRIRDRV---GDGIAYLSIDIDVLDPAYAPATGTPESAGWTTRELRTILRGL-DGIKLVGADIVEVAPAYDFAEVTTLAAADILFEVMSIMVKT.............. 380
46 3.000e-91UniRef50_Q7N122 Agmatinase n=533 Tax=root TaxID=1 RepID=SPEB_PHOLL  ali  18  11...........................................................DDSLVSNAFGFLRFPLNFQPYSSDAEWVITGVPFDMATSGRAGSRHGPAAIRQVSTNLAWESRRW---PWDFKLHNCLKVVDCGDVVF---------NFGDAQDMSDKLQAHAEKVLASGKRMLSFGGDHFITLPLLRAHAKHFGKMALVHFDAHADT---YPNGSQFDHGTMFYHA--------------PNEGLIDPHHSVQIGIRT------EHGRDNGFTVLDADQVNDRSVDDLLAQIKETV---GDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTTDRALKLLRGL-QPLNIVGMDVVEVAPAYDQSEITALAGATIALEMLYLQA................ 303
47 4.000e-91UniRef50_A0A098R1X2 Arginase n=2 Tax=Spirochaeta lutea TaxID=1480694 RepID=A0A098R1X2_9SPIO  ali  35  26................................................................................................................GSYAIRAEKLVEKLKALGYQVSDEGNVEDEGD--TLESGNPKLRYAAAIRRNMLELKEQVQAIVQQDAMPIVLGGDHSMAMGSLAGLKERYGNLGLLWVDAHGDFNTPETTPSGNVHGMPLAAITGRGAPELVDIGPF---PGVREENTVLFGIRDLDPEESMLIRESRVTMYTIRDIIERGFYTCLQEALQVVT-TGVDQFHLSFDMDSIDPIFAPGTGTPVMGGLNDREVLYLMERVHETGRLVSMDLVEVNPALDVGNKT---------------ARLAAELILRALGKKTL 304
48 5.000e-91UniRef50_A9U7C1 Arginase n=3 Tax=cellular organisms TaxID=131567 RepID=A9U7C1_PHYPA  ali  37  57..................................................................................................................................................LTPYPTTRMKHVDQVMAVCSQLAREAASAASAGSIPLMLGGDHSIAMGSLAGLSRHYPNMGVIWVDAHSDLNTEITSPSGNMHGIPLAAALGLTQLKLTQILPGAVQ--LKPENCVIIGARDLDRDEKTLIRSRGITCFTMYEIDRLGIEHVVQEAL-RIAGTGTDGLHVSFDIDSVDPFEAPGTGTPVRGGLSYREAHLAMELMSESGLITSVDMVEVNPSLDRNNQTS---------------KLAVELLGSLFGSRIL 299
49 6.000e-91UniRef50_UPI0004409C3E Ureohydrolase n=1 Tax=Fomitiporia mediterranea (strain MF3/22) TaxID=694068 RepID=UPI0004409C3E  ali  27  5.............................................................................HKFLPNPKTAAIVGCPFRGGQAKLGVDQGPIHLVNAGLIEQLKSLGWTVKFDGHHQFEEVN-------AQQDPPIGILKNPRLVSRVSKAVADVVGTHAGRGELPVTIGGDHSLAMGTISGTLKKYPDACVIWVDAHADINTVDTTESGNIHGMPVSFLLGLNKPAVA--EYSWIEPRLTPDRIVYIGLRDVDAGEKRILRENGIKAFSMHEVDKYGIGAVVEKALDHVNPDRKRPIHLSFDVDALDPSVAPSTGTPVRGGLTFREGHYICEAVHETGLLVAFDIMEVNPSL----------ADV--ESAKATVAVGCSLVRSALGETLL 341
50 7.000e-91UniRef50_M2SP37 Uncharacterized protein n=6 Tax=leotiomyceta TaxID=716546 RepID=M2SP37_COCSN  ali  18  18...........................................VGPDYSHPIEDLDVDLPFSQPVTFAHLEWQRCLAASHDKPLDIAILGFPYDTSTSYRPGARFGPRGIRAGSAR--EKKGRSYNTVWEVDPYEELAIVDCGDVPIT--PFDAAHAFKQMEQGYRQVLYHLTSSTNEHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHAS--------------REGCISKGTSVHGGLRTFSPKDYEIDKDVGFGIIEAHEIDDIGMNGIIEKTLSFVK---DTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGL-EGINLVGADVVEVSPPYDTAEITSIAAADLIVDIMAAMAK............... 357
51 1.000e-90UniRef50_UPI0004AF33E4 agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=UPI0004AF33E4  ali  17  10.......................................................................MMRLPHLPSAEGLDVAFVGVPLDIGTSNRPGARFGPRAIRAESPLLRPCNLG-----TGDSPFKRLRVADLGDVAV---------NPYNLQDSVMRIERYYEALLAHGCIPVTLGGDHTIALPILRAMARRHGPVALVHVDAHADVND-EMFGEKIAHGTPFRRAVEEG--------------LLTCDKVFQIGLRGYTPDEFDWGASMGFHVIPAAQCWSRPMDDVVARIRAQV---GDHPLYISFDIDGLDPAYAPGTGTPEIAGLSSVQALQLIRG-CAGMNIVGADVVEVSPPFDCGGMTALTAANLAFELLCA.................. 296
52 1.000e-90UniRef50_Q6CIB4 Guanidinobutyrase n=10 Tax=Saccharomycetales TaxID=4892 RepID=GBU1_KLULA  ali  20  32......................................................MWGEDWPFSGIQTFAHLPHHKCLIDMEKKFDIGVIGVPFDTAVSFRGGARFGPQAIRKASQRQT--SMRGFNFRADINPYDWASVVDCGDVPVT--PMDNCLALKMMTAAYENLLSHESQTSDNNPRFVTLGGDHSIILPALRALRKTYGRLAVIHFDSHLDTWAPSKYPS-------FWHSDTSEFTHGSMLWIAHNEGLLTENNNIHAGLRGSSFEDYDDDDKVGFHRIEADEIMDGGIKSIVEKIKSKIPS--DVPVYISVDIDVLDPSAAPGTGTMEVGGWMTRELIRIIREL-EDLNLVGADIVEVSPPFDPTEITSLAGAQIAYELITNMVK............... 362
53 2.000e-90UniRef50_A0A225AKU7 Putative agmatinase 2 n=3 Tax=Dikarya TaxID=451864 RepID=A0A225AKU7_9EURO  ali  18  20....................................DLGPDY------PYIVEDLDKDLPFSQPVTFAHLEWQRCLAASHEEPLDIAILGFPYDTSTSYRPGARFGPRGIRAGSSR--EKKGRSYNTVWGVDPYEGLQIIDCGDVPIT--PFDAAHAFKQMEQAYRQYHQTSEQNAWKHPRILSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHAS--------------REGCISKGTSVHGGLRTFSPRDYEIDRDVGFTLIEAHEIDEIGVHGIVEKVRKAV---GDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKAFLKGL-EGINLVGADVVEVSPPYDVAETTSVAAADLLVDILAGMTK............... 361
54 2.000e-90UniRef50_A0A1C3JG26 Guanidinobutyrase n=45 Tax=root TaxID=1 RepID=A0A1C3JG26_9VIBR  ali  18  17.......................................................................FMRCDYVPDLQDVDIALVGVPFDGGVTNRTGTRHGPREIRNQSSL-----MRIINQATGVAPFELCRVADVGDV-LPDSPFELVKAHQSIELFF-------KQIKASGALPIAAGGDHSISLPILRALAQ-DGPVALIHFDAHCDTGDNY-FGSKFHHGSPFKIAVEEN--------------LIDPKRTIQIGIRGSDKDMWRFSHETGMRVLYMDECVELGVEGILQQIKQTI---GDTPAYVTFDVDCLDPAFAPGTGTPEVGGFTSIEALQLIRGL-QDVNVIGADVVEVSPPFDPTGNTALVGATIMFELLCIAAQ............... 306
55 2.000e-90UniRef50_A0A2H5Z7S5 Guanidinobutyrase n=5 Tax=Bacteria TaxID=2 RepID=A0A2H5Z7S5_9BACT  ali  18  18........................................................HNPGPWQPRFSGMRTFARFPYSRSLDRVDVAIVGIPFDTGVTYRPGARFGPAAVREHSSRIE-----QYHPVLGVDVLAELSVIDYGDLPVVAGYT---------ERSFQLIEEGIGSLVESGVIPIGIGGDHSISLPELRAVARRYGPVALVHFDSHVDTWDT-IWETKYNHGTPFRRAVEEG--------------LVDPGRSIQIGIRGGGQDELDQSRELGFEVWTAREVRRAGLARMCEAIHRRV---GASPVFLSFDIDFLDPVFAPGTGTPEVGGFATWEAQELLWGLV-GLDIVAADLVEVLPDRDPADVTALNAANLIFDMVAVIA................ 321
56 2.000e-90UniRef50_A0A1Q7L3V1 Agmatinase n=22 Tax=Bacteria TaxID=2 RepID=A0A1Q7L3V1_9BACT  ali  17  30.......................................................................FMRLPHITEPRELEVALIGVSFDGGTTYRPGPRFGPRHIREQSAIIRPW-----NPVLKVNPFAKHRTADFGDLSV---------NPLSIEDTFGRIERGIRPLLDAGVRCVCVGGDHSISLPILRAVAKKHGAVSLIQFDAHNDLWDEY-FGSKYSHGTPFRRA--------------FEEGLLQDGDVLQVGLRGYGEEDFDFARVHKVRMVTAEEFHEKGMATV----RSHLRAFRRKPVYVTLDIDVVDPAFAPGTGTPQVGGLTSVQILELVRAL-RGLNIVGCDLVEVSPPYDNGEITSLLAANLLFELLCVL................. 316
57 3.000e-90UniRef50_A0A0A2LCI9 Ureohydrolase n=2 Tax=Aspergillaceae TaxID=1131492 RepID=A0A0A2LCI9_PENIT  ali  30  40..................................................................................................................ALIESGLLTQLSEDLDYDVHHDNTVHYYNDIPAEDPDHRGMKKPRAVSAVTEKLSTQVYNYAKDGKFVLTLGGDHSIAIGTVSGTAKAGREMAVIWVDAHADINTPETSDSGNIHGMPMAFLTRLAREEKKDFGWMQDEHIVSTQKLVYIGLRDVDRGEKKLLRENGIKAFSMHDIDRHGIGRVVEMALAHI--GNDTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICEAVHETGNLIAMDLVEVNPSLESKGASETIRAGFADE...................... 315
58 4.000e-90UniRef50_A0A0M2VQ20 Arginase n=7 Tax=Bacillales TaxID=1385 RepID=A0A0M2VQ20_9BACL  ali  31  19...................................................................................................RPGAELGPKSLIDAGLIRQLNHIHVHVSDEGSISIDSST-------DSSAPRNSKLKHLETIAQVNARLRDKIDSLMEKCTFPLILGGDHSIAIGTIAGLTRHYQRLGVIWFDAHGDLNTPDTSPSGNIHGMSLAVSLDQGHPLLTELRKGCHP--LDPAKVVIVGARELDQGEREMIKRLGITCFTMHEIDRYGMAAIMEKTLE-IVSDGTDGVHLSFDIDSLDPYEAPGTGTTVRGGATYREAHFALEMMFEANLLTSAEFVEVNPLLDHNKQT---------------VKLANELICSALGKRIL 301
59 6.000e-90UniRef50_B7G627 Arginase n=3 Tax=Eukaryota TaxID=2759 RepID=B7G627_PHATC  ali  31  10......................................................................................................TDSGPELLRQAGLRKMLSALGWRVEDVPDLEFEALQLS-----EKSGTFEGNAKNHKLVGAGCEMLANAVEKTLKQKRFPLILGGDHSIGMGSLAGILRAQPETGVIWIDAHADLNTPALSESGNMHGMPVGMLMEGDHRQIPGLEWLADGPRLSPDSIVYVGLRDVDPAERRLIQSLDIAAYTMHEIDRYGIGQVMEMALDHLAKNPNRPLHLSYDIDAVDPVLAPATGTTVRGGLTFREAHYVAEAVAYTGNLASAEIVELNPSLSCG------------EGAEATVELGLQLITSFMGKSII 301
60 7.000e-90UniRef50_Q1I7X5 Agmatinase n=507 Tax=root TaxID=1 RepID=Q1I7X5_PSEE4  ali  19  45.....................................................................................VVVSGVPFDTATSNRPGARFGPRAIRTASVQQAW----ARHWPWAFDPFDHLAVIDYGDCAFDNG------TPESVPDSIQAHAER---ILDAGCAMLTLGGDHFISYPLLKAHARRHGPLALIHFDAHSDTW-PDEEGKRIDHGTMFWHA--------------AREGLVDPAHSVQIGLRTTN------DDSQGFAILDARQVHRQGTEAIVAAIRQRV---GERPVYLTFDIDCLDPAYAPGTGTPVCGGLSTLQALEILGGL-RGINLVGMDLVEVAPAYDHADITALAGATLAMEMLCLYA................ 312
61 7.000e-90UniRef50_A0A2B8JBT7 Arginase n=1 Tax=Bacillus megaterium TaxID=1404 RepID=A0A2B8JBT7_BACME  ali  32  54.................................................................................................................................................EPDKNENPNLLHLKAVCDTSEELAKQVDSVIERGHFPLVLGGDHSIALGTIAGVTTHYDNVGVLWIDAHGDANTDETSPSGNIHGMPLAASLGYGHPLLTNLY-GSVLPKVKPKNVALIGVRDLDEGEVEFFKQHDITYYNMSRVNEIGISIVLQQIKEQFQHESVKHIHLSFDMDVLDPELVPGVGTPVPGGMRLTQAEQVIKEVKSWNQLVSAEFVEVNPLLDNKNRTAKLAARLIKHLF.................... 294
62 8.000e-90UniRef50_A1CGK0 Arginase family protein n=64 Tax=Dikarya TaxID=451864 RepID=A1CGK0_ASPCL  ali  19  21.....................................LGPDY------QHPIEDLDKDLPFSQPVTFAHLEWQRCLASSHNTPLDIAILGFPYDTSTSYRPGARFGPRGIRAGSSR--EKKGRSYNTVWGVDPFEELSIVDCGDIPIT--PFDAAHAFKQMEQGYRQVLYHETNVTEKHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHA--------------AREGCINKGASVHGGLRTFSPKDYEIDEQVGFHRIEAHEIDIIGVEGIIKRTVDVV---GDNPVYLSIDIDVLDPSIAPATGTPESGGWTTRELKRYIKGL-ENLNLVGADVVEVSPPYDTAETTSVAAADLIIDILAAMAKN.............. 362
63 8.000e-90UniRef50_A0A225B0U1 Putative agmatinase 2 n=10 Tax=Pezizomycotina TaxID=147538 RepID=A0A225B0U1_9EURO  ali  18  47.....................................................MKWEQEWSFSGVSTFAHMKPVKCLVEPDARYDIAIIGAPFDTAVSYRPGARFGPRAIRAASARQLPGT--SFNARAGINPYSWATLLDCGDIPIT--PFDNALASRQMYEAFLELGTRPVASSKNNQRPVTLGGDHSVALPALRALYQIYKPITVLHFDAHLDTWNPVRYASYWSEQSRFNHGS--------FFHIASSEGLISNTTSAHAGIRGVDDSDYTTPGEQGFMRIHADDIDDIGTRGVIDAIIERIGLDSEQPVYLSVDIDVLDPATAPGTGTPEPGGWTTREMIRILRGI-EKLNVVGADIVEVSPSYDVGETTALAAAQVAFEIITSMVKAGVE........... 388
64 1.000e-89UniRef50_A0A146VNG0 Agmatinase, mitochondrial (Fragment) n=18 Tax=Deuterostomia TaxID=33511 RepID=A0A146VNG0_FUNHE  ali  15  84.............................................AGVWDPHHGQAAVPGDGRRAGRGVRWRPDRHRDLEPAWSKVWSTPDQRGVRPAQGLQQRHQSSTLRGESALLRAYNSG-----TRAAPYESLMVADIGDVNV---------NMYDLKDTCKRIREAYRKILATGCIPLTMGGDHTIAYPILQAVAEKHGPVGLVHVDAHADT-SDVVLGEKIGHGTPFRRCVEEGLLHGTPFRRCVEEGLLDCRRVVQIGLRGYSPDSYEWSRAQGFRVVQVEECWFKSLAPLMSEVRAQMAS---GPVYLSFDIDALDPGFAPGTGTPEIAGLTPIQGVEIIRG-CRGLNLVGCDLVEVSPPYDTTGNTALTGANLLFEMLCVLPKI.............. 421
65 2.000e-89UniRef50_A0A1F9TUQ3 Arginase n=1 Tax=Elusimicrobia bacterium RIFCSPHIGHO2_02_FULL_57_9 TaxID=1797943 RepID=A0A1F9TUQ3_9BACT  ali  30  18...................................................................................................KQGTSGGPAAVRRAKLLEMLEDLGLAAS-------------DNGDVAVPKASSSKLKNAAVILKVCRDLEKRVYDEVKGGHVPITIGGDHSLAVGTVTGVAKAYKKIGLIWVDAHADINTPETSPSGNIHGMPMAHILGMGSRDFARLGGFW--PKVEPRNLCLIGVRDVDKAEAANLRKSGVRVFSMQEIDRFGMGVVIEQAIDA-ASDGTAGFHLSFDIDVVDPGSAPGTGTAKRGGLTYRESHLLMELAADSERLLGLDMVEINPLEDVQNATAV---------------LAAELVASAMGKSI. 300
66 2.000e-89UniRef50_C3ZD81 Uncharacterized protein (Fragment) n=2 Tax=Chordata TaxID=7711 RepID=C3ZD81_BRAFL  ali  18  1.................................................................................................................................GAAPFDSLQVADIGDVFI---------NMYDLKDAVKKIREAYSKIVANGCKPLTLGGDHTLTYPILQAIKTKYGPVGLVHVDAHADT-SDKQLGEKISHGTPFRRAVEEG--------------LLDCQRVLQIGLRGYSSDDYGWSRQQGFRVVQAEEIWYKSLAPLMEEVRAQM---GDGPVYLSFDIDALDPAYAPGTGTPEIGGLTSHQGLEIIRG-CRGLNLVGGDLVEVSPAYDPSGNTALTAANLLFEMLCVL................. 235
67 2.000e-89UniRef50_A0A2P2BYP6 Guanidinobutyrase n=6 Tax=root TaxID=1 RepID=A0A2P2BYP6_9ZZZZ  ali  18  24.......................................................................FARLPRLTDVPRADVAVLGVPFDSGVSFRPGARFGPGAVRAGSKLLRPYHPHLDVE-----PWSVLQVADAGDAAVN--PFDLDEAIRQIEAAAEATYEHADRL-------IAIGGDHTIALPLLRAAHRRHGPIAIVHFDAHLDTWDTY-FGAPYTHGTPFRRASEEGLLVLDHAS--------------HVGTRGYSRTDLEDDRKLGFATVSSEDLARRGVDEAIDRIRERV---GNHPVYLSIDIDVLDPAHAPGTGTPEPGGLTTRELQMILRGLTD-LEIVGADVVEVAPAYDHAELTTIAAANVVYEYLALFA................ 312
68 2.000e-89UniRef50_A0A2P2H787 Arginase n=9 Tax=leotiomyceta TaxID=716546 RepID=A0A2P2H787_ASPFA  ali  31  37.........................................................................................................APMALVEAGLLDQLRDDLGYTLDYDGTVHYYENQ-----IPAEDPDHRGMKKPRAVSAVTEALSAQVYEKAKQGQMVLTLGGDHSIAIGSISGSAKAGRELAVIWVDAHADINIPEMSPSGNIHGMPMAFLTRLAREEQKDFGWLQDEHIVSTRKLVYIGLRDVDRGEKQILREHGIKAFSMHDIDRYGIGRVVEMALAHIGN--DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLVAMDLVEVNPSLESVG-------------ASETIRTGCSLVRSALGDTLL 324
69 2.000e-89UniRef50_A0A2H5YY37 Guanidinobutyrase n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5YY37_9BACT  ali  18  12.............................................................WRPRFSGLRTFARFPHTTELEGVDIAVVGLPFDTGVTYRPGARFGPAAIREQSSRIECYHPVLDIDVTDV-----VSVIDFGDAPVVPMET---------ETSYASITATLQPLAARGIVPIGLGGDHSVSLPELRAVATRYGPVALVHFDAHVDTWDT-IWGNRYNHGTPFRRAVEEG--------------LIDPERSIQIGIRGGERAELEQSRELGFEVWTARQVRQASVSQVLGAIWRRV---GTHPVFLSFDIDFLDPVFAPGTGTPEIGGFTTWEAQEFLWGLV-GLRIVGADLVEVLPDRDPSGVTALIAANLVFDIIAVIA................ 310
70 2.000e-89UniRef50_A0A094IAD1 Uncharacterized protein n=4 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094IAD1_9PEZI  ali  19  583...................................VDQG-QQISEDRLAELKRKWNDEWAFSG-ISTFAHLPHLKCLVHPEELYDIAVIGSPFDTAVSYRPGARFGPRAIRAASARQTAN--RGFNPRAGFNPYTWATIKDCGDIPIN--PFDNELALRQMTEAFVELAHRPSKSGTQKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHPAKYPSWSSEQSQFNHGS--------MYWIASNEGLIANGSSVHAGLRSGDWEDYDDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGTEI--PVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV-DGLNVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMVK............... 930
71 3.000e-89UniRef50_A0A163A0X4 Uncharacterized protein n=2 Tax=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) Tax  ali  32  66.................................................................................................................................................PAQDPTVLNLKQPKFVSAVTEMISNQVRERALQGKFVLTLGGDHSIALGTVSGVFSAYPDACLVWVDAHADINTPGTTDSGNIHGCPLSFLAG---IAEEHPDFSWVKPCLKANRLVYIGLRDVDDGEKKILKELGIKAFSMHHVDQLGIGKIVEQALDYVNPDRNLPIHLSFDVDALDPSVAPSTGTPVRGGLSFREGHYICEALVNTGLLVSADIVEVNPVL------------LDEESAFQTIQVGCSLARCCL..... 307
72 4.000e-89UniRef50_A0A1Y2LJR6 Arginase n=85 Tax=Fungi TaxID=4751 RepID=A0A1Y2LJR6_EPING  ali  31  68.............................................................................................FSGGQPKPGVDAAPMALIEAGLIKELEN------DLDMKVSFDGQVHNYSELPEEDPDYRGMKRPKFVSAVTKQVSDQVYKYAKDGKLVLTLGGDHSIAMGTISGTAKAGREIAVIWVDAHADINTPETSDSGNIHGMPVSFLTGLAEDREDCFGWLKPEHMLSTKKLVYIGLRDIDRGEKKILREHNIKAFSMHDVDRHGIGKVMDMALAWIGS--DTPIHLSFDIDALDPMWAPSTGTAVRGGLTLREGDFIAECVAETGSLIALDLVEVNPSLDEVG-------------ASDTIRAGNSIIRCALGDTLL 367
73 4.000e-89UniRef50_A0A2V8C9B5 Agmatinase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8C9B5_9BACT  ali  16  1....................................................MTHQPRASFKSPRFAQPATFMRLPHVDDPHGLDVAIIGVPFDGGTSYRPGSRYGPREIRNQSSLIRSYSYF-----QRVAPFERLNVADAGDIDAPPV---------SIEKCYAVVEERIGATVEAGARPIVIGGDHSISLPVLRALARRHGPLGLVQFDAHIDTWDEY-FGGKYFHGTPFRRAIEEG--------------LVDGRRFIQVGIRGYGEDDFDFHREHGITVIDIDQLKDRGVAWAIAEIRRVV----TGPAYMTYDIDSVDPAFAPGTGTPEIGGLTSHDAQRLVRGLAGLTLLG-GDIVEVAPVYDPGQITSVLAANLMFEFLCALAFTA............. 311
74 4.000e-89UniRef50_A0A1Y5PFU5 Guanidinobutyrase n=57 Tax=Bacteria TaxID=2 RepID=A0A1Y5PFU5_9MYCO  ali  18  23..............................................................YPRYTEPSTFARLPRISEVPGADVRIVGVPFDSGVSYRPGARFGPSHVRAASKLLRPF-----NPALGVAPFAAQQVADCGDIAV---------NPFNIDEAIAAIDTAMTDLRKDGSTVLTIGGDHTIALPILRSLARDHGRVAVLHFDAHLDTWDTY-FGSPYTHGTPFRRASEEG--------------LIDMERSLHMGIRGYSKTDLEQDSVLGFQVIRSDDYEFDGVASIVERMRKRLD---GGPVYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLV-GLDIVGADIVEVAPAYDHAEITGIAAAHVGFELLSVLA................ 320
75 5.000e-89UniRef50_A0A1Z5SRI2 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5SRI2_HORWE  ali  28  737.............................................................................................FSGGQCKPGTDAAPMA------LIESGLVDQLKDDLKYDVHYDGQVHAYGDIPQEDPDHRQMKKPRAVSAVTQKLSQQVYDHAKEGRFVLTLGGDHSIAIGTISGTAKAGREMAVIWVDAHADINTPETSDSGNIHGMPVSFLTGLALDKDAPFGWIKDDQKVSVKKLVYIGLRDVDRGEKKILRDHGIKAFSMHDVDRHGIGKVMDMALGWIGS--DTPIHLSFDIDALDPMWAPSTGTAVRGGLTLREGDFIAECVHETGSLVALDLVEVNPSLEEQG-------------AAETVRAGVSIVRCALGDTLL 1036
76 5.000e-89UniRef50_Q12611 Arginase n=254 Tax=Eukaryota TaxID=2759 RepID=ARGI_EMENI  ali  30  37.........................................................................................................APMALVEAGLLDQLRDDLDYEIHYDNTVHYYEK-----EIPAEDPDHRGMKKPRAVSAVTETLSSQVYEHSKEGKFTLTLGGDHSIAIGSISGIAKAGREIGVIWVDAHADINIPEMSPSGNIHGMPMAFLTRLAEEKKDIFGWLQEEHKVNLRKLVYIGLRDVDRGEKKLLREHGIKAFSMHDVDRHGIGRVVEMALAHIGN--DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLISMDLVEVNPSLEAVG-------------ASDTIRTGCSLVRSALGDTLL 324
77 7.000e-89UniRef50_A0A094GW84 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094GW84_9PEZI  ali  19  371...................................VDQG-QQISEDRLAELKRKWNDEWAFSG-ISTFAHLPHLKCLVHPEELYDIAVIGSPFDTAVSYRPGARFGPRAIRAASARQTAN--RGFNPRAGFNPYTWATIKDCGDIPIN--PFDNELALRQMTEAFVELAHRPSKSGTQKPRLITLGGDHSLALPALRALNQLYGPVAVLHFDAHLDTWHPAKYPSWSSEQSQFNHGS--------MYWIASNEGLIANGSSVHAGLRTDGWDDYDDDDRQGFFRISADDIDDIGPAGVAKLIVEKIGTEI--PVYLSVDIDVVDPGLAPGTGTPEPGGWTSRELIRILRNV-DGLNVVGADIVEVAPAYDRGEQTALVAAQIVYEILTSMVK............... 718
78 1.000e-88UniRef50_C5LR61 Arginase n=2 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5LR61_PERM5  ali  32  14..........................................................................PPIPSLCEPRTLVMIGAPISEGQDYDSGVAKAPQALRDGGLSAVVEEVGWGFEDRGDLDLDQLADTPVPNAPPVPPFYDNAKNCEKIGRACGHIFDAVYNAANEGKFVLTVGGDHSLGCPTIAGVMRARPNACVVWVDAHGDCNHPETSPSGNYHGMPAAHAMGEKRARGFEWMDEHLSHPLKEDRIAFIGLRDIDPEERRLLRQSKVKCFTMTDVDRLGISAVMEEALKQINPRGDRPIHLSLDIDGIDPVIAPGTGTKAKGGLTYRESHYICERLAMTGQLGSMDLVEINPVMDSSPQTAVSVSSIGQPLDTPTVRLGLELVESALGKTII 389
79 1.000e-88UniRef50_Q9I6K2 Guanidinopropionase n=69 Tax=Proteobacteria TaxID=1224 RepID=GPUA_PSEAE  ali  18  23.......................................................................FMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSL-----MRKVHHVSRIAPYDLVRVGDLGDAPV---------NPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGR-ERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEG--------------LLDPLRTVQIGIRGYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVV---GAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGL-RGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAAR........... 316
80 1.000e-88UniRef50_V5FMH2 Uncharacterized protein n=1 Tax=Byssochlamys spectabilis (strain No. 5 / NBRC 109023) TaxID=1356009 RepID=V5FMH2_BYSSN  ali  18  24.......................................PTPNVGPDFKYKIEDLSVDLPFSQPVTFAHLEWQRCLAHSHSEPLDIAILGFPYDTSTSYRPGARFGPRGIRAASSR--EKKGRSYNSPWGVDPFEGLSIIDCGDIPIT--PFDAEHAFKQMEQGYRQIYHGTSDALDKHPRVLSLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHAS--------------REGCISKGTSVHGGLRTFSSKDYEIDQDVGFTLIEAQEIDEIGMEGIINKVRATV---GDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGL-EGVHLVGADVVEVSPPYDTAETTSIAAADLLVDILALMVK............... 368
81 2.000e-88UniRef50_A0A0L0HPL8 Agmatinase n=6 Tax=Fungi TaxID=4751 RepID=A0A0L0HPL8_SPIPN  ali  17  62.............................................................FSGITTFAHLPSERCWKDKDVDYDIAILGLPFDTATSYRPGARFGPAGIRQGSKRLVLY--GGYNVPQNVNPFSWAKIIDCGDVPVT--PYDNALAIEQMQYGHKELLHRTPALAAQFPRLVTLGGDHTIVLPILRSIASAYGPVSVVHFDSHIDTWKPKVFGGKYNHGTYFYHAS--------------QEGLIKNGSSIHAG-----PSDYDNDALCGFHIIEARDIDEIGTKGIAERIKKAV---GDNLVYLSIDIDVLDPAFAPATGTPETGGWTTRELRTIIRSL-DGVKLVGADVVEVAPAYDTNELTTMAAADVLFEVISLMVKNPLK........... 385
82 2.000e-88UniRef50_A0A1G8M7E4 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G8M7E4_9BACI  ali  17  1.....................................................MYKPKDSSKSPRYTGVRTFMRLEQIQTTEGVDFVVAGNPFDTAVSNRIGARGGPQHIRNFSVLLRPY-----NPDQGINIFDYCSGVDYGDFEIVP---------QNIHRSYDIVGEQLAPIIEKEITPIILGGDHSVSLGHLRAFAKKYGPVALVHFDSHSDTWDNY-FGEKYMHGTPFRRAVEEG--------------LIDTSHSIQVGLRGYGPEDITDPEELGFKTIPMREVRKLGKDEVLRQIHER---AGNKPVFVSYDIDFVDPAFAPGTGTPEVAGPDSFEALEYVRELY-GLNIKGFDLVEVLPEYDSDDITAALASTIAFEMITLVA................ 307
83 2.000e-88UniRef50_A0A1V8V764 Uncharacterized protein n=1 Tax=Rachicladosporium sp. CCFEE 5018 TaxID=1974281 RepID=A0A1V8V764_9PEZI  ali  30  447.............................................................................................FSGGQCKAGVDAAPMALIESGLVDQLQNDLAYKVHYDNEVHAYTSL-----LPSSDPPHRGMKNPRAVSAVTQELSNQVYAHAKEGRFVLTLGGDHSIAIGTISGTAKAGRDMAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLATEAENPFGWLKPEHRVSVKKLVYIGLRDIDRGEKRILREHGIKAFSMHDIDRHGIGKVMDMALGHI--GTDTPIHLSFDIDALDPSFAPSTGTAVRGGLTLREGDFIAECVHETGSLVALDLVEVNPSLEQNG-------------AAETVRAGVSIVRCALGDTLL 746
84 3.000e-88UniRef50_A0A1D2MVY3 Arginase n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2MVY3_ORCCI  ali  31  29LFSTSPSHSFQKSLTNNLRVGVQGVELYRGQNKRGVELGPKAIRDTGVVAALRNVGHEIVDYGNAPIMEMQE---------------------EAVLQERLVASGG----RQ-SQTVPESDYNGYL---------------------------NVHYVKQVADANRMISDWTSKIMRDGRVCLTLGGDHALGIGTVNGASQVHPDLGVLWIDAHSDINTPLTTGSGKIHGMSVAFFVQELQPYMTQLPFSWVQPRIKAANLAFIGLRDVDPAERAILEMLGITAYSMRDVDRHGIQKVTEMALSKISQDKKRPIHVSYDIDSLCESIVKSTGTPVPGGLSLREGITLLEMINETGRMVSMDLVEVNPLLG..................................... 346
85 5.000e-88UniRef50_A0A259SZ26 Arginase n=14 Tax=Bacillales TaxID=1385 RepID=A0A259SZ26_9BACL  ali  37  57..................................................................................................................................................LKPYPVTHMKHVDQVMAICSQLAREAAAAASAGGVPLILGGDHSIAMGSLAGLSRRYPNMGVIWVDAHSDLNTEITSPSGNMHGIPLAAAFGLTQLKLTQVLSGAV--HLKPENCVIIGARDLDRDEKTLIRSRGITCFTMYEIDRLGIEHVVQEAL-RIAGTGTDGLHVSFDIDSVDPFEAPGTGTPVRGGLSYREAHLIMELMSESGLVTSADMVEVNPSLDRNNQTS---------------KLAVELLCSLFGSRIL 299
86 6.000e-88UniRef50_A0A2W1HEY8 SpeB, Arginase agmatinase formimionoglutamate hydrolase, arginase family n=1 Tax=Pyrenophora tritici-repentis TaxID=45151 RepID=A  ali  19  427.........................................ALRGMGRQHIGATVNIADSIFSGISTFGRLPYH-PCLSSDVDYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLY--GGYNVPLKANPFSWAKVIDCGDIPVTS--YDNAYALQQIEQGHNLLLSRAPHTHANKPGPITLGGDHTITLPLLRSVHREYGPITVIHFDSHLDTWRPKVFGGAPSEQASINHGT--------YFFHAAQEGLLANDTNIHAGIRTTLPSDYDNDGYCGFEIVEARAIDKIGIDGIVKKIRDRV--GLERPVYLSIDIDTLDPAFAPATGTPETGGWTTRELRTIIRGL-EGINLIGADIVEVAPAYDTNELTTMAAADTLYEVMTLMVK............... 775
87 6.000e-88UniRef50_A0A1H0AFP5 Arginase n=2 Tax=Dendrosporobacter quercicolus TaxID=146817 RepID=A0A1H0AFP5_9FIRM  ali  29  10......................................................................................................ANLAPAALRAAGLQKRLTAFN-------------QDIIDLGDIPIAEAGEQQVKNLQPIIAASNEIARCVDRIVASDRFPLVLGGDHSIAIGTLAGLIGHYDNLGIIWYDAHADINTPATTPSGNIHGMPLAVAMGSGHAELLSIGGAGVR--IKPENIVYIGVRDIDPGEAAFIDEQQIKLYTAEDVGRWGMPAIIEQTLAHLAAC--DGIHLSFDIDGIDPLAMPGVGTPAAGGVSYRDSILALQLLEQSRAVTSAEFVELNPVLDKDGQTTRAVVDLIAAFLG................... 283
88 7.000e-88UniRef50_A0A2T9XAG4 Agmatinase n=1 Tax=Acidianus hospitalis TaxID=563177 RepID=A0A2T9XAG4_9CREN  ali  20  33....................................................................................NIAIIGVPWDDLATSRPGARYGPLGIRNASSFILPN--RKYNYVLDINPFEVTKIVDYGDVEVHAGY---------IEDMFNEVEKEVKEMLKKNVIPVVLGGDHSISLPIIRGLSSKYKKVAVIHVDAHHDSLDIL-YGKKYDHGTIFRRGVEEG--------------VIIGESSVHYGVRVFSKEDMESVRALGYDLLTMKIIDEEGLSKTVEQLKRKV---GDQPVYLSIDIDVMDPAYAPGTGYPDPGGLTSREILEFVRKLY-GLNIIGMDVVEVSPPYDVAEITSTLAASIVFEGLSIISKNLKK........... 317
89 8.000e-88UniRef50_A0A2B6LRW5 Arginase n=54 Tax=Bacillaceae TaxID=186817 RepID=A0A2B6LRW5_9BACI  ali  33  42........................................................................................................................................IDFVDLGDISLPSTNNKNYGIVKQVIDICKNIASTVENELEKGHFPLVLGGDHSIAIGTVTGILRKIPRLGVIWFDAHGDANTFETSISGNIHGMSLAILLGYGNEKFKDF--LEKETKIDPKNIVQIGIRDLDPGEEEFLKNLGVTIFTAEDVRKQGIKSIMEKAIK-ILNNNTDAVHLTFDLDALDPEFAPGGGLAVPHGLSLDDTKEAIDMLRNNTNLVAAEFTEINPILDKDNITVNTTIELITELLSK.................. 296
90 9.000e-88UniRef50_A0A0D2WMM6 Uncharacterized protein n=2 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WMM6_CAPO3  ali  20  466....................................................................................QAAFVGVPFDLGTSNRVGTRYGPRAIRAESVLLRPYNM-----ATRAAPFECLQVADAGDVPINT--YNLAESIKIIEQFYS------DNILQHNCVPMTLGGDHTITLPILRAIVKKHGPVGLVHIDAHSDTNDVMK-GEKIAHGTTFRRCVEEG--------------LLDTKRVVQIGLRGYAADDFDWGRKQGFRVVQAEECWYRSLAPLMAEVRAAM---GSGKVYVSFDIDGLDPSVAPGTGTPEYGGLTAHQGLEIARGV-RGLNIVGCDLVEVAPQYDTSGNTALLGANMLFEMLCSL................. 741
91 1.000e-87UniRef50_A0A0P9CCP6 Uncharacterized protein n=2 Tax=Bacillales TaxID=1385 RepID=A0A0P9CCP6_9BACL  ali  18  7..............................................................YPRFEGIHTFMRFNYEPSPQPVDVVLLGAPFDTAASYRVGARFGPEAIRRVSSLLRPANMY-----HRIRPDDSLRIVDGGDA---------MVIPGNIERSYASITERVSSWLAEGATPIMLGGDHSIALAELRALAGKYGPVAMIQFDAHGDTSDEY-WGEKDTQATPFRSAVEEG--------------LLNPAKSTQIGMRGYDTNDIEAGRQLGFDVVTMEQVRERGLKPVMQAAQ---LRAGNTPVFVSFDIDCLDPAYAPGTGTPEIGGFTTFEAQHMIHQLV-GLNCVGFDVVEVLPSQDVSEITALAAATVAFEFLTLIA................ 304
92 1.000e-87UniRef50_A0A2N3MXM2 Arginase (Fragment) n=123 Tax=Opisthokonta TaxID=33154 RepID=A0A2N3MXM2_9PEZI  ali  30  22..................................................................MHVDMCTSMVKSRFLSNPHDLGVVAVGFSGGQGKAGVDDGPVALIESGLINQLRNELGYKIHGD----EEVQVRSYHDIPTDDPPFRNMLNPRSVSAVTAKIADEVYSHAREGRMVLTLGGDHSIAIGTIAGTAKAGKELAVVWVDAHSDINTPETSDSGNIHGMPVAFVSGLAKEEKPDFGWLKEDHMLSLKKLVYIGLRDVDVAEKRILRENGIKAFSMFDIDKHGIGRVVEMALAHI--GNDTPIHLSFDVDALDPMWAPSTGTPVRGGLTLREGDYICEALHETGNLVAVDLVEVNPRL--AAETELGPAE--------TVRAGSSIVRCALGESLL 354
93 1.000e-87UniRef50_A0A0H4W4P5 Guanidinobutyrase n=48 Tax=cellular organisms TaxID=131567 RepID=A0A0H4W4P5_9BORD  ali  19  11...............................................................PRYSGMPTFMRVPQAAPQDDFDIALAGVPFDGGVTLRPGARFGPREIRNMSSM-----TRAIHHVTGFNPFAVCKVADIGDVPFTG--------FGQLEAAHADIRRFFAPLFAAGKKVLVAGGDHSITFPIFQAIAPR-QPLGMVHIDAHTDTWDEHA-GSKFSHGSPFRRAVE--------------AGLLDPRRTIQIGIRGATDEGWRYSLDHGMRVVFIEEFDAAGVQAIVREARRVV---GPGPAYLSVDVDGLDPVYAPGTGTPEIGGLSTRETLALLRGL-DGLDFVGADVVEVAPPYDPSGNTALLGATLMYECLCLLAR............... 308
94 2.000e-87UniRef50_A0A1Y6CN32 Arginase n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6CN32_9PROT  ali  35  17.....................................................................................................................................IQGYKVRDIGDLFVPSQEIQDEKFLQPLTQICEDLCGKTHNAVQSGNIPLVVGGDHSIAIGTISGIAKHHGELGVVWVDAHADINTPDSSPSGNIHGMPLATLMGDGHPELCKI--GGDGPKLKPENVALIGIRTIDDDEKRVLKASGVNYYSMRDIDERGMFRVMKEAIEKVSAN-TKALHVSFDIDGIDPRYAPGVSTPVSGGLTLREAHLLLEMLYETKKLGSLEFVELNPYTDVG---------------AQSANLTVDLILSALGKSIV 281
95 2.000e-87UniRef50_Q8KZT5 Guanidinobutyrase n=458 Tax=Bacteria TaxID=2 RepID=GBH_ARTS8  ali  19  43.....................................................................................VTVVGVPFDSGVSYRPGARFGANHVREASRLLRPY-----NPAWDVSPFENIQVADAGDM---------AVNPFNINEAIETIQQNALDLTANGSKLVTLGGDHTIALPLLRAAAERAGPIAMLHFDAHLDTWDTY-FGAEYTHGTPFRRAVEEG--------------ILDTEAISHVGTRGYGKKDLDDDHRFGFGIVTSADVYYQGVLETVAKIRDRI---GNRPLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEIIRG-FRGMNLVGADVVEVAPAYDHAEITGVAGSHVAYELVTLMADNAVE........... 323
96 2.000e-87UniRef50_A0A0B0HX53 Arginase n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A0B0HX53_9BACL  ali  38  57..................................................................................................................................................VRSPAGTKMKHVQEVLAVCTRLGEAVSEAVADGRIPLVLGGDHSIAIGSLAGLTRHYGNMGVIWVDAHSDLNTESTSPSGNMHGISLAAGLGLTHLKLKQIAEGAAS--LKAEHCVIIGARDLDRDEKALIRSCGLTCFTMHEIDRLGIEQVVREAL-RIAGQGTDGVHLSFDIDSVDPIEAPGTGTPVRGGLSYREAHLLLELLSESGAVTSADFVEVNPLLDRNNQTS---------------KLAVELIGSLFGSRIL 299
97 2.000e-87UniRef50_A0A2X0PE90 BQ5605_C021g09361 protein n=2 Tax=Microbotryum TaxID=34416 RepID=A0A2X0PE90_9BASI  ali  28  1.......MSTHNFLKSPLTAGIVGCPFSGGQPKEGVDTGPRQLIEAGLLDDIKTLGYHVEFEGADSLATSLTSDQPDPDIGILKKPRLVSKVGVENSCRK---------MRSLSDQL-------INDELHF-------------------------------QVTQELADKVFAHASKGHLTVTLGGDHSLAMGTVSGTFRAYPEAALIWIDAHADINTPLTTPSGNLHGCPVSFLMGLGTSPQEIPEFGWCKPVLKPSRIVYIGLRDIDSGERKILKENNIKCFSMFHVDKYGIGKVVDMALEHVGR--DRPLHLSFDVDAMDPEVAPSTGTAVRGGLTFREGHYICEGLAETGNLVSLDLMEVNPSLGDD------------LSVAQTISVGRSLVRCALGETLL 365
98 3.000e-87UniRef50_A0A2H0WI42 Agmatinase n=2 Tax=Bdellovibrionales TaxID=213481 RepID=A0A2H0WI42_9PROT  ali  19  24.......................................................................FFRLPVVEIKEKFDVALFGIPYDGGVSYRPGARFAPTEVRNASSLGRGFHWNREL-----NIFEQLKIADVGDCPTVPIDQN---------QTYEKIEKFVGSILKTNKKFVAVGGDHSTTLPVLRALKKHYKPLAFVHFDAHLDTY-PAAWGCEYHHGAFARHAVEEG--------------LVDPKKMLQIGIRGPSKEDLAFVKKHKVQVKTVDDVR----AGSLDQFLKTLPTFDNTPTYISFDVDCLDPAFAPGTGTPVVGGLTSYETQRILRAL-KIPNLVGGDVVEICPPADHADITSLVGVDVMFEMLCLM................. 311
99 3.000e-87UniRef50_C7D719 Agmatinase n=57 Tax=root TaxID=1 RepID=C7D719_9RHOB  ali  17  17....................................................................PQTFMRLPEAETPEGLDVGFIGIPMDIGTSWRSGTRMGPKQVREQSAMIRPYNI-----QTGAAPFDALQCADLGDV---------AINTFSLSDSLRIITETYDKHLKHNFIPMTLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVND-EMFGERETHGTVFRRA--------------YEENLITPSKVYQIGLRGYTSEDFTEAEGWGFNTVLAKDLWHKSLTPLAKTIKDAI---GDQPCYITYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRGI-NGLNIVGCDLVEVSPPYDPSGNTALTGANLMFELLSIL................. 307
100 4.000e-87UniRef50_A0A284R5A1 Related to agmatinase n=1 Tax=Armillaria ostoyae TaxID=47428 RepID=A0A284R5A1_9AGAR  ali  19  80...................................ADQMPLDYVKYPLEPLYRTITADAIFSGITTFAKLPWVQCLTKEKGELFDIAFIGAPFDTGTSYRPGARFGPAGIRTGSRRLTLY--GGYNVPLESNPFQGLKIVDCGDIPVT--PYDNKVAIKQIEEGHKALLHRTGQTLKHHPRVITLGGDHTIVLPLLRSIYSAYGPISVIHFDSHLDTWKPSVFGGAPSDVAAINHGT--------YFYWASQEGLIKNGSSIHGAIRTTLSEDYDNDDDAGFKRIEAREIDVIGTDGIIKKIRETV---GDAPVYLSIDIDSIDPAFAPATGTPETGGWSTREIRTILRGL-DGLHLVGADIVEVAPAYDTNELTTIAAADVLFEVLTVMAKT.............. 449
101 4.000e-87UniRef50_T1FZK4 Arginase n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1FZK4_HELRO  ali  31  10....................................................................................................................................................DDRVSNVKRAKSVGKANEQIAKVVEQSISQNHFCVALGGDHSIAIGTIIGHARAHPNLAVVWIDAHADLNPPLASPSGNSHGMPVSFLLRELVEYIPKPGFEWAKPCLGVKDIVYIGLRDLDEAEKALIEKHNILAFTMREVTELGVDAVVRAAIKYISPSGTRPIHLSFDIDGLDPTDAASTGTPVPGGLLLREGVYITESLAATGHLQMIDMVEVNPTLGSSKE------------QVRTLQSACEIIGACFGKR.. 256
102 5.000e-87UniRef50_A0A2G7FWS6 Arginase n=1 Tax=Aspergillus arachidicola TaxID=656916 RepID=A0A2G7FWS6_9EURO  ali  20  45.....................IVFPPIAAIQGSGQVPLGKDDTVDI-------VTGSQFSGLTTFGHLPYVNCLMDDQAHSTPYDIAILGAPFDTGVTARPGARFGPVGIRLGSRRLQGWSIY-----TGVNVFEWAKMVDCGDAPLT--PLDNTVALKQLDLAHKVISSRPTNSTERGHTPLTLGGDHTTTLSALRSTYDKWGPVSVIHFDSHLDTWDPKVLGGGISHYAGVNHGT--------FLHIAHEEGLIRNTSL-HVGIRAPVKGDIRNDIRCGFEIIKARDLDRVGISGIVEQIKARV---GDSKVYISVDIDVLDPAYAPATGTAEPGGFTTRELLSILDALH-GLPVIGADVVEVAPVYD..................................... 372
103 6.000e-87UniRef50_C3MH08 Agmatinase SpeB n=93 Tax=Bacteria TaxID=2 RepID=C3MH08_SINFN  ali  19  15............................YGESHGGELFDPTFRKVADKIFTKSGTRLAPYSGIPTFLTAPYMPVDADNPDFGNLQVAIVGIPMDLGVTNRPGSRFGPRALRAIERI------GPYNHVLGCAPVHDLRVADIGDVPFRSRYR--------LELSHEDIEKRLNQIVDAGVVPLSVGGDHSMTHPILKAVGKK-QPVGMIHIDAHCDTGGAY-DLTKFHHGGPFRNAV--------------LDGVLDPTRVIQIGIRGSAEYLWEFSYESGMTVIHAEEVSGLGIPAIIEKAKKIV---GDGPTYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLELIRGL-KGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMVF............... 344
104 6.000e-87UniRef50_A0A1Y4NS07 Agmatinase n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NS07_9FIRM  ali  20  10................................................QPKYTPADWLTGKSGDMDVAPGTFGRLPYMRTLEDVDYVVVGIPFDTLTSNRPGTRFGPKAIREA------YGGINYVYGTDVYAAETLSGVDYGDIQVQNGDTK---------QSFENIKAEIGKILEAGVIPVALGGDHSITYAELLAYRDVYGPVSLIHFDSHTDTWGGEESLDFPTHANPFRNAI--------------LTGCIDPKTSIQVGMRGIMKSEYDFAHENGLEQIFATDLHKMGVYEAAKKIREKV---GNNKVMVTFDIDFVDPAIAPGTGTPVPGGFTSWETLELVRTAITGLDVVGFDLVEVAPNYDPTENTQLLANKLVGEFITAIA................ 322
105 7.000e-87UniRef50_K2SF00 Arginase n=3 Tax=saccharomyceta TaxID=716545 RepID=K2SF00_MACPH  ali  35  1..........................................................................................................................................................MKCPRAVSAVTRKLSEQVYEHARQGRCVLTLGGDHSIAIGSISGTAKAGREIAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLAEDREDIFGWIKEDQMISVKKLVYIGLRDVDKGEKKILRENGIKAFSMHDIDRHGIGKVMDMALGWIGS--DTPIHLSFDVDSLDPQFAPSTGTPVRGGLTLREGDYIAECVAETGSLIALDLVEVNPSLESAG-------------ASETVRAGCSIVRCALGDTLL 244
106 7.000e-87UniRef50_Q4WHD9 Agmatinase, putative n=118 Tax=Pezizomycotina TaxID=147538 RepID=Q4WHD9_ASPFU  ali  18  31...............................................LREELLKKWDQEFTFSGIASFAHLKPVKCLVEPDERYDIAVIGAPFDTAVSYRPGARFGPRAIRAASARQMAGT--SYNTRAGINPYSWATVKDCGDIPIT--PFDNGLAERQMYEAFLELGSRAKGISAGKAKLVTLGGDHSIALPALRALYQIYKPITVLHFDAHLDTWNPAYWTSEQSH---FNHGS--------FFHKASREGLICNSTSAHAGLRGVDDSDYTAPNEQGFMRIHADDIDELGPMGIVDKIIERIGRDPEQPVYLSVDIDVLDPSTAPGTGTPEPGGWTTREFIRILRGI-EKLNIVGADIVEVSPSYDNKGETALAAAQVAFEIITSIVKAGA............ 386
107 8.000e-87UniRef50_L0DI55 Agmatinase n=5 Tax=Bacteria TaxID=2 RepID=L0DI55_SINAD  ali  18  5....................................DLSPLFERIAG---------YGRHMLDMPFSGPTSFFRTDVVDTLEGVDIALIGVPTDAGLSHRPGARYGPQAVRAQSGLIRYINPY-----TGVIPYEHGRVVDAGDVP-----FQNTLVLDDI---VREIFSYYTQVVAAGVVPLSVGGDHSITYPILKAVASR-GPVGLIHFDSHHDTAPPMK-GSRFHHGAPFRNAVE--------------DGLIDPRRTVQIAIRDPYRQAARYAEAHGFTVLDMPLILREGLDAVVATTRKTI---GDGPVYITFDVDALDPAFAPGTGTPVVGGLSSREAMILLQGL-RGLNIVGADVVEVSPPYDPTGMTALAGAQILMELLCLASESLAK........... 323
108 8.000e-87UniRef50_A0A2H3JBH6 Arginase/deacetylase n=3 Tax=Agaricomycetes TaxID=155619 RepID=A0A2H3JBH6_WOLCO  ali  18  68.....................................................................HLPYSLCLEDTTAGFDIALLGMPFDTGVTYRPGARFGPYAIRSGSRRQRE--TRGYTLAWKVNPYELGKIIDCGDVPVS--PFDNALAVDQMEVAYNAPSLATSKFAKDGKRIITLGGDHTIVLPILRALHKVYGPVSVIHFDAHLDTWASYTEQSRVTHGTFFYLAQEEGLMTNT---------------SIHAGIRCAGIGDLENDKAVGFQLISTDDIDDLGVAEIIKRIRARI---GDSPVYLSLDIDVIDPGLAPATGTPEAGGWTTREVKRIIRGLA-GLNFVGADIVEVAPAYDNAEITAIAAADIVHDFLS................... 386
109 8.000e-87UniRef50_A0A1S7HLM1 (ZYRO0G05610g) n=17 Tax=saccharomyceta TaxID=716545 RepID=A0A1S7HLM1_9SACH  ali  17  16.............................................ASLASLSEASKWSEDWPFSGLQTFAKLPFHRCLVEPTEFDIAIIGVPFDTAVTFRPGARFGPQAIRRASQRQ--NELRGFNARAGINPYDWATVVDCGDVPVT--PMDNQLALKQMNEAYKEQEERWPQQSQAPPRFMTLGGDHSVILPVLRALHAHYGPIAVVHLDSHLDTWSPSSYPS-YWHSSEFTHGS--------MLWLAAREGLLAKGHCVHAGIRGNGWDDYKEDDRVGFHRIHADEMMDLTPRGVARKIKSFIPK--GMPVYLSVDIDVLDPSAAPGTGTVEPGGWLTRELIAVLRNL-EDLPLVGADVVEVSPPFDHADVTAMAAAQVAYEIVTSMVKTPLK........... 362
110 8.000e-87UniRef50_A0A088U2K6 Agmatinase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A088U2K6_9BURK  ali  19  23.......................................................................FMRLPLFDDPAQLQIALVGVPWDGGTTNRAGARHGPREVRNQSSL-----MRRVHHVSRIAPYDLVRVGDLGDAPT---------NPIDLLDSLARIERFFRRIDAAGAVPLSVGGDHLVTLPIFRALAAR-RPIGMVHFDAHSDTNDRYFGDNRYTHGTPFRRAIEEG--------------LLDPQRTVQIGIRGYSADDEAFARDCGIRVIAMEEFTALGVAATLAEARRVV---GSGPTYVSFDVDVLDPAFAPGTGTPEIGGMTTLEAQHLVRGL-QGLNLVGADVVEVSPPFDAGGATALVGATMMFELLCILADA.............. 313
111 9.000e-87UniRef50_A0A2E2E306 Agmatinase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2E2E306_9PROT  ali  18  22.....................................HDPDFKKVAATIFDDAGTRQAPFAGVSTFLDAPWHEVDPKSPDFGDLQVAMVGVPMDLGVTNRPGARFGPRAVRTIERI------GPYNHVLKCAPVSELRVADIGDVPFRSRF--------SLNSCHEDIEDYLAKIVAAGVIPLSIGGDHSVTLPIMKAIGKK-APIGMIHFDAHCDTG-GEFDNSKFHHGGPFR--------------EAVLEGVLDPERCIQIGIRGPAEYLWEFSVDSGMTVIHAEDVAEMGPAAVIKKARDVVR---DGPVYVTFDVDCLDPAFAPGTGTPEIGGVTSREAMTMLRGLA-GLNIIGGDVVEVAPQYDSTTNTAQVGAQILFEILCLMRF............... 342
112 9.000e-87UniRef50_A0A0J6NP84 Agmatinase n=43 Tax=Proteobacteria TaxID=1224 RepID=A0A0J6NP84_9NEIS  ali  20  31.......................................................................FMRRNYSRDLTGADVVVSGIPLDLSTTFRSGARLGPQAIRAASVQLAELSPF----PWGFNPFDELAVVDYGDCWFD------AHNPLTIKPSII---EHARTILASGAKMLTFGGDHFITYPLLIAHAEKYGPLALLHFDAHCDTWPDDEPDSLN-HGTMF--------------YKAVKEGLVDPRKSVQVGIRTWND---DFM---GMNVLDAPWVHDNGVDVAIARIKEVI---GDSPVYLTFDIDCLDPAFAPGTGTPVPGGLSSAQALKIVRNLGD-LNIVGMDVVEVAPAYDNSELTAIAAAHLACDMLCLM................. 312
113 9.000e-87UniRef50_A0A060T991 ARAD1C42174p n=8 Tax=Saccharomycetales TaxID=4892 RepID=A0A060T991_BLAAD  ali  17  23......................................................KWGTDWPFSGISTFAHLPTEKCLVNPDESFDIGVIGVPFDTAVSYRPGARFGPRAIRAASMRQT--SLRGFNARAGINPYAWAKIIDCMDMPVT--PVDNKIALTQMTAGYKELLKRPVAYTANGPRLITLGGDHSIVLPALRAYHEVYGPITVIHFDAHLDTWLPSAYPSEFTHGSMF--------------WMAAQEGLLDKDHCVHAGLRGVDWADYESDDQSGFARIGSDEIM-GDVQGVVSKILDRVPK--DVPVYISVDIDVIDPGMAPGTGTPEAGGWLTRELIQVIRGLS-GLNIIGADVVEVSPAYDHAEITALAGAQIAYELITSMVQVGV............ 355
114 9.000e-87UniRef50_I3XC91 Guanidinobutyrase Gbh n=750 Tax=root TaxID=1 RepID=I3XC91_RHIFR  ali  19  15............................YGESHGGELFDPAFRKVADKIFTKSGTRLAPYSGIPTFLTAPYMPVDADNPDFGNLQVGIVGIPMDLGVTNRPGSRFGPRALRAIERI------GPFNHVLGCAPVHDLRVADIGDVAFQSRYR--------LELSHEDIEKRMNQIVDAGVVPLSVGGDHSITHPILKAVGKK-RPVGMIHIDAHCDTGGAY-DLTKFHHGGPFRNAV--------------LDGVLDPTRVVQIGIRGSAEYLWEFSYESGMTVIHAEEVTGLGIPAIIEKAKKIV---GDGPAYLSFDIDSLDPSFAPGTGTPEVGGLTTREVLELIRGL-KGVNLVGGDVVEVAPQYDATTNTAHAGAQVLFEILSLMVF............... 344
115 1.000e-86UniRef50_A0A1G7QVI1 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QVI1_9DELT  ali  17  12.............................................................SSPRFCNTGNFMRLPRMADPTGMDFAVFGIPFDTGSSYRTGSRFGPAAIRNISSMIKPN-----HVIFEVNILNELRGGDFGDVNIVPGY---------IEPSYAAITEFMTPLLAAGVTPLALGGDHSITLAELRAIAARHGKVSLLHFDSHLDLNT-AVFGQPYNHGTPFRRALEEG--------------LIDPATSIQVGMRGYDPDDFKVAAELGFKVLPAHVMREMGLAEVIKAILERL---GRTKVFCTFDVDFVDPAYAPGTGTPEVGGFTTWEVLRLVRALNE-VHFVGFDIVEVLPAIDPAELTPYVAANLGFEFLSILA................ 310
116 1.000e-86UniRef50_A0A2B7WII0 Agmatinase n=3 Tax=Pezizomycotina TaxID=147538 RepID=A0A2B7WII0_9EURO  ali  18  11...................VAVVSAHLDHG------DQTPIAGPLGGLWYPGDGGKQADSVFSGISTFGRLPYFPCLASDQESFDIAFLGAPFDTGTSYRPGARFGPSGIRQGSRRLNLY--GGYNVPLAANPFTDIKVLDCGDIPVTS--YDNTWAIQQVEEGHKPHTDAYEKISLAGRRIITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDTWKPKVFG-----GAP---SSVAAINHGTYFYHAAQEGLLRNDTNIHAGIRTTLSGDYENDGYCGFEIVEAREIDTIGTAGIIKKIRDRV--GTVNPVYISIDIDTLDPAFAPATGTPETGGWSTRELRTILRGL-DGINFIGADIVEVAPAYDTNELSTMAAADVLYEILTMMVK............... 379
117 1.000e-86UniRef50_I2JQM8 Arginase family protein n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JQM8_DEKBR  ali  17  4.......................................PKSQSESRKSPTLEQLWGQXWPFTGIPTFAHLNTTKCLLSPESXYDIGIIGVPFDTATSYRPGARFGPQAIRLASQRQ--NSMRGFNTRAGINPYQWASLVDCGDIPVT--PMDNKVALDQMTAAFEELLLRRNSSLGDAHPPVALGGDHSIILPHLRALHEVYGKIAVIHFDAHLDTWTPXKYPSWSSEQSKFTHGS--------MLWMAKKEGILSDDYNVHVGIRGVSWEDFDEDDDQGWLRFSADDVWKQSLDQIVASIKKRIPAHY--PVYISVDVDCMDPGFTPGTGTIEPGGMMPREVIYLLRHL--DLDLVGADVVEVAPAYDQAEITATNAAQVVFELVTTMVK............... 351
118 2.000e-86UniRef50_A0A1D2R7S3 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon WOR_SM1_79 TaxID=1849365 RepID=A0A1D2R7S3_9EURY  ali  19  1..................................................................MMNSKSTFMNFSRKFEDAEICILGVPFDVTETYRRGARFGPGSIRESSLSVEEYSQGFGL------DLGDLRIADLGDIE-----------AGDVKETLKGIEERISEIISKDKLPVVLGGEHLISLGAVRALKKKHEDLKIIQFDAHLDLRDE-------YEGERLSHSTVMRRIYDI------------CNDLYQIGIRSGSREEFDFAKE-NTRIYGADDI-SASISDVIEKI-------GDKPVYVSIDIDVLDPAYAPGTSNPEPCGISTRELMDAVHKIGKLG-VVGFDVVEVCPGYDKSEVTPITAAKIVREGI.................... 275
119 2.000e-86UniRef50_A0A2C5YQ83 Uncharacterized protein n=1 Tax=Ophiocordyceps camponoti-rufipedis TaxID=2004952 RepID=A0A2C5YQ83_9HYPO  ali  17  2................KSAVALVGVCSAHGADDHGGPWSKEAL------AELEAKWGYEWGFSGIGSFAHLDHVKCLVDPSVQFDIAVIGVPFDTAVSFRPGARFGPRAIRHSSARQTAF--RGFNPRAGINPYDWAKIIDCGDMPIT--PFDNQIALEQMTQAFREGKRKASKTSNPRPRLVTLGGDHSLALPALRALKEIYGPVRVLHFDAHLDTWDPYSYPTQFTHGSMFWMASQEGLLSNSSSSPS-----------VHAGLRGTSWADNESDGSQNWVRFSADDMDEKGTSGIIDGIVKTL--GTEDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGI-EGLNLVGADVVEVSPAYGRGEETALAAAQVVYEMVTSMVKRGSK........... 375
120 3.000e-86UniRef50_UPI000852C38D agmatinase n=1 Tax=Vulcanisaeta thermophila TaxID=867917 RepID=UPI000852C38D  ali  18  41......................................................................................VFLGVPFDGGATFYVGARFGPQYIRSESRILRPYNAELD-----VYPFKVLRAVDYGDVDVIPV---------SITKTLDGIEEVVKDVINQGATLFIAGGDHSITLGVLRAIGKMFKPI-LLHFDSHLDYWDEY-WGEKYTHGTWVRRAIEEGLIA----------------QVVQVGIRGYDKSDFNYPRESPIRVIMMREVEERGIEWLISELR-----SLEGNVYVSFDIDVVDPAYAPGTGTREPGGFTSNEVLRIIRSLADAKNLVGFDVVEVAPPLDVANITSLLAANILYQAMSVKSKLMLK........... 318
121 3.000e-86UniRef50_A0A0P5JB67 Arginase n=5 Tax=Pancrustacea TaxID=197562 RepID=A0A0P5JB67_9CRUS  ali  31  9...............................................................................................................................ENGLNIF-GCDVHDFGDVDYQPSQEDNVRNMKNVIAFNEKLSQKVSKIINEGRMCLTLGGDHSIGVGTVHGHLKAQPETSLLWVDAHADINTPATSNSGNAHGMPLSFHIKELTEYQPELPGFWHSPMISARNIAFIGLRDVEPYERLIIEKLGMCALSMEEVHGIGIKEAVKYALSRIDPRNTRHLHVSFDIDALDPLEAPSTGTPVRGGLTLREGTELLRSVHRTGRLSAVDIVEVNPLLGSAN.................................. 258
122 3.000e-86UniRef50_A0A0T8FRU1 Formimidoylglutamase n=136 Tax=Bacteria TaxID=2 RepID=A0A0T8FRU1_STREE  ali  21  36..........................................................................................MPFDTAASFRVGARFAPQAIRQASMTLFPY-----HPVHDVYPFDDTNAIDIGDVPVIP---------HNIHRSYELMEEAVGALMDRGIVPIGIGGDHSVTLASLRAAAKRYGPVAMIHFDSHTDTWDTY-YDEKYWHGSPFIRA--------------YEEGLVDPKKVFQIGIRGTLPGDVQESKDLGYHVVTAGELERQGFSVILEQMKTAI---GETPCFLTFDIDFVDPSCAPGTGTLEVGGFSSRETLQMIRSLT-GFNYVGFDLVEVLPSYDPTQITSLLAATIIHDFASLVA................ 305
123 4.000e-86UniRef50_A0A0G3XWG0 Guanidinobutyrase n=83 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0G3XWG0_9BACI  ali  21  32......................................................................................AILGMPFDTAASFRVGARFAPQAIRQASMTLFPY-----HPIHKVYPFEDTNGIDIGDVSVIP---------NNIHKSYELMENAVFDLMKKGIVPIGLGGDHSVTLASLRAAAKVYGPVALIHFDSHTDTWDTY-YGEKYWHGSPFVRAHEEG--------------LLIPDKVFQIGIRGTLPGDIEASLKLGYNVITTQELAKRSLNDIAQEMKETI---GETPCFLSFDIDFVDPSCAPGTGTLEVGGFSSRETLDIVRSLTD-FNYIGFDIVEVLPAYDPAQITALLAATLVHEFASIVA................ 305
124 4.000e-86UniRef50_A0A1S7HGC0 Arginase n=4 Tax=Zygosaccharomyces TaxID=4953 RepID=A0A1S7HGC0_9SACH  ali  27  1........................................................................MESPHYDYYPQRKLALVLAPFSGGQGKSGVEKGPEYMLRQG---LAHEIQELGWNVTKHEPLKTLPESD-------EVQCGKVKNANLVGEATERIYRTNLEALNQDSFPLTLGGDHSIAMGTVSAVLEKHPDAGLIWIDAHADINTLQGTESGNLHGCPVSFLLGLN--KEAPGKLSWVPNKLHPSKIVYIGLRDLDRPEKRIIKELGIKAFSMYHVDRYGINQVIEMALQHL---GNGPVMCSYDVDAIDPQYVPATGTPVRGGLTLREALFLVERLAETGKLVALDVVEVNPQLATDDV-----------HVVDTINAGCALARCALGETLL 309
125 4.000e-86UniRef50_A0A2H9Q9M0 Agmatinase n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A2H9Q9M0_9ARCH  ali  19  1...............................................................MILHVRSYFTYLGLETDFKKSKYVILPVPYDGTASYRSGAREGPFEIINASRNLETYDSEFGDVSNLIYTLPELQ-----------------PNLNSVEEMMLRIEETALDQLTQGKYLITLGGEHSITYGVLRAFRKCYPKLSVLHIDAHADLRED-------YEGSRLNHACVMKRSHARELYP----------DTVSVGVRSVCEEEAKCISSEKLDVYPMEDIESR---------FDEIVSKLGKNVYLTFDIDALDPSIMPATGTPEPGGLLWYQALRLLRKVFEKKNVVGFDLMELCP----------------IPGMHAPNFTAAKLLYKMIGY... 283
126 5.000e-86UniRef50_A0A268K8G3 Agmatinase n=7 Tax=Bacillus TaxID=55087 RepID=A0A268K8G3_9BACI  ali  20  32......................................................................................AIVGLPFDTAASFRVGARFAPQAIRQASMTLFPY-----HPIHKVYPFDACNAIDIGDVSVIP---------HNIHRSYEVMEKAVMELMEQGIIPIGLGGDHSVTLANLRAAAKIHGPVALIHFDSHTDTWDTY-YEEKYWHGSPFIRA--------------YEENLLIPDKVFQVGIRGTLPGDIDSSSDLGYHVITTPELKDRGFENVVKEMKEKI---GDTPCFLSFDIDFVDPSCAPGTGTLEVGGLNSFETLQIIRSLTD-FNFIGFDLVEVLPPYDPTQITSLLAATIIHDFASLVA................ 305
127 6.000e-86UniRef50_D8ITV1 Arginase n=220 Tax=root TaxID=1 RepID=D8ITV1_HERSS  ali  24  2...................................................................................NRIRMMGAPTDVGASRRG-ASMAPAALRVAELQ-------RGLQQHGLDVIDGGDLA--GPANPQQPPVQGLRHLEQVVQWNQTVHEAVAQCLADGELPLLMGGDHALAVGSIAAVAAHCKELRVLWLDAHADANTSQSTPTGNIHGMPVACLLGVGPAALTAI--GGQTPALQPQQICQVGIRSVDREEKRHLRELGVRVFDMRHIDEYGMRQTMEEALAGVGPQT--HLHVSFDVDFLDAALAPGVGTAVPGGPTYREAQLCMEMIADTGALASLDVMELNPACDVRNQT---------------AELVVDLVESLFGKSTL 300
128 6.000e-86UniRef50_I2K389 Arginase family protein n=20 Tax=saccharomyceta TaxID=716545 RepID=I2K389_DEKBR  ali  20  100..............................QDDYQVP-DKDDLRDIN-GSSVLYRGGEFGGLVSFAHLPYANCYDPAAFDDEKFDIAVVGAPFDTGTSYRPGTRFGPTGIRMGSRRLAP----AYSVYSGFNPYSWAKIVDCGDPPVT--PLDNRIALDQIYRAERAIRKTTGKSKQKAPKVFTLGGDHTITLPAVKAAYEKYGKISVIHFDSHLDTWNPYYFGGNITSYQAMNHGT--------YLHWAHEKGYXS-DNCIHAAIRGPYPGDVQHDIDCGFDRILARDIDKIGADGIIKKIKERIGST-DAPVYITVDVDSMDPAFTPATGTVEPGGWSSRELLTVLDGL-EGLNVVGGDVVEVSPPYDSAEITSLAAAQVADSIISLMV................ 446
129 8.000e-86UniRef50_A0A0M9VQ94 Agmatinase n=1 Tax=Malassezia pachydermatis TaxID=77020 RepID=A0A0M9VQ94_9BASI  ali  16  20.................................................DPVNQWDVPDFYFSGVSTFAHLPHEKCLVQEHTDFDVAVLGVPLDTAVSYRPGARFGPRAIRAGSARQTVF--RSFNPALGVNPYSKTKFLDCGDIPVT--PFDNELAFQQIEDAYDDLLHRFAKDKKQHPRMAVMGGDHSIALPILRSLNKVYGPVSVLHFDSHLDTWAPNQYGSGYTHGTMLYHASQEGLVSNT---------------SMHVGLRGLDFEDYRRDASLGFTYLETWEVDQLGLDGTVAAIRERL---GDSPVYLSIDIDVLDPSIAPGTGTPVSGGLTSRELRSIIRMLS-GINLVGCEVVEVSPPYDTNGVTALAAAELLYELMSVMA................ 375
130 9.000e-86UniRef50_A0A0J6VZ56 Agmatinase n=98 Tax=root TaxID=1 RepID=A0A0J6VZ56_9MYCO  ali  16  30.................................................................................WKPDVAIVGAPFDIATTNRPGARFGPRAIRA-----TAYEPGTYHMDLGLEIFDWLEVVDFGDAYCPHG---------QTEVSHANIKERVHAIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTAD-EIEGNLASHGTPMRRLIE--------------SGAVPGSHFVQVGLRGYWPPQFEWMQEQKMTWHTMQEIWERGFKAVMADAVGEALAKADK-LYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEHDVAGVDVVEVAPAYDHAELTVNAAHRVVFEALAGMA................ 313
131 1.000e-85UniRef50_A0A1G6MW86 Agmatinase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1G6MW86_9BACL  ali  17  12...............................................................PRYTGIRTFMKLGLDLKMDGSDVAVIGLPFDTGASFRAGARFGPAAIREMSVLLRPA-----HSFHKINPFEHVRCVDYGDLPLLPGY---------MEDSFDIIRDTYRRLAREKVIPVGLGGDHSVTLAELRGLADVYGPLSLVHFDAHGDTWDEY-WGKKYTHGTPFRRALEE--------------EIIDPHHSVQIGLRGYHPDDMDEAAELGFEVIAADELHTLHPTDLRRRIENRV---GDRNAFLTFDIDFFDPAYAPGTGTPEVGGFTSHQGLTFVRHLP-LLNYVGFDLVEVLPAHDHSQNTALLGAAVVYEFLALIA................ 308
132 1.000e-85UniRef50_A0A076K4V5 Agmatinase SpeB n=32 Tax=cellular organisms TaxID=131567 RepID=A0A076K4V5_9RHOB  ali  16  26.............................................AKTKDMRMPNQPISGNDLARFAGPQTFMRLPEAQGPAGLDVVIMGIPMDIGTSWRSGTRFGPKQIRQESAMIRPYNL-----QTGAAPFDSLQVADMGDV---------AINTFSLAESLRIIESAYDGLHDYPVVPATLGGDHSLTLPILRSIAKKHGPVALVHVDAHADVND-EMFGERETHGTVFRRA--------------YEEGLLVPDLVYQIGLRGYTAEDFSEAAGWGFNMITAPEIWHKSLTPLGQEIRQAI---GDHPCYLTYDIDSLDPAYAPGTGTPEIGGLTTPQAMELIRAL-RGLNIVGFDMVEVSPMYDTSGNTALTAANLMFEILSILPGVAYR........... 345
133 2.000e-85UniRef50_U4LG95 Similar to Putative agmatinase 2 acc. no. O42887 n=2 Tax=Pezizomycotina TaxID=147538 RepID=U4LG95_PYROM  ali  15  46.....................................................NWWNDIVPYGGINTFAHLPHVFCLSQPSETFDIALIGAPFDTATSYRPGARFGPRALRAGSQRQIPAA--SYNALTGVNPYSWAKITDCGDIPLTSFSSELALA-----QMTSAFEEIMTHKTPSGGSPVTLGGDHSIILGALRAVNKIHGQVAVLHFDAHLDTWDP-----RFYVGTPFTHGT--------MLNLAGREGLISNNSNVHAGLRTVGMGDYRDDTEQGWLRIGSEDIDDLGAKGVVEKIVQRLK---GKKVYLSFDIDTLDPAVAPGTGTPEVGGWTMREVKRILRGIAEDVELVGMDIVEVAPAYDNQGITALAGAQVVFEVLSGYVKKG-ELAGK....... 376
134 2.000e-85UniRef50_A0A1G7QV34 Agmatinase n=1 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7QV34_9DELT  ali  18  8............................................................ESPRFCGIRTFMRQPAAAAGAAPADVSIIGVPFDSGVSYRPGTRFGPAAVREASTLLKPYSPELDVDVT-----EAFSIADHGDIDTIPGY---------MEESFTAITAGLLPFFRANTLPVILGGDHSISLANLRAVKEAQGPVALLHFDAHSDT-LPSYYGKPYNHGTPF--------------YWAISEGLILPERSVQIGIRGYSRKALDWPRQQGLRIIMGHEAHALGLEAVIREALARV---GDAPVFLSFDVDFLDAAYAPGTGTPEVEGFTTYEAMTLVRGICSHCRTIGMDLVEVLPDKDAAGITALAGASVIFAFL.................... 304
135 2.000e-85UniRef50_K5V0H8 Uncharacterized protein n=25 Tax=Agaricomycotina TaxID=5302 RepID=K5V0H8_PHACS  ali  19  92...................................................................................YDVAVLGAPFDTATSYRPGARFGPNGIRQGSRRIR---IEGINVPMKLRISDHLDVVDCGDVPMV--FVDNKVALRQLEIANSALASGAKSIAKDGKFVLTLGGDHTITLPLLRGVAEVYGPVSVIHFDSHLDTWKPRTWDGPPDEEIPVSHGS--------YFYYAYQEGLMAANQSIHVGIRNHGWEDEENDAEVGFQISYAEDIEEVGYQGIVDRIKEVV---GENPVYITLDIDVLDPSFAPATGTPEIGGFTTREIKKILHGLSD-LKIVGADIVEVAPGYDTDEITQIAAANIGWEMLALMAKT.............. 408
136 2.000e-85UniRef50_D5DRS1 Agmatinase n=130 Tax=cellular organisms TaxID=131567 RepID=D5DRS1_BACMQ  ali  15  4.....................................................YQPKNSFESPRFCGPRTFMRLPYVEQVNSEMDFIVTGIPFDSGQSFRTGARFGPEAIRDFSILLRPYNPE-----QKINIFDYISGVDYGDLSVVPGY---------ILETYKKIEEGLTPVVNEGIIPISLGGDHSMTLGELRAIAKKHGPVALLQFDAHSDTWDSY-FEQKYNHGTVFRRAIEEG--------------LIDVSRSIQIGMRGYGIEDLEDAKNLGLALYATNEYKKLGVERMLDIIHERV---GEGPVFLSFDIDFLDPVYAPGTGTPEVSGASIDDALQFVRGLT-NIDFVGFDLVEVLPAYDHGQITAAAAANIVYEFITLIA................ 310
137 2.000e-85UniRef50_Q81JT1 Agmatinase n=646 Tax=cellular organisms TaxID=131567 RepID=SPEB_BACAN  ali  23  16.............................................................................HPSFEESEVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSPYLDRE------LEEVKYFDAGDIPLP---------FGNAQRSLDMIEEYVSKLLDAGKFPLGLGGEHLVSWPIFKAMAKKYPDLAIIHMDAHTDLR-------ESYEGEPLSHSTPIRKVCD----------LIGPENVYSFGIRSGMKEEFEWAKEVGMNLYKFD---------VLEPLKEVLPKLEGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKELLDSIVAIANSNNVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK............... 290
138 2.000e-85UniRef50_A0A1Y5SQ85 Guanidinobutyrase n=41 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5SQ85_9RHOB  ali  18  15...........................................................PRFAGVPTFMRLPYVPHGHERYSDVQIGLIGVPWDSGTTNRPGPRHGPRQLRDASTMI-----RAQHPTSGMRPYETVNCADLGDVGP---------NPADILDSMTRITAFYDQVLAAGITPLTAGGDHLTSLPVLRSLAKVHGAMGMIHFDSHTDLFHSYFGGTMYTHGTPFRRAVEEG--------------LLDPKRVVQIGLRGYDTEDRDFAAANGIRLILIEEFHDRGVADVMAEARDI---AGDGSTYISYDIDFVDPTYAPGTGTPEVGGPNSYQALQVVREL-EGVNIIGADMVEVSPPFDPSGGTAFLGMSIMFELLCVMA................ 316
139 2.000e-85UniRef50_F0G135 Agmatinase (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=F0G135_9BURK  ali  20  1...........................................................................................................................................ADIGDV---------ATNPYDLKDSVRRIEQAYDRIVANGCRPITLGGDHTIAWPILRALHRKYGKVAVVHVDAHADVNDT-MFGEKIAHGTPFRRAVEEG--------------LLHGDKVTQIGLRGYHADDFDWCREQGFTVVQAEECWNKSLAPLMAQVRERV---GDTPVYLSFDIDGLDPSFAPGTGTPEVGGLSVQQGLEIVRGM-KGLNIVGADLVEVSPPYDPAGTTALVGANLAFEMLCVM................. 225
140 2.000e-85UniRef50_A0A1Y2NJ92 Guanidinobutyrase n=132 Tax=root TaxID=1 RepID=A0A1Y2NJ92_STRPT  ali  18  57.....................................................................................VVILGAPFDGTTSHRPGTRFGPQAIRRTDYL--PHVPYRPHLGLGVDPFTELKIVDAGDVPTPPGET---------ERAHQLLERTVSEVVAAGAIPFTLGGDHSIAWPTMRGIAGRRGPFSVVHFDAHADIGDTSDFGAEYGHGTVMRRLLE--------------SGTVPGDRFTQIGLRGYWPGPRQWAAGLGVRSITMSELRSRGLDTCLDDVLDQI---GPGPLYLTIDIDVVDPGMAPATGTPEPGGLTSRELLDAVRTCAQRVDLVGAEIVELSPPYDPGEITAYLANRIVLEVLSGMA................ 339
141 2.000e-85UniRef50_Q6FP31 Arginase n=12 Tax=Saccharomycetales TaxID=4892 RepID=Q6FP31_CANGA  ali  28  1...........................................................................MTDYKYYKDRQLSLVLAPFSGGQGKLGVEKGPKYMLKHGLQKDLEELGWGTEIQSPLDEEEYKVK-----ENTQDQFGIIKRPQLVGEATELIYKSVTDVLSRDRFPVTLGGDHSIAIGTVSAALDKHPNAGLLWIDAHADINTLESSPSGNLHGCPVSFLLGLNKKHESLKSLDWVPGKLKPNKIAYIGLRDVDSGERKILKELGIKAFSMYHIDRYGINTVIEMALEAIKESENTPIICSYDVDSIDPLFVPATGTPVRGGLTLREGLFLAERLAETGNLISLDVVECNPDLAIQDI-----------HVSNTISAGCAIARCALGETLL 321
142 3.000e-85UniRef50_A0A1W6JYS4 Agmatinase n=1 Tax=Acidianus manzaensis TaxID=282676 RepID=A0A1W6JYS4_9CREN  ali  21  24..............................................................................CKEEDVRAVFVGVPFDDATTFRPGARFGPSGIRQGSRLLREY-----NQFLDTYPFEKLNMCDQGDINAIPGFLD---------DTMKIIENGIYEIISKNRVPFIAGGDHSITLPVLRAMRKKYGKVNLIHLDSHYDFWDTYWGNKKYTHGTWLRRALEEGLLNE----------------VVQAGIRTYSKDDLEDKKKLGIKSFTINEMKEKIEEII------SIINSLNGNTYISIDIDVVDPAFAPGTGTPEVGGLTSYEIINFIRKL--KTKIIGFDVVEVSPPYDVSELTSMLAANIIYEGASVL................. 299
143 3.000e-85UniRef50_A0A0F4Z477 Agmatinase n=31 Tax=Fungi TaxID=4751 RepID=A0A0F4Z477_TALEM  ali  18  81.................................................................HLPYVPCFSSLADDQIDRYDIAILGAPFDTATSYRPGARFGPHGIRDGSRRIRGYH--SWNVYTGQNPFEWAKIVDCGDAPLT--FFDNTVALKQLGKAHKIISGRQASNVSVSKVPLMLGGDHTTTLAALRSTIDHWGVVNVIHFDSHIDTWNPNRIGGGVSEYAAVNHGT--------FLHIAHEEGLISNDSSIHVGIRSSRRYDLANDAQCGFDIITARDIDDIGVKGIIKRIKERV---GDGKVYISVDIDVLDPAFAPATGTAEPGGWTTRELLSIIDGLS-GLKVVGADVVEVAPAYDNTGETTIAAAEVARSLLTLMV................ 397
144 4.000e-85UniRef50_A0A162II54 Arginase n=1 Tax=Ascosphaera apis ARSEF 7405 TaxID=392613 RepID=A0A162II54_9EURO  ali  34  84..................................................................................................................................................QNDTDVRGMRLPRSVSAFSQALSEQTYQLAKNGRLVLTLGGDHSIAMGSIRAIRERFPDLGVIWVDAHPDINTPETSDSGNVHGMPVAFLSGLVRESDELFGWIKPEHRINLQKLVYIGIRDADDGEKRIIKENGILTFTMHDVEELGIRAVVDMALKHIGSET--PIHLSFDVDAIDPVFVPGTGTPVPAGLTLREGQYICRNVHDTGNLVSMDVVEVNPAID--GITQKEK--------CQTLQSANSLIRAALGHKLL 362
145 4.000e-85UniRef50_A0A1W9HT52 Agmatinase n=1 Tax=Proteobacteria bacterium SG_bin7 TaxID=1827384 RepID=A0A1W9HT52_9PROT  ali  22  20.......................................................................FFRMPVADIDADYDVGIFGIPFDGAVSYRSGCRFGPSKIREVSSLGRGYHWG-----REINFFEKIKVADIGDSPTVPVDQKL---------CFERVEKFVADVLKNKKKFISVGGDHSTTLPILRQLKKKYKPLRLVHFDAHLDSY-PAAWGFEYHHGTFVRHAVEE--------------KLIDPKISHQIGIRGPLAGDLDFVKKTKINVHTVDDIRDD-----FKKVLKDLDKFGDEPTYISFDIDCLDPAYAPGTGTPVIGGLTTYETQKILRN-FKIKNLVGADIVEVSPPYDHADITALAAVDTMFEILSIYA................ 307
146 4.000e-85UniRef50_A0A1C5VFB2 Guanidinobutyrase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C5VFB2_9FIRM  ali  15  21.......................................................................FMRMENIQTTDDVDFVVVGIPFDTCATFRVGTRFGPAAIREMSAVVA----KPYNPILEVGIFDYCSGVDYGDVGSVPGY---------VEESFEVITEGMLPIFEKGVIPIAMGGDHSVTLPELRACAKVNGPVALIHFDAHFDTIDQY-FGKPYTHGTPFYHA--------------AKEGLVDTSKSIQVGIREYSIEDTKNSSDLGYDYIYAADCHKMTCEEIIKRIKDRV---GDAKAFLTFDIDFLDPSCAPGTGTPIPGGFTTAQALEIIRGL-KDLNIIGYDVVEVSQPYDPNGITAIAAAGLMQEFMSHIA................ 310
147 4.000e-85UniRef50_A0A2U9CQU4 Putative HEAT repeat-containing protein 1 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9CQU4_SCOMX  ali  26 2088...................................................................................................RPGVERGPELIRAAGLLLKLQQQGCAVKDYGNLELEE---------PVDDEPVGRAKHVRAVGGANQRLSEAVQRVKRDGHTCVMLGGDHSLAIGSIHGHAAAVGELSVVWVDAHADINTPLSSPTGNLHGQSMSFLLHELQAKVPVLPFSWIKPCVRARDLVYIGLRDVDPEEHHILKLLGVKVFSMSQVDQLGVARVMEETCDFLSDKVKKPIHLSYDIDAIDPSVAPATGTSVVGGLTYREGVYITEHLCQTGLLSAVDLVEVNPLRGRTERDVR-----------STVHTAVDLLLGCFGRR.. 2374
148 6.000e-85UniRef50_D7CX25 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D7CX25_TRURR  ali  19  38......................................................................................AIVGAPFDTGGTYRVGARFGPAGIRHESMLLRPYHPELRVDVT-----EQLSLVDYGDLPVTPGY---------LSESHAQLERGAAELVAAGVTPFFLGGDHSVSLPLLRAVAQRHGPVGLVHIDAHSDLW-EGYFGGKDTHGTPFRRALEEG--------------LLEPARSIQIGLRGYSAEDHALSQRLGFEMVTAPELHRVGVQEVARRVRAR---AGTGPLYLSFDIDALDPTFAPGTGTPEVGGLSSVQALAL-LRALAGLPFVAYDLVEVMPPYDVAGTTCLLAANLVYEMLALEA................ 311
149 6.000e-85UniRef50_A0A1X6ZLI4 Agmatinase n=1 Tax=Roseovarius albus TaxID=1247867 RepID=A0A1X6ZLI4_9RHOB  ali  22  43.....................................................................................IVAWGVPYDLSVTNRPSCRFGPRGIRAASTNVTWDGGPWF---WDFDPFEKLHMVDYGDCMFDPGF---------PMEIPEVIYQEAMSILQSDAFLLTMGGDHSVTYSVLKAQAERHGPISLIQIDAHSDTW--EESPKRFDHGSMFYHA--------------AQEGILAPETSVQAGLRTYNSS------THGFTTLTAEFVHEQGVAATVAKIKEVV---GDLPAYLTFDIDALDPAFAPGTGTPVCGGLSSWQAISLIRKLA-GVNLIGADMVEVSPPFDHAEITSLAGATLLLEMVCLIA................ 310
150 9.000e-85UniRef50_A0A059WWP7 Arginase n=27 Tax=Bacteria TaxID=2 RepID=A0A059WWP7_9BACT  ali  30  38....................................................................................................PGVDIGPAAIRVARLSQRIAQLGY-------------EVRDLGDMRIVAPPNESAKYLKEMTESCENLSVEVRDILRDGELPLIIGGDHSIAIGSIAGVAEREETLGLIWFDAHADMNTPETSPTGNIHGMPLSSLLGYGPPELT--HIAGFAPKLDPRLCAHIGARDIDLGERELIRKLGLRVITMREIDERGMSACIDEAIS-IASKASAGYAVTFDVDVMDPGDAPGSGTLVRGGLSYRESHLAMEKIAEAGGMLSLEVVEINTALDVNNRT---------------AELGVELILSALGKRIL 322
151 1.000e-84UniRef50_A0A059WYQ4 Arginase (Fragment) n=3 Tax=Bacteria TaxID=2 RepID=A0A059WYQ4_9BACT  ali  36  1...........................................................................................................................................................................VKNILANNELPIILGGDHSIALPTFSAIQSHFREVGLIWFDAHADMNTPETSPSGNLHGMPLAHILGFGLSQLVNLEGFA--PKLNPKYFAHIGARDLDNGEKKLIRELGINCWTMHEIDRYGMNYCIEKALEVVSQA-PSGFAVTFDVDALDPLDAPGSGTLVRGGISYREAHLALERIAETNKMKSFEIVEVNPMLDRDNRTS---------------ELAVELILSVLGKRIL 222
152 1.000e-84UniRef50_A0A0C2JA98 Uncharacterized protein n=1 Tax=Sporothrix brasiliensis 5110 TaxID=1398154 RepID=A0A0C2JA98_9PEZI  ali  18  13.....................................LAAAVNVGPNYEHHIEDLDVDLPFSQPVTFAHLEWQRCLAASHDKPLDIALLGFPYDTSTSYRPGARFGPRGIRAGSAR--EKKGRSYNTVWGVDPYEGLEIIDCGDIPIT--PFDAAHAFKQMEQGYRQYHPTSDATAWKHPRIISLGGDHSIVLPILRSLKTVYGPISVIHLDSHLDTWDPYEGYTGITHGTFFWHAS--------------REGCIAKGTSVHGGLRTFSPKDYEIDRDVGFTLIEAHEIDEIGMEGIVARTRAAV---GDTPTYLSIDIDVLDPSIAPATGTPESGGWTTRELKRFIKGL-EGVNLVGADVVEVSPPYDVAEVTSIAAADLIVDILAAMVK............... 359
153 1.000e-84UniRef50_A0A0U3B3E2 Uncharacterized protein n=3 Tax=Lacimicrobium TaxID=1751872 RepID=A0A0U3B3E2_9ALTE  ali  18  6..............................................................YSLYQGTHKYVFARQQQMDAQTQVVIAGIPFDLATSGRPGARFGPAAIRQASVNL---GWEKKRHPWPFALRDALNIADIGDLAFSHGDARGA---------MEAVREHVSQVVRSGAIPFMLGGDHLITLPALQAVHAKHGPVAVVHFDAHSD---DYAGGSEFDHGSVFYHA--------------RKQGLLQDEKVIQIGIRT----------EQGFKVLCADELWHSKAEEVVARIKNTV---GDAPVYLTFDIDCLDPVYAPGTGTPVSGGLSGPFVLELLRKLH-GLNWVGMDLVEVSPPYDQSQITSLLAATMMTDMLCLLA................ 294
154 1.000e-84UniRef50_A0A212K565 Guanidinobutyrase n=44 Tax=Bacteria TaxID=2 RepID=A0A212K565_9DELT  ali  20  8............................................................QSPRFCGIRTFMRQPAATGETPQADVSIIGVPFDSGVSYRPGTRFGPAAIREASTLLKPYSPELDVDVN-----ESFTIADHGDIDTIPGY---------MEDSFAAITSSLKPFFASKTLPVILGGDHSISLANLRAVHAAHGPVALLHFDAHSDT-IPSYYGKPYNHGTPF--------------YWALKEGLILPQHSTQIGIRGYSRNALDWPRQQGLRIIMGHEAHAMGLEAVIREALARI---GDAPVFLSFDIDFLDAAYAPGTGTPEVEGFTTYEAMSLVRGICSKRRAVGMDLVEVLPDKDVAGITALAGASVI........................ 300
155 2.000e-84UniRef50_A0A2C9T1L7 Agmatinase n=14 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A2C9T1L7_9MYCO  ali  16  2................................SAGHDHKPNRELPPGMAEQLDLPYAGVASFGNRP-----FLTEPEQLDSWQPDVAIVGAPFDVATTNRPGARFGPRAIRS-----TAYEPGTYHMDLGLEIFDWLEVVDFGDAWCPHGLT---------EQSHANIRERVHTIASRGIVPVILGGDHSITWPAATAVADVYGNVGIVHFDAHADTADI-IDGNLASHGTPMRRLIE--------------SGAVPGTHFVQVGLRGYWPPQFEWMQEQGMVWHTMQEIWDLGFKEVMRRAVGEALAKADK-LYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRQLCYEHDVAGVDVVEVAPAYDHAELTVNAAHRVVFEAL.................... 325
156 2.000e-84UniRef50_A0A168NCE5 Uncharacterized protein n=11 Tax=Mucorales TaxID=4827 RepID=A0A168NCE5_ABSGL  ali  19  38......................................GPSDIPVNFDRPVLDKDVYMPSFAGISTFAHLPYLQCFEEGIVEDYDIAVIGAPYDIGVTFRTGARFGPSAIREGSKRIKGFNYEIKVNPFK----SWAKLVDCGDIPFE--PFDAEHAMGQIEAHAKYVLQRPDQQVATPPRLVTLGGDHTILLPVLRAMHAAYKPITVIHFDSHLDTWAPEIYNSRFNHGNPLYHA--------------AKEGLTTNGTSMHVGIRSYDEEDIQRDEALGFRMVKANDIFTMGVEGMVERIKEVIGPKEDTLLYLSIDIDVIDPSMAPATGTPESGGLLTRELKYILRGL-NGYDIVGMDVVEVAPAYDTAQLTSFLAADLIYEIMSMMVK............... 382
157 2.000e-84UniRef50_A0A1I1HD76 Guanidinopropionase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I1HD76_9RHOB  ali  21  46..........................................................................................VPWDSGTTNRPGPRHGPRQLRDMSTMIR-----AQNGATGVRPFERINCADLGDVSP---------NPADIQDSMARITTFYDAVREAGVLPLTAGGDHLTSLPVLRALSKP-APLGMIHFDSHTDLFKDYFGGTQYTHGTPFRRAVEEG--------------LLEPKRVVQIGIRGYDDEDRDFADAVGIRVIPIEEFHARGPEDVMTEAKEIV---GTSPTYISYDIDFVDPAFAPGTGTPEVGGPNSHQAL-LVARLLEGVNIAGADLVEVSPPFDPSGGTAFLAVSIMFEILCNMA................ 315
158 2.000e-84UniRef50_F4LMU9 Arginase n=14 Tax=Treponema TaxID=157 RepID=F4LMU9_TREBD  ali  30  15..................................................................................................NRHGSDMGPSAIRLAGLKERLSH----LDHEAVTSFSPIAI---NPQEYEDPGRADAKYLKQIVSACNLLAAETEKAVLDGKFPLVLGGDHSIALGTIAGLSGAYRKLGVLYVDAHGDFNTSETSPSGNIHGMCLSASCGFGIPELTELYRPGV--KVLPENVCYVGLRDIDSEEKKLMKRAGVTAFTMSDIDRLGFSAILQKVTSFFKSRVDV-VHVSFDMDVIDPMFAPGVGIPLPGGLNYREALLLMEEMAATGMVGSAEIVEVNPVLDVRSQT---------------ARMAVELVARLLGDTI. 301
159 2.000e-84UniRef50_A0A2A5DEA7 Arginase n=25 Tax=Bacteria TaxID=2 RepID=A0A2A5DEA7_9BACT  ali  27  10......................................................................................RIMGVPMDLGASRRG-TDLGPSALRVAKVGAALRDLGF-------------EVQREQDIPVPAMETDDARFLAEILQVCEELAQQVKLALDEGTTPLVFGGDHSIAMGTVAGVAQHFEEIGLVWFDAHGDMNTPASSPSGNIHGMPLAHLIGLDGTNDALASIGGRKGIIKPENVALVGIRDIDRKEAALVRESGVHTWTMRDIDEKGMPRVVAEILDVVNVD-TAGFHLSFDVDGLDPEVVAGVGTPVPGGVNFREAHLMLETMADTGRMTSMEIVELNPLLD---------------LCNQGAENMRHLICSAFGQSIL 310
160 2.000e-84UniRef50_A0A2V9RIE8 Agmatinase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9RIE8_9BACT  ali  19  23..............................................................YPRFSGIPTFMRLPHVTDPSELDVALIGIPFDGGTTYRPGPRFGPRNVRVQSAMIRPW-----NPVLKVDPFEKLRVGDFGDLSI---------NPLSIEDTYRRITEQLGEVLRADARTICVGGDHSILLPILRAIHRHFGPVAFIQFDAHGDTWGGY-FGSPHSHGTPVKYAVEEG--------------LLEPGCALQVGLRGYSEDDFEFARKHGIAMITSEEFHEGGI----ELMKRHLRKHRNKNVYVTLDIDVVDPAFAPGTGTPQVGGFSSAQILSAVRALH-GLHIVGCDLVEVSPPYDNGEITSLLAANLIYELLCL.................. 317
161 2.000e-84UniRef50_UPI000C7A8967 agmatinase n=1 Tax=Nonomuraea indica TaxID=1581193 RepID=UPI000C7A8967  ali  18  6...................................................................FHDIPPSSDGRFQGRPSDVVVLGVPIDSGTGGRPGARFGPAAIREASALIA---GNLYHVGLETEVFEHLRIVDVGDVPVTPG---------QHERNLDAAEKWARELMSVTDRVVVLGGDHSVLLPVLRAVADKHGPVSFVHWDAHADTWD---GGPEHL----LTHATAVRRVIEEGLT----------NQVFQIGLRGYSRETFAWAGEHGVEHWTMMDVDEAGLTDIVQQVIASV----TGKVYISIDIDVLDPSYAPGTGTPEPGGLTSRELLAGIRDLARNTDVVGLDVVEVAPPYDHADVTALVANRCVLEFLSATAQ............... 299
162 3.000e-84UniRef50_A9GKY1 Agmatinase n=11 Tax=Myxococcales TaxID=29 RepID=A9GKY1_SORC5  ali  21  43..........................................................................................VPWDGSVTYRPGARFAPYELRRVSALVQSYHPG-----HGVDVFRAIHVLDGGNVPFPPFHADSVRELIQ---------ASVDEVLAAGAVPFVVGGDHSIALPVLRALSRRHGPVTVVHVDAHLDTSTSEVWGEPFHHGTPFRNAIEEG--------------LIGRSALHQIGIRATWPEEGAFAAHAGATLYGMDRIDRDGASAIAAA---IRAAAGESPVYVSFDIDGVDPAYAPGTGTPVPGGLTSREAIQLLRGLA-GINLVGMDLVEVCPALDHADITLHLGAHLLFEGLALLA................ 313
163 3.000e-84UniRef50_A0A1Z5HDB5 Guanidinopropionase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z5HDB5_9GAMM  ali  21  48..........................................................................................VPWDGGTTYRSGARLAPRQVRDASTFMRNM-----HNTLKIKPYELCNCADLGDANI---------NAVNLLESLQWVEDFYHQVLSKDIVPLSVGGDHLVSLPILRALAK-NQPVGMVHFDAHTDMFSGFSGNSSFSHGTPFYHAI--------------NEGLLDPKRIVQIGIRGYTEEDRLWGLEKGVRIIDMEECTDLGTEGILIEIKKVI---GDDETYLSFDIDCLDPAFASGTGTPEIGGFTSIEAQHLIRGLH-GSNLIGADLVEISPPYDQSSNTALVGATLLFEILCLLA................ 317
164 3.000e-84UniRef50_A0A0H3J433 Arginase n=86 Tax=Bacteria TaxID=2 RepID=A0A0H3J433_CLOPA  ali  27  1....................................................................................MIVNMIGVPLFYGSDKKGVDCAPNKLRE-------------NNIIDVIHNDNHEIYDCGNIFVPKSYNSRMKYLKPIIDVNTNLAHEVYSSFTSGSFPFIIGGDHSLGLGSISGASKYYKNLAVIWVDAHGDINTDETSISGNVHGMPLAAAMGIGPQSLTDLYFKGI--KVKYKNVFIVGARSLDSGEFSLVQEKGLNVYSMENIKNMGIESILKEIHHKLMENGIEAVHLSFDIDCLDPSIVPGTGTPVTDGMSVEDAKFLLKYLMNTKLIKSMDMVELNTLLDRNDSTTKLVIDLV........................ 291
165 3.000e-84UniRef50_A0A0N0NHT7 Arginase n=1 Tax=Phialophora attae TaxID=1664694 RepID=A0A0N0NHT7_9EURO  ali  31 1002...................................................................................................................................................EDAPHRGMKNPRSVSAVTKELAGKVYEQAKEGRMVVTLGGDHSIAVGTVAGTSKAGKEVAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLAREDREDVFGFGEKPALSVSKLVYIGLRDVDRGEKRILRENGIKAFSMHDVDRHGIGRVVEMALAHI--GTDTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDYIAECVHETGQLIAMDLVEVNPSLEVAG-------------ASETVRAGVSLVRCALGDTLL 1256
166 3.000e-84UniRef50_B6HAK8 Pc16g13170 protein n=3 Tax=leotiomyceta TaxID=716546 RepID=B6HAK8_PENRW  ali  19  23...............................................................................QIPYSHFYQTGAPFDTGTSYRPGARFGPSGIRQGSRRL---NLGGYNVPLQANPFTDMRILDCGDVPVTS--YDNAWAIRQIEEGHNSILMR-KPYLDANKRVITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDSWKPKVFGGSPSEVAAINHGT--------YFYHAAMEGLLRNDTNIHAGIRTTLPSDYDNDGYCGFEIVEAREIDVIGTDGIIKKIRDRV--GTDNPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGL-DGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVK............... 333
167 3.000e-84UniRef50_A0A174HHN8 Agmatinase n=37 Tax=Bacteria TaxID=2 RepID=A0A174HHN8_9FIRM  ali  20  11..................................................................................................................................VNIMDGLKGGDIGDFNVTPGY---------IHPTYQAIEEGVAGILKENACPIVLGGDHSITLAELRAAAKKYGPVALVHFDSHSDLCD-EVFGQKYNHGTPFRRALEEN--------------LIDASHSIQVGMRGYDPDEHKMAAELGMKLIPAHKVREMGLETLVKTILERV---GDMPCFLTFDIDFVDPAYAPGTGTPEVGGFTSLEALELVRNI-KDLNFVGFDLVEVLPAYDHGEITAYLAANIVFEYLSILA................ 245
168 4.000e-84UniRef50_A0A1S8BAH6 Putative agmatinase 1 n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A1S8BAH6_9PEZI  ali  19  19.....................IVFPPLSGFQS-DQVPVQPSAFNAAGSFKDGGISGAKFAGLTTFANLPYVHCLAADEADVEKFDIAFLGAPFDTGVTARPGARYGPGGIRIGSKRMVPDVWNIYTGESAY--HSWAKIVDCGDAPLT--FLDNTVALKQLDTAHKILAGRTTNSSDTAPRIITLGGDHTTTLSALRSTAEQWGPVSVIHFDSHLDTWDPKVLVN---HGTFLHIAHEEGLIRNTSIHAGIRAPVMRPH------------GDVRNDIRCGFDMVKAREIDRIGIDGVIERLKQRV---GDSKVYISVDIDVLDPAFAPATGTAEPGGWSSRELLSILDGLS-GLSVIGADIVEVSPVWDNVGETTVLAAQVADSLLTLMVQTPVK........... 372
169 4.000e-84UniRef50_Q2U8I2 Uncharacterized protein n=13 Tax=Eukaryota TaxID=2759 RepID=Q2U8I2_ASPOR  ali  20  20.....................IVFPPIAAIQGSGQVPLGEDDTVDI-------VTGSHFSGLTTFGHLPYVNCLVDDQAHSTPYDIAILGAPFDTGVTARPGARFGPVGIRLGSRRLQGWNIY-----TGVNVFEWAKLVDCGDAPLT--RLDNTVALKQLDLAHKVISSRPTNSTDRGRTPLTLGGDHTTTLSALRSTYDKWGPVSVIHFDSHLDTWDPKVLGSGVNHGTFLHIAHEEGLIRNTSLHVGIRAPVIRPK------------GDIRNDIRCGFEIIKARDLDRVGINGIVDQIKARV---GDSKVYISVDIDVLDPAYAPATGTAEPGGFTTRELLSILDALH-GLPVIGADVVEVAPIYD..................................... 349
170 4.000e-84UniRef50_O42887 Putative agmatinase 2 n=13 Tax=Dikarya TaxID=451864 RepID=SPEB2_SCHPO  ali  17  45.........................................AYEDDSLDDDTWRSKRWEFDYQYISTFAHLPHVRCLVEQSEDFDIAIIGVPFDTAVSHRPGARFGPKGIRSASSRQMA--IRGFNPSLNVNPYEWAKILDCGDIPVSS--YDNQLAVRQMTEGYIDLLSRTAGLAKDGIFLITLGGDHSIGLASLRALGHFYGNVSVIHFDSHLDTWNPKRYYPSYWHSDR------ADFTHGTMFWMASKEGLINNGTSIHAGLRGTDYYDYEEDNRVGFTFIEAQEIDEIGVNGIVERIKQVV---GDTLVYLSIDIDVVDPGLAPGTGTPETGGWTTREMKSILRKLDGHLNLVGAEVVEVSPPYDRAESTSLAASDFIFEILSSMVK............... 405
171 5.000e-84UniRef50_A0A2D9LMI3 Agmatinase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D9LMI3_9CHLR  ali  17  45.....................................................................................VAIMGAPFDMGVVNRPGARFGPRAIRQAGYFGAPND-DLYHMGLQVYPTDVLSVADFGDANCPPS---------SLERSHEAIQAKVSQCLKAGALPIVVGGDHSITLPSATAVANHYGPVGIVHFDAHADTAPATYGGVLASHSSPMRRLIE--------------DGIVQGKNFVQVGLRGYWPPHFDWMREQGMRWHQMSEIETRGFDPVLDDAISE-ALDGPELIYLSVDIDVLDPAFAPATGTPEPGGLTSVELLRAVRTIVGSVETVAADVVEVAPDYGPANITAEAALRVILEILSSLA................ 330
172 6.000e-84UniRef50_H2C483 Agmatinase n=2 Tax=Metallosphaera TaxID=41980 RepID=H2C483_9CREN  ali  21  36..............................................................................CGEERPKAVFIGIPFDDATTYRPGARFGPMGVRDGSRLLRPY-----NPFQGVYPFDELNACDAGDVDTVPGH---------IEDTMKKVEEGLLNIL---VFPFIVGGDHSITLPVLRAVHKVHGRVNLIHMDSHYDFWDSH-WGKKYDHGTWLRRALEEGLLEE----------------VVQIGIRGFSHEDVEDSKRLGITSFSIREVKKN-WGEVMDRVKA-----LRGPTYVSFDIDVVDPAFAPGTGTPEVGGLTSFEALELVRGLP--VELVGFDVVEVSPPYDVSELTTMLASNLIYEAMSLKARL.............. 312
173 6.000e-84UniRef50_A0A285EI99 Agmatinase n=2 Tax=Geodermatophilus sabuli TaxID=1564158 RepID=A0A285EI99_9ACTN  ali  19  1.......................................................................................MLGAPFDWGASYRPGARFGPRAIREADYL--PPDGRRPHLSTGIDPLFELPVVDAGDIPVVGGH---------IEPSLELIESWVHTVAAAGAIPIVLGGDHTITYPDATGVARHHGNVALIHFDAHADT-APHQWGHLYGHGTPMRRLIE--------------SGAVPGHRFVQIGLRGYWPEVVAWMEEQRMRTFFMDEINERGLDPVVDEAVDHALTGGAEAVFLSLDIDVVDPGMAPGTGTPEPGGILAREFLPTVRRLARELNVVGADIVEVAPHYDPMNITAALANRVVLEMTTGMVE............... 284
174 6.000e-84UniRef50_C3M9P2 Arginase n=416 Tax=root TaxID=1 RepID=C3M9P2_SINFN  ali  25  1...................................................................................MKSITLIGAPIEEGSGRRGAAMGPTALRIAG--IDTVLSELGHTVHDEGDLRPLPARDL-------PNHAGANNLQMVAAFARALNDTVHDTARKGHVPIILGGDHALSMGSVSGMARVGRPLFVLWLDAHADFNSPSTSPSGNMHGMPVAFFCGE---AEFTPILAADRPLVDPKRVYQVGIRSVDSREREEIAEHGVNVYDMRAVDEIGMAHIMRQILDDVRAA-DGLLHVSLDVDFMDPEFAPGVGTTVPGGATFREAHLIMEMLCDSGLVSSLDVVELNPFLDDRGKS---------------ARILVELTASLFGRRIL 300
175 7.000e-84UniRef50_A0A124BXJ8 Similar to An14g05950 n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A124BXJ8_ASPNG  ali  18  18................................HGGHDQTPL----AGPHQRLWYNTQADSVFSGISTFGRLPYFPCLSSEAERYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLY--GGYNVPLQANPFSDMRILDCGDIPVTS--YDNAWAIQQIEEGHRKPFTDAEKLSKAGKRIITLGGDHTITLPLLRSINRAYGPVTVIHFDSHLDSWKPKVFGGSPSQVAAINHGT--------YFYHAAMEGLLKNDTNIHAGIRTTLPSDYENDGYCGFEIVEAREIDTIGTDGIIKKIRERV--GTENPVYLSIDIDTLDPAYAPATGTPETGGWSTRELRTIIRGL-DGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVK............... 379
176 8.000e-84UniRef50_A0A163HN12 Flavin adenine dinucleotide binding n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163HN12_DIDRA  ali  31  37.........................................................................................................APMALIEAGLIKELE------EDLDLKVTFDGQVHNYAELPAEDPDYRGMKRPKFVSAVTKEVSEQVYNYAKTGKLVLTLGGDHSIAMGTVSGTARAGREIAVIWVDAHADINTPETSDSGNIHGMPVAFLTGLAETREDVFGWLKAHHMLSTKKLVYIGLRDIDRGEKKILREHGIKAFSMHDVDRHGIGKVMDMALAWIGS--DTPIHLSFDIDALDPMWAPSTGTAVRGGLTLREGDFIAECVAETGSLIALDLVEVNPSLDELAISAL.............................. 307
177 9.000e-84UniRef50_A0A2T7NAZ9 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NAZ9_POMCA  ali  17  19...........................................RYLGTSGPRWRRNYPLSNEMPRSGGIASMMRLPVQATTQGLDACFVGVPLDSGTSNRSGARLGPRHIRQESSLLR-----QANPMLGTIPFDSIQVADVGDV---------CMNIYDLPTAVKQIKAAFDKLIVNGCVPLTMGGDHTISYPILQAIKDKYGPVGLVHVDAHADVNDT-MLGAKIAHGTPFRRAFEYGS--------------LDGRRVIQIGLRGYDLDGYKWSTEQGFRVVPASDCWNKSLKPLMTEVRSMM---GSGPVYLSFDIDSLDPCFAPGTGTPEIAGLTIYQALEIIHG-CQGLNIVGADLVEVSPPYDVGSMTSLTAANLLFEMLCV.................. 334
178 9.000e-84UniRef50_A0A0F2SC64 Arginase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A0F2SC64_9FIRM  ali  32  4..................................................................................................NRRGVDMGPSAIRYGGLKKAITNLNIGYKDIGNI-----------DVPIPESYDDFVKNEEEIGYVNKSLASLVRKSLLEGNLPIILGGDHSIAVGSILGTQSVLENIGVLWIDAHGDFNTRETTLSGNLHGMSLAASAGFGALEMTGF-KPKDVNYVNPKKVVLIGARDIDNEEAILIKESGITVFTMSDIDEYGMKEVMVRALEIVAAD-TEGFHVSFDLDVMNPNEAPGVGTPVNGGLTFREAHLAAEMISNSKKLRSLEVVELNPILDHMNQTG---------------KLAVSLICSMIGKRIL 288
179 1.000e-83UniRef50_A0A1E3QKG1 Uncharacterized protein n=8 Tax=saccharomyceta TaxID=716545 RepID=A0A1E3QKG1_9ASCO  ali  20  45.................................................PTLDQLWGEDWPFSGLSSYAHLPYHKCLVEPDTDFDIGIIGVPFDTATTYRTGARFGPKGIRAASARQT--KLRGYNPRAGINPYDWAKVIDCGDIPVT--PMDNNLALRQMTVGFEEKRNVTEAGASRTQFPVAMGGDHSILLPHLRALKKAYQEIHVIHFDAHLDTWSPSKYPS-FWHQSEFTHGS--------MLWMAAKEGLINANNNVHLGLRTRLNGEEDNDEDLGFTRISADDIHQSGVNYVVDKILETIPK--NKPVYLSVDIDCLDPGFAPGTGTIESGGLLPRELIYILRKL-EGLNLVGADVVEVNPAFDHSEVTTTNGAQVVYELVTSMVK............... 387
180 1.000e-83UniRef50_A0A160F3E1 Agmatinase n=23 Tax=Bacillaceae TaxID=186817 RepID=A0A160F3E1_9BACI  ali  22  1..............................................................MRFDEAYSGNVFIKSHPNFEESEAVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSPYLDRE------LEEVKYFDAGDIPLP---------FGNAQRSLDMIEEFVDRILTAGKFPLGLGGEHLVSWPVMKAVYKKYPDLAIIHMDAHTDLR-------EHYEGEPLSHSTPIRKIAE----------LIGPKNVYSFGIRSGMKEEFEWAKQNGM------YIAKF---EVLEPLKEVLPTLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLAAIHEIARSVHVVGADLVEVAPVYDHSEQTANTASKLVREMLLGWVQ............... 290
181 1.000e-83UniRef50_A1HTD3 Arginase n=4 Tax=Firmicutes TaxID=1239 RepID=A1HTD3_9FIRM  ali  34  2..........................................................................................................................................................LKNLQPIVAASEKVAAKVSRTVAAGRFPLILGGDHSIAIGTLAGISRHYANLGVIWYDAHGDLNTPETTPSGNIHGMPLAASMGLGHPALTGI--GGYVGKVKAENIVMIGIRDLDPGERLLIAERKIRVYTADDVSRLGIARVIAETVDYLSARCDG-VHLSFDLDGIDPLEVPGVGTPVAGGISYSDSLAALVLLHQSGIITSAEFVEVNPLLDRDDRT................................ 219
182 2.000e-83UniRef50_C3MMG9 Agmatinase n=45 Tax=TACK group TaxID=1783275 RepID=C3MMG9_SULIL  ali  19  10...............................................................PRFTQISTFGRLPICGRDEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGSRLLRPY-----NQFLDTYPFDKLNACDMGDINIIPGYIEDTMNIIQ--------TNLYEIISSKNLVPFIAGGDHSITLPVLRALHKKYGKINIIHLDSHYDFWDSY-WGKKHTHGTWLRRAIEEGLIKEA----------------IQGGIRTFSKEDLKDKERLGVKSFTIRDL-KYNLDSVIREI-----NSLSGPTHVSIDIDVVDPAFAPGTGTPEVGGLTSFEIIEIIRKL-RFDKLVGFDVVEVAPPYDVSEITTMLAANIIYEGMSVL................. 301
183 2.000e-83UniRef50_A0A1J4UHW9 Agmatinase n=2 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4UHW9_9ARCH  ali  20  4..................................................................FECIPFTFLGMKNNLKNAKTVIVQAPYDGTVFYKDGQRHGPREIIDASRHMELYDAEF-----GCDVCESAPVYTMDELVLSK---------ESPKKAVERVGEVVDEVLKERKFPLVLGGEHSVSAGAVSACAKKFKNFSVLQIDAHGDLRD-------AYEGTKYSHACAMRRAREA------------CGNIVQAGVRSMSGEEAEWIKKERIKYIFGSEFEE-------SEVLERIE---NENVYVTFDLDGFDPSIMPAVGTPEPGGISWKQATSLLRKVFERKNVIGADVVELCPVIGDT----------------ASAFLAAKLCYKMIGWKFL 287
184 2.000e-83UniRef50_A0A2E6VUY7 Agmatinase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VUY7_9DELT  ali  18  3................................................VNNFSPVDGRVYPRFSGIKTFYRLPFLPDEASLQAADVALLGAPFDGGTSYRPGARFGPEKIRSMSSL-----GRGHHPEHDVNIFKGMKVGDAGDCPVTP---------QDISKTHAQIKERVAEVLKAGTFPMVVGGDHSTTIGTLDALVAHHGPLGIIHFDAHTDTY-PAAWGCDVHHGTFMR--------------LGKERGWFRENAVVQVGIRGPTEQDIHVPTQYGYRVFTVDDVKQQGVGAVV----QHIQQLDDGPFFISFDIDCLDPSCAPGTGTPVPGGLSTWEAQQILRA-TSHINVVGADLVEVSPPYDHHDITALTGVTVIWEILSAVA................ 313
185 2.000e-83UniRef50_Q2NRD3 Agmatinase n=372 Tax=Bacteria TaxID=2 RepID=SPEB_SODGM  ali  20  26............................................................................FNPYATDADWVITGIPFDMATSGRAGCRHGPAAIRQVSTNLAWEGCRW---PWDFDVRKRLKVVDCGDLVYE---------FGDAQDFCDKLQDHAERLLAAGKRMLSFGGDHFVTLPLLCAHAKHFGKMALVHFDAHTDT---YANGSKFDHGSMFYHA--------------PNEGLISPAHSVQIGIRT------EFERDNGFTVLDAGQVNDRSVDDILAQVKQIV---GNLPVYLTFDIDCLDPSAAPGTGTPVIGGLTSDRALKLVRGL-QPLNIVGMDIVEVAPAYDQAQITALVAATLALEML.................... 297
186 2.000e-83UniRef50_P70999 Agmatinase n=355 Tax=Bacteria TaxID=2 RepID=SPEB_BACSU  ali  22  19................................................................................WEEADAILYGMPMDWTVSYRPGSRFGPSRIREVSIGLEEYSPYLD------RDLADLNFFDAGDIPLP---------FGNPQRSLDMIEEYVDSILEKGKFPMGMGGEHLVSWPVIKAMYKKYPDLAIIHFDAHTDLRVD-------YEGEPLSHSTPIRKAAE----------LIGPHNVYSFGIRSGMKEEFEWAKENGMHI---------SKFEVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKELLASVHEIARSVNVKGADLVEVAPVYDHSEQTANTASKIIREMLLGFVK............... 290
187 2.000e-83UniRef50_A0A160T3Q5 Proclavaminate amidinohydrolase n=45 Tax=Bacteria TaxID=2 RepID=A0A160T3Q5_9CHLR  ali  22  45.............................................................................................SGATSFRGGTRFGPRHIRAASLALW-----GTHHIHGVAPTDALTIVDYGDVEIEMAY---------IEKSMDFITTEVGAALAQGAMVVALGGDHSISLPLLRAQAAAHGPLAVVHFDAHTD-----VEPGGYEHGTVFRHAIEEG--------------LIDPTAYIQVGIRGFFPDDLNVARRLGARVLTIDDCFEMGIPAVIEAIRETV---GDRRVYVTLDIDATDPAFAPGTGTPEPGGFSSYQMLQLMRGL-KGLNLVGMDLVEVSPPYDQSDVTAILAANLVFEYLCLVA................ 312
188 2.000e-83UniRef50_A0A0B7JEV9 Agmatinase n=82 Tax=root TaxID=1 RepID=A0A0B7JEV9_PHOPO  ali  19  35.....................................................................................VIITGVPFDMATTGRSGSRMGPGAIRQISTNLAWEGKRW---PWSFNLLKSIKIADCGDLVFD---------CGDAGQMCERLEAHATGLLEQGKTLLTFGGDHFVTLPLLRAHAKQFGKMALIHFDAHTDTYDQ---GSKFDHGTMFYHA--------------PKEGLIDPTHSVQIGIRT------EHSDKLGFNVISADTANDWSVAQIVEKIKATV---GDMPVYLTFDIDCLDPAYAPGTGTPVCGGITSDKALKIIRGL-QGINLVGMDVVEVAPAYDHADITALAAATIATDLLHLWA................ 301
189 2.000e-83UniRef50_W7A3G5 Uncharacterized protein n=13 Tax=Fungi TaxID=4751 RepID=W7A3G5_COCMI  ali  19  59....................................................................PYVHCLAPEGDDVEPFDIAILGAPFDTAVTGRPGTRFGPGGIRAGSRRMGP-SWSIYTGENVF--FDWAKIVDCGDAPLT--FLDNTVALKQLDKAHEIISSRDANSSEHGRTPITLGGDHTTTLPALRSAHNHWGPVSVIHFDSHIDTWDPKVLGGGISHYAGVNHGT--------FLHIAHEEGLIR-NTSIHAGIRAPVKGDVRNDIRCGFDMVKARDLDRIGVSGIIETLKARV---GDSKVYISVDIDVLDPAFAPATGTAEVGGWSTRELLSILDGLA-GLDVIGADIVEVAPIYDPGEPTVLAAAEIVLSLITLMVKAPA............ 373
190 3.000e-83UniRef50_A0A0B8QPH7 Agmatinase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0B8QPH7_9VIBR  ali  25  3.........................................................................................................................WEGNKFPWDFNVFDRVNVIDSGDLVFDSG---------DAEDMTQRLQAATDEILKSGKTVLALGGDHFITLPLLRAYAKHYGEMALVHFDAHTDT---YAHGSRYDHGTMFYHA--------------PNEGLISPEHSVQIGIRT----EYQ-KESHGFNVINAMEANDLSADEIVARIKQTI---GDKPVYVTFDIDCLDPAFAPGTGTPVCGGLNSDKVLKILRGLA-GVNIVGMDVVEVSPPYDHADLTALAGATVALELMYAWA................ 237
191 3.000e-83UniRef50_Q6MHV0 Agmatinase n=16 Tax=Proteobacteria TaxID=1224 RepID=Q6MHV0_BDEBA  ali  20  24.......................................................................FFRLPYVTIEADYEVGIFGIPYDGGVSYRPGGRFAPAKVREVSSL-----GRGFHMTRMENFFENLKVADIGDCPTVPIDQK---------QTYEKIEKFVGEVLSHNKRFLAVGGDHSTTLPVLRALRKKYGPLAFIHFDAHLDTY-PAAWGQEYHHGAFARHAVEEG--------------LVDPKKMVQIGIRGPLAGDLNFVNKHGIRVITVDEIRNQPI----TEFLKTLPTFDETPTYISYDIDNLDPSCAPGTGTPVPGGLTTYEVQRIFRAL-KIPNLVGGDVVEISPPFDHADITALAGMDALFEMLHL.................. 310
192 3.000e-83UniRef50_UPI000688AB93 agmatinase n=1 Tax=Ensifer aridi TaxID=1708715 RepID=UPI000688AB93  ali  19  24.......................................................................FMRSAHVPLSSELDIAISGVPFDLGTAFRIGSRFGPACVREQSRHVR-----RIHQTFGFSPFDLCRVADVGDAPV---------RSFSIRDSLALIEDHFRKIKDLEITPLTIGGDHTISLPILRGIVQ-HGPIGLIHIDAHSDTLD-SIQGEQYCNGTPFRRAVEEG--------------LVDPKRLVQIGIREFDKDDHDWAKANGIRMISMNEIDQRGLEAIVEETRSIVAE---RPCYLTLDIDSLDPSVAPGTGAVEPGGFTVREMERLLEGLM-GVDLIGADIPEVSPLYDEGGRTGRVAATLAFDLLCLLAKA.............. 313
193 3.000e-83UniRef50_U1GRI1 Arginase n=3 Tax=Spirochaetes TaxID=203691 RepID=U1GRI1_TRESO  ali  27  1...................................................................................MNIHIIEMPLDFGAS-RHGSDMGPSAIRLAGLRAKLESLGHYNSPMRIHPQEYEEV-----------GNPKAKYLKPIAAACGQLAKETDDSFAAEEFPLTLGGDHSIVLGTLAGAARKGQRLGVLYVDAHGDFNTPETTLSGNIHGECLAASCGLGLPELTNLYFDGR--KVDPRNVCFVGIRDLDPGEKELMRKSGVTVFTMSDIERQGFPSVVKQVVLFFKTHADV-VHVSFDMDVLDPMFAPGTGIPLPAGMTNREALLLMEEMSDTGIVKSADIVEVNPILDVRNQTAV---------------LAVSLAARLLGEKL. 301
194 4.000e-83UniRef50_A0A2T3BAW9 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A2T3BAW9_AMORE  ali  16  97...................................VGTGFGYEIEGNWVFIQTDLDYDLPFSNIVTYAHLPWERCFNLAHNNPFDIAIVGFPFDTTVSVKPGARYGPRGIRAGSTKEKPGRTYNVNYGLDWATN-WAKIIDCGDVPVT--PYDNAHAFIQMEQGYRQHKDVVTPALATHPRLISLGGDHSIMLPILRSLKSVYGPISVIHFDSHLDSVNPTKGYSGFTHGTFFWHA--------------AQEGCI-ANSSVHAGLRTFGLGDYENDQEVGFSIIHARDIDDIGVQGIIDKIVAAV---GDKMAYISVDIDVLDPGAAPATGAPEAGGWSTREFKRILEGL-QDLNIVGADVVEVAPDYDTNEITSIAAADMIIDIISAMVK............... 450
195 4.000e-83UniRef50_Q57757 Uncharacterized protein MJ0309 n=20 Tax=cellular organisms TaxID=131567 RepID=Y309_METJA  ali  19  11.........................................................................FMMANCPYEEAEGVIFSIPYDETTSFKPGAREGGNAIRTASWGLETYSPILD------RDLAELKYCDLKDLDL----------YGSQEEIFGTIHSVSREILKENKKIIVFGGEHSITYPIIKAVKDIYDDFIVIQFDAHCDLRDE-------YLGNKLSHACVMRRVYELT------------KNIFQFGIRSGDKEEWDLARKNNL-YLKMDLMNKDDLEYI---------KSLDKPIYVTIDIDVLDPAYAPGTGTPEPCGFSTRELLYLLEEVKD--KIIGFDIVEVSPIYDIANITAITAAKIARELMLMI................. 283
196 4.000e-83UniRef50_P00812 Arginase n=71 Tax=Eukaryota TaxID=2759 RepID=ARGI_YEAST  ali  33  88.........................................................................................................................................................KAKRADLVGEATKLVYNSVSKVVQANRFPLTLGGDHSIAIGTVSAVLDKYPDAGLLWIDAHADINTIESTPSGNLHGCPVSFLMGLNKDVPHCPESLKWVPNLSPKKIAYIGLRDVDAGEKKILKDLGIAAFSMYHVDKYGINAVIEMAMKAVHPNGEGPIMCSYDVDGVDPLYIPATGTPVRGGLTLREGLFLVERLAESGNLIALDVVECNPDLAIHDI-----------HVSNTISAGCAIARCALGETLL 333
197 4.000e-83UniRef50_UPI000C2A61B1 LOW QUALITY PROTEIN: uncharacterized protein LOC111529469 n=1 Tax=Piliocolobus tephrosceles TaxID=591936 RepID=UPI000C2A61B1 :  ali  68  1...................................................................................................................................................NDIYYNNIKNVEVIGKSSENIFKQCDKELKKKNFVLNIGGDHSIAFATILSSVHNYENLKLVWIDAHGDINVPETSPSMNYHGMPLAHALNLFKKKVPGFEWSEKLKYLKPENVALIGIRDIDEYEKIIIKKSXINYYSMFDIDMHGMYNVCKDALEKIDPDNNSPIHVSLDIDSIDVLYAPATGTLAKGGLTYREIHLLLKMLADTKRVVCMDLVEYNPLIDVKDKKLHCDSLPIRADATVTGKLCLEMIARILGNNI. 259
198 5.000e-83UniRef50_A0A0G2J7S0 Agmatinase n=5 Tax=Fungi TaxID=4751 RepID=A0A0G2J7S0_9EURO  ali  19  3...SSPLFLLQLLAELNNAADIVFPPVAAIHGMAQAPLGPEDTIDI-------VSDSQFSGLMTFANVPYVNCFVDSEAEKQRYDIAFMGAPFDTGVTGRPGARFGPGGIRRGSQRIGS-DGAWSVYTGENAFTSWASVVDCGDVPLT--FLDNTVALKQLDKAHRVVSSRSANASDVSTVPITLGGDHTTTLPALRSTYKHWGPVSVIHFDSHLDL----SSYAGVNHGTFLHIAHEEGLVL---------------NSSIHVGIRGPPKKDIKNDIRCGFNIITARDIDRIGTSGIVEKIKKRV---GNNKAYISVDIDVLDPAFAPATGTSEPGGFSTRELLTILDALADTIRIVGADVVEVAPIYDTAGETVLAAAEVAHSLLALMV................ 368
199 5.000e-83UniRef50_A0A1G5SG98 Agmatinase n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1G5SG98_9PROT  ali  20  28.......................................................................FFRVPYQTDMTGVDVVVTGVPLDIATTNRSGARLGPRAIRNASLSLAWERPW----PWNIDPMTALRVIDCGDCE---PVTDDLLSVAHIEAHIANIIGAGAAAL-------VLGGDHFVAYPSLRAHAAVHGPISLIHFDAHTDTWP--SSGNGINHGTMF--------------YQAAHEGIVNPASSTQIGIRTTN------DDTLGFHIVSAADVHQTTGRDIASQIRARV---GGKPVYITFDIDCLDPAFAPGTGTPVPGGLSSFQALSIIREL-KGINLVGMDVVEVAPAYDHAEITALAAAQIAVELLCLYAE............... 308
200 5.000e-83UniRef50_A0A2H0SIE7 Agmatinase n=8 Tax=Bacteria TaxID=2 RepID=A0A2H0SIE7_9BACT  ali  21  1..................................................................MYLPYNFGGLNNQSYKKAKVVVLPISLEKTVSYMPGTKFGPRAIINASRYIELFDIEMGRDLSQIGIFTLPEL---------------LFAKKSLEESIKEIKQAALNLLKDKKFILSLGGEHTISYGLISAFKEKYKDFSVLQIDAHSDLRDE-------YEGTKFSHACVMRRVRDLGISVTG------------VGIRSQDETEIGYMKKKKIKIFYAPMIP-----------LKKIISSLSKNVYITFDVDGLDPSIMPSTGTPEPGGLGWYEVLSLIKQVAKERKIVGADIVELSPLKG-----------IIFP-----DFLAAKLAYKIIGYSL. 280
201 6.000e-83UniRef50_A0A1V6QBE5 Uncharacterized protein n=2 Tax=Penicillium TaxID=5073 RepID=A0A1V6QBE5_9EURO  ali  19  508.......................................................................PYFPCLASEAEKYDIAFLGAPFDTGTSYRPGARFGPSGIRQGSRRLNLY--GGYNVPLQANPFDDMRIMDCGDVPVTS--YDNAWAIQQIEEGHRKPFTDADKLSRAGKRVITMGGDHTITLPLLRSINKAYGPVTVIHFDSHLDSWKPKVFGGSPSQVAAINHGT--------YFYHAAMEGLLKNDTNIHAGIRTTLPSDYENDGYCGFEIVEAREIDTIGTDGIIKKIRDRV--GTDNPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGL-DGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVK............... 827
202 6.000e-83UniRef50_K4Z987 Agmatinase SpeB n=58 Tax=Firmicutes TaxID=1239 RepID=K4Z987_PAEAL  ali  21  1..............................................................MKLDQKYSGNVFICSSDDYEGAKAVIYGMPMDYTVSFRPGSRFGPGRIREASVGLEEYSPYLD------RSIEELNYFDAGDLLLP---------FGNAAKSLDIIGEFVGKLLSDGKFPIGLGGEHLVTWPVLQEVYKKYPDLAIIHIDAHADLR-------EQYEGEPLSHSTPIRKAAEM----------IGGKNVYQFGIRSGSREEWTYARE-NINFFPFD---------VAEPLKKVLPELAGRPVYVTIDIDVLDPSCAPGTGTAEAGGITSKELLEAVHSIARSDNVIGCDLVEVAPIYDPTEQTPITASKIIREMLLGFVK............... 289
203 7.000e-83UniRef50_A0A1V5FZ74 Agmatinase n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A1V5FZ74_9PROT  ali  19  42.......................................................................FLRRPYRKDLRDADVAVFGAPFDLATTNRPGARLGPRAIRSASASLAWCPPYR----WGFDPLERLQVVDFGDLYFDPGR---------PAEIPERLYQQVRDILAHSVTPLALGGDHFVSFPILRALSEQHGAIALIHFDAHSDTWRDD--DGRVDHGTMFFHA--------------ARLGYVDPAVSVQLGMRTFNEE------THGFLVWDADRLHRDGIDAALQAIHARV---GQRACYVSFDIDFLDPAFAPGTGTPVCGGFSTHEALRLIRGLA-GLNLIGMDVVEVAPAYDHAEITALAAASVAHELLAVLA................ 322
204 7.000e-83UniRef50_A0A1Y2F5F4 Arabinogalactan endo-beta-1,4-galactanase n=1 Tax=Protomyces lactucaedebilis TaxID=56484 RepID=A0A1Y2F5F4_9ASCO  ali  16  379.................................................SYSTDQWDFDWSFSGIETFAHLPHVKCLTHPDEAFDIAIIGAPFDTAVTFRPGARFGPRAIRHMSQRQTT--LRGFNAATGINPYKWAKIIDCGDIPIT--PFDNAVALKQMTLAFEQLIHTGRRIAKDGPRLLTLGGDHSIALPALAALHKAYGPVSVLHFDSHLDTWSPAAYPTDFTHGTMF--------------HLAAQRGYIANGTSVHAGLRGADFDDYMHDQEVGFKLIEAREMDSIGADGIAANIMNVLGK--DRPVYLSIDIDVLDPSVAPGTGTPESGGWTTREMLRVLQAL-QGLNIVGADIVEVSPAHDNQGETALAAADLAFEILGMMVQ............... 727
205 7.000e-83UniRef50_A0A291B6D7 Agmatinase n=12 Tax=Bacteria TaxID=2 RepID=A0A291B6D7_9BACT  ali  19  1...............................................MESVMATLANFPDYSLYANAFGFLRQPLVFQPQGFDADVVITGVPFDMATTGRSGSRMGPGAIRQASINLAW---EGKCWPWDFSLTKEIKIADCGDLVF---------NCGDAAQMCERLEAHASSLLAEGKTLLTFGGDHFVTLPLLRAYAKQFGEIALIHFDAHTDTYD---MGSQYDHGTMFYHA--------------PNEGLIDPYSSIQIGIRT------EHGYTLGYQVVDATKANDWPVNKIVDTIKNRV---GNHPVYLTFDIDCLDPAYAPGTGTPVCGGLSTAKILQVIRAL-QCINLIGMDVVEVAPAYDHAELTSLAAATIATDLLHVWA................ 305
206 8.000e-83UniRef50_A0A1R0GTL0 Arginase n=2 Tax=Smittium TaxID=4888 RepID=A0A1R0GTL0_9FUNG  ali  31  21..........................................................................................PTCYDGGQKKSGVDIAPGEMLKAGLATQIEKMGYSVNVLPDEDCESHK--PESEISVEGS---NVLNLVWTSNVCKAHAARVEEQCRLGNFALSLGGDHSLALGTITGSSRVYGDLCIIWVDAHTDINTLSTTDSGNLHGCPVSFLLGI----ETHPELAWMKPIIRKDRFVYIGLRDIEHKERKIVKDNNIKAFTMHHVDKYGIGAVVQMAIDHINPNLDLPIHLSLDVDAMDPSVAPATGTPVRGGLTFRECHYLCEAIAETNCLVAMDLVEVNPLLGDE------------SAFNQTVAVGNSVIRCALGETLL 317
207 8.000e-83UniRef50_Q10066 Arginase n=5 Tax=Schizosaccharomyces TaxID=4895 RepID=ARGI2_SCHPO  ali  26  1..............................................................MSPHKISDNHRHLMLSRFMMGNGVSIINMPFSGGQP-KDGAELAPEMVEKAGLVDDLEHLGYDVKLIQNPEFKSRP-------SKEGPNQALMKNPLYVSNVTRQVRDAVQRELEQQRVVVNIGGDHSLAIGTVEGVQAVYDDACVLWIDAHADINTPESSPSKNLHGCPLSFSLGYAEPLPEEF--AWTKRVIEERRLAFIGLRDLDPMERAFLRERNIAAYTMHHVDKYGIGRVVEMAMEHINPGKRRPVHLSFDVDACDPIVAPATGTRVPGGLTFREAMYICEAVAESGTLVAVDVMEVNPLLGNE------------EEAKTTVDLARSIVRTSLGQTLL 323
208 8.000e-83UniRef50_S8EF51 Uncharacterized protein n=3 Tax=Polyporales TaxID=5303 RepID=S8EF51_FOMPI  ali  19  3..................................................PAFKEPWSRESYGLTTFAAAPPLRCFGVDSETSYDIAVLGAPFDTTTSYRPGARFGPNGIRQGSRRIHVSSININMKS---RISDDLDVVDCGDVPMV--YTDNKVALRQLEAANKLVLNHTKSIAKDGKFVLTLGGDHTITWPLLRGVHDIYGPVSVIHFDSHLDTKKPSLMPNGPWEGEPVSHGS--------YFYYAHKEGLLAPDNNIHVGIRSGSWKDYENDYEVGFVISHADEMEEIGWRGVVKKIRETV---GDNPVYITFDIDAVDPGSAPATGTQEIGGITTREIKKIMQGLT-GLKIVGADIVEVAPGYDTAELTQIAAANIGWDILALMAKT.............. 345
209 9.000e-83UniRef50_Q32C02 Agmatinase n=1171 Tax=root TaxID=1 RepID=SPEB_SHIDS  ali  18  6........................................................HQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRF---PWNFDMRERLNVVDCGDL---------VYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDT---YANGCEFDHGTMF--------------YTAPKEGLIDPNHSVQIGIRT------EFDKDNGFTVLDACQVNDRSVDDVIAQVKQIV---GDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGL-KDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQA................ 301
210 9.000e-83UniRef50_I6X7R8 Arginase n=121 Tax=Bacteria TaxID=2 RepID=I6X7R8_PSEPQ  ali  30  19......................................................................................................CRLGPGALRVAGIGKALRAFG-------------VDVRDAGDVTGPPPPVDGYRHLPEVIEWNRAVRDAVAAELADGRMPVLMGGDHSLAIGSISAIARAGKKLRVIWVDAHADINTNELTPSGNIHGMPVACLLGDGPEELTG--MSDRKPAIEVDNIRQVGLRSVDPGEKRVLVDKGLEVFDMRFLDEAGMRHAMERALHDI--DGDTHIHLSLDLDFVDPQVAPGVGTPVVGGPTYREAQLAMEMIADTGRLGSIDLVEINPALDIRNTT---------------AELAVDLVESLFGKSTL 299
211 9.000e-83UniRef50_A0A0D6FIK0 Guanidinobutyrase n=101 Tax=Bacteria TaxID=2 RepID=A0A0D6FIK0_ALCXX  ali  22  58.......................................................................RQVDWTQPDFGDLQVALLGVPMDLGASNRSGCRFGPRALRAIER------VGPYNHVLKCAPVRELRVADIGDVPMRSRY--------SLEQSHEDIHAAYEKLVAAGVAPLSVGGDHSVTLPILRALGAR-QPVALVHFDAHCDTGGPF-DGSRFHHGGPFRQAV--------------LEGVLDPTRTIQIGIRGSAEYLWEFSYESGMTVIHAEDIPRLGVDAIIAQARAIV---GDAPVYVSFDIDCLDPAFAPGTGTPEVGGVTVREAQAMLRGLA-GLDIVGGDLVEVAPSYDATANTAHAGAQILFEILSLM................. 342
212 1.000e-82UniRef50_D6TKE7 Agmatinase n=9 Tax=Ktedonobacteria TaxID=388447 RepID=D6TKE7_9CHLR  ali  22  14............................................................................PHCNPETAQVTIIPAPLEYSVCYMKGTEHGPQAILDASSQMELYDEELDCCPIEIGVYTR-PVLDYS--------------GMDHAEALKATGQAVRETLEKGQLPLILGGEHSLSAPCIAAVHEKYPDLTVVHIDAHGDLRDE-------YEGTPLSHASIERRVVDMGIPLLE------------IGIRSFSPEEAEFLKSGNIAVVWAYQIAR-GIAQIP-------WERLGKHVYLTIDLDAIDPSEMPAVGTPEPGGLSWYQVLDLVREICQRSTVVGMDVVELCP----------------MEGQTRADFLAAKLVYKMIGYRF. 286
213 1.000e-82UniRef50_A0A075B2U1 Ureohydrolase domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075B2U1_9FUNG  ali  32  44...................................................................................................................MILTGDFLSEITSLGWTYYDASNIRSFESFKNENDKFKNIKNSKWVGFANSVVYSKLKEVHQNQHFPLLIGGDHSLAVGSVAATADKHKDFCLIWVDAHADINTVDSTLSGNLHGCPVSFLLGL---NGNVPGFEFLKPCLRPDRIVYIGLRDLDNAEKKILKELDIKTFSMHDVDKYGIAKVIEDALNHVNKERNLPIHLSFDIDALDSTIAPSTGTPVLGGLSYREGRYLIETVCETGLLVALDMVEVNPEIGDQ------ASQI------QTIKVAQNLIKSALGYTL. 319
214 1.000e-82UniRef50_W2RVU3 Agmatinase n=3 Tax=leotiomyceta TaxID=716546 RepID=W2RVU3_9EURO  ali  19  93...................................................................................FDIAFVGSPFDTGVIYRTGARFGPAGIRMGSRRLGKYS--GHSVELDYNPFSPFTVVDCGDAPVT--PMDNRVAIKQLEQAHQIITSRANQTLLKHPKLITLGGDHTITLPALRNAYKQWGQLSIIHFDSHLDTFNPDSYGGVNSNYSSVNHGT--------YFHIAKDEGLLKDDANIHAGVRLFDPEDIKEDRRCGFDIIKATQMETLGIKGIVERLKKRV---GDGPVYISIDIDVLDPGFAPATGTAEPGGWTSREMLSIIEGLS-GINLVGADIVEVAPAYDTNETTTMLAAELLYEILIVM................. 394
215 1.000e-82UniRef50_UPI0005D25114 agmatinase, mitochondrial n=1 Tax=Takifugu rubripes TaxID=31033 RepID=UPI0005D25114  ali  17  24.........................PGFCCQDRSLTRDGPS--RKA---SGQRYNEPPSAEVVARVSGIPTMARLPYRETADGLDAAFVGVPIDTGTSNRPGARFGPRQIRVESAMLRAYNSG-----TRAAPYQSIRVADIGDVNV---------NLYDLQDTCRRIRDAYRTILAAGCTPLTLGGDHTIAYPILQAVAERHGPVGLVHVDAHADT-SDLLLGEKIAHGTPFRRCMEEG--------------LLDRERVVQIGLRGYSADAYEWSRAQGFRVVPVEECWYRSLTPLMAEVRSQM---GAGPVYLSFDIDALDPGFAPGTGTPEIAGLTPIQGVEIIRG-CRGLSLVGCDLVEVSPAYDT---TVPAAAR.......................... 340
216 1.000e-82UniRef50_A0A2G1XN31 Agmatinase n=1 Tax=Streptomyces cinnamoneus TaxID=53446 RepID=A0A2G1XN31_STRCJ  ali  16  11................................RREVDRSFSPRREAGPIDLRRYYVQPAY-SGMPTFMGVPLALNQDDLRAGKVDAAVVGCPVDVSTGHRG-AAYGPRAIRSDERYMYATPEAYIHSATRVNPFNVLKVVDYGDAAVDPF---------DITRSMEPIRGLVREIAEVGAAPIVLGGDHSLLWPSVGALSEVHGRIAVVHFDAHPDCHD-ELFGHKATHTTPIRRLM--------------HDEMVPGANIIQVGLRGPDDQLFNWMRRAGMKSHFMAEIERVGLAAVVDKVIEEAKAVAD-HVYISLDIDVLDPAFAPGTGTPEPAGLNTRELFTALRRIAHETNLVGMDVVEVAPHLDPGYSTAMNARRAVFEVLTGLAMNKVKI.......... 353
217 1.000e-82UniRef50_A0A2P7YLX7 Agmatinase n=1 Tax=[Candida] pseudohaemulonis TaxID=418784 RepID=A0A2P7YLX7_9ASCO  ali  19  583.................................................EPLATIWGEAWPFQGINTFAHLPNHHCLADRDLQYDVALVGVPFDTAVSYRPGARFGPRAIRAASQRQT--SLRGFNPRALYNPYEWASVVDCGDIPVS--PMDNSLAFEQMTVGFEEL--LFEHSRERPPRYIALGGDHLVLLPHVRALHKLYGPLNIIHFDAHLDTWKPDKYPS-YWH-------TETLEVSHGLMLWKAYEEGLTTKNNVHAGLRTSGAEDWEDDDEQGWLRLSADDVWIHGADYIVKQILKRVPK--NSPTYISVDIDVLDPAFASGTGTQEPGGWLPRELIHILRGI-EQLLIVGADVVEVSPAYDHAEVTATNGAQVAYELITSMVKNG............. 913
218 1.000e-82UniRef50_A0A2E7UM23 Arginase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2E7UM23_9DELT  ali  33  58.....................................................................................................................................................PGDPSMRFLPEVTAVVEALADCTEAAVGAGRFPLVLGGDHSIAIGTIRAMRRKGQRLGVVWVDAHTDMNTPETSPSGNIHGMPVACLLGDGPASLTTKLLAG-EPALRPEDVILVGIRDVDRREAETVRRKGVRAYTMSELDSRGTAVCLREAFAGLVERTDG-IHLSFDLDGVDPAEAPGVGTPVPGGLSLRESHLLCEMAAQTGCLMGMEMVELNPTRDICNKTG---------------ELARWLIESALGRSIL 302
219 2.000e-82UniRef50_C5BAV1 Agmatinase n=22 Tax=Proteobacteria TaxID=1224 RepID=SPEB_EDWI9  ali  18  25...........................................................................DFMPYDGDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEGKRW---PWNFDMRDRLKVVDCGDVVFS---------FGDAQEMSDNLQAHAERLLASGKRCLTFGGDHFITLPLLRAHAKHFGKMALVHFDAHTDT---YAHGSKFDHGTMFFHA--------------PNEGLIDPQHSVQIGIRT------EYDHDNGFTVLDAAQVNDRSVEDVLAEVKRIV---GDLPVYLTFDIDCLDPAHAPGTGTPVIGGLTSDRALKLVRGL-QDLDIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQA................ 301
220 2.000e-82UniRef50_A0A2A5AJ85 Arginase n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2A5AJ85_9BACT  ali  31  21......................................................................................................ASMGPDAIRIGGLYSGLERLQSYKDRGNLSALEEPH-------PPRKIPVGDIRYLDLICDFMKDLKQEVTSSLEDGEIPLVLGGDHSLAMASLAAVINFYKKPGVIWFDAHADLNTEETSPSGNIHGMPLAVALGDGNDSLKSLFEGS---FLDPSKVVLLGVRSVDSQEAQMIRKLGVHIFTMKDIDELGMKECVSRSIA-IANKDNSPVHVSFDIDGIDGRFVQGTGTPVNGGITLREAHLFLEMLAAKEIVTSVDLVEVNPLLDDRNKT---------------AEIAVHLIESLFGRVI. 303
221 2.000e-82UniRef50_I4Y8K0 Putative agmatinase n=1 Tax=Wallemia mellicola (strain ATCC MYA-4683 / CBS 633.66) TaxID=671144 RepID=I4Y8K0_WALMC  ali  21  24...................................................DNFKHIKAPLFADIVSFAHLKHQHCLLDKSEKFDIAVNGLPLDTSVSYRTGARFGPSGIRQGSRRQDP--ENAWSHYWKQNPYRGIKVIDCGDVPV--IAVDNNMAYKSIEAAHDTLLNRASKQLK-HPMLLTFGGDHSVELPILRSLKKVYGPIALIQIDSHIDTWSSKYGFSDNHNEAPVSH--------GNMLWHAHEEGLLS--SSIQAGIRTFTNEDIEDNEKFGIEMLTIDAVDEMGTKGISERIKERI---GDKPAYITFDIDSLDPAFAPATGTPEPGGLTTREAKAILRGL-EGLNLVGADIVEVSPAYDTSELTQMVAAEVAYELLNLL................. 351
222 2.000e-82UniRef50_A0A1C6F2L2 Proclavaminate amidinohydrolase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C6F2L2_9FIRM  ali  19  33..........................................................................................IPFDIRTTYRPGTRFGPDGIRRA------FSTDSVNEAVGIDTSKYVKGVDYGNLDIWNAEKAYLGSIPQ----------EMKAILETGTIPIVLGGDHSITFPELLAYKDVYGPVSIIHFDSHTDTWGSDTDKEHHDHSTPFRRAIEYD--------------CIDPKTSIQVGMRGFEKSDFDFANNAGLEHIYAVDIHHMGIEKTAELIREKV---GNNKVMVTFDIDFVDPAFAPGTGTPVSCGFTSRQALELIRHALIGLDIVGFDLVEVAPNYDAGGITSILASRIVKEFITCVAKAGIK........... 309
223 2.000e-82UniRef50_A0A2U3DXY6 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DXY6_9HYPO  ali  17  276.................................................DELEAKWGNEWPFSGIGSFAHLSHSKCLTDPTVDYDIAIVGAPFDTAVSFRPGARFGPRAIRQASSRQT--GFRGFNPRASINPYQWAKIVDCGDIPITPFDNDIAR--EQMTQALKQLGKKTVSALSPKPKLMTLGGDHSLTLPALRALKEIHGPVRVLHFDAHLDTWNPNAYPS-YWGATQFTHGS--------MFWMANQEGLLSNEASVHAGLRGTAWADNEDDSSQNWVRFSADDMDDIGTQGIIDGIMRVL--GTEDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGI-EGLNLVGADVVEVSPAYGRGEETALAAAQVVYELLSSMVKRGMK........... 617
224 2.000e-82UniRef50_A0A166S1B9 Arginase/deacetylase n=3 Tax=Fibularhizoctonia sp. CBS 109695 TaxID=436010 RepID=A0A166S1B9_9HOMO  ali  19  58.....................................................................HLPYSVCLEDESARFDIAILGFPFDTAVSYRPGARFGPFAIRAGSRRQR--DTQGYSLSWGMNPFDEATVIDCGDIPIS--PFDNALALDQMEVAYSTLLNRVGASAREHARIVSLGGDHTIVLPILRSLNKIYGPISVIHFDAHLDTWPGYQGQSRINHGTFFAVAQEEGLISNT---------------SIHVGVRCKMAGDVEHDQSVGFELITTDDIDDLGIPEIIRRVRARI---GDSPVYLSFDIDVIDPGLAPATGTPEAGGFTTREVKRIIRGLA-GLNFVGADIVEVAPAYDHADITGIAAADLVSDFLS................... 373
225 3.000e-82UniRef50_C5PF24 Agmatinase, putative n=45 Tax=saccharomyceta TaxID=716545 RepID=C5PF24_COCP7  ali  18  20....................NIVFPPIHEGQ--------ASLSNDGVADDIDIVTGSQFSGLSTFAHVPYVNCFIDGEAEKEKYDIAILGAPFDTAVTARPGARYGPGGIRRGSARMRAGSA-WSVYSGVNNLRSWAKIVDCGDAPLT--FLDNTIALKQLDKAHKVVSSRIANTTDVSSVPITLGGDHTTTLSALRSTYEKWGPVSVVHFDSHIDTWDPEVLGGGVSHGTFLHIAHEEGLVQ---------------NNSIHVGIRAPEKGDLRNDVRCGFDIVTARDIDMIGASGIIEKIKNRV---GSDNVYISVDIDVLDPAFAPATGTAEPGGFSTRELLTILDGLS-GLRVIGGDVVEVAPVYDTTGETTVLAAAEVANSLLGL................. 372
226 3.000e-82UniRef50_A0A101JHK3 Agmatinase n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A101JHK3_9ACTN  ali  17  14...................................VDRTQAPAREPGPIDLRRNFLQAAY-SGIPTFMGLPVCLDPADLRAGGVDVAVLGVPLDSSSGHRG-AAYGPRALRSDERYLFNTPELLISPSTRVSPFQQLKVVDYGDAAID---------IFSVEKSLPSIAATVTEVAQTGAIPVILGGDHSLMIASVGALADLYGPIGVVHFDAHPDCH-EHIFGHRVTHGTPIWRLIEE--------------KKIPGKNFIQVGLRGPDDQLFNWMRRQGLRTHFMVEIERSGFTAVLDKVIEEVL-DGPEFVYLSLDIDVLDPAYAPGTGTPEPGGLTPRELFPAFRRICAETNVIGIDVVEVAPHLDPGYTTTMNARRAIFEGLTGLA................ 347
227 3.000e-82UniRef50_A0A2X2KZA2 Agmatinase n=1 Tax=Staphylococcus aureus TaxID=1280 RepID=A0A2X2KZA2_STAAU  ali  22  3....................................................................................................................................PFAIAQVVDAGDIPVN--PFDLTEAVSEVERAALALGEQVQRI-------VTIGGDHTVALPLLRAVAAKHGPVAVLHFDAHLDTWDTY-FGAPITHGTPFRRASEEG--------------LIDLTASCHVGTRGYSKQDLEDDERLGFSIVSSEYIEEHGVEAGIARILQRI---GDKPLYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLRILRALS-SQNIVGADVVEVSPAYDHAQMTGIAASHVVYELVCLLA................ 235
228 3.000e-82UniRef50_B5YMM5 Arginase (Fragment) n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B5YMM5_THAPS  ali  30  9..........................................................................................................PALLRQLGLLKDLSTLGWRVEDNPDLDFNTI----CAEAGKNSNISPNAKHSHQVGAGSKALAELVETKLRLGRFPLILGGDHSIGIGSLAGIMRAKPETGVIWVDAHADLNTPEMSESGNMHGMPLGIMMKEDRRTIPGLEWMEEGPRLAPDSLVYVGLRDIDKEERRCIRELGIKTFTMYDIDHLGIGRVMDLALEHLRKNPDRPIHLSYDIDAVDPLHAPATGTAVRGGLTWREAHFVAEHVVKSGSLASAEIVELNPTLDGQGADETL-------------ELGHKLVTALCGESI. 298
229 3.000e-82UniRef50_P0DJQ4 Proclavaminate amidinohydrolase n=47 Tax=Actinobacteria TaxID=201174 RepID=PAH_STRC2  ali  20  10...............................................................PRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRS-----ESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQ---------SHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTN-PAFYGGRYHHGTPFRHGI--------------DEKLIDPAAMVQIGIRGHNPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKV---GQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKP-VGFDVMEVSPLYDHGGITSILATEIGAELLYQYARA.............. 308
230 3.000e-82UniRef50_U1MUQ6 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=U1MUQ6_9MICO  ali  17  66...........................................................................PQLHEVEHADVAVVGIPFDSGTSFRPGARFGPAHVREHSRQLHPY-----HQVHESFPFRDQQVVDGGDLRVGPY---------DIEAAVEAIHEQARALVQGGTTVVAIGGDHTIALPLLRAAAERHGPLAVLHFDAHLDTWDTLHGAS-IWHGSPFRRA--------------AEEGLLDLERCQHVGIRGYDPSELDDDARVGFAIIRSDDFARHSPEQLAERIRDRL---GTGQVYVSIDIDVLDPAHAPGTGTPEVAGISTRELFGVLREL-RGLDIVGGDVVEVLPAHDHAGITGLAAAHTVWELLALI................. 349
231 3.000e-82UniRef50_U2E6X7 Arginase n=6 Tax=Clostridiales TaxID=186802 RepID=U2E6X7_9FIRM  ali  32  41.........................................................................................................................................DVCDLGNIEVAKVNDDHIYRCDQVVDANTKLAFKVYDSISSGHFPLVLGGDHSLGIGSIAGVSKQYKNLGVVWIDAHGDLNTHETSETGNIHGMPLAASIGKGPDKLVNL--FEHRIKVKDENVVHIAGRDLDPGEVALINNSKINAFTMDKVYEHGIEKVMEESISYLKER-VDAIHVSFDIDSIDSSYVPGTGTPVRNGLTIEEAKKVLIALASSGLMVSLDLVELNPELDDNNKTADLYMELIR....................... 291
232 4.000e-82UniRef50_M1VX99 Related to agmatinase n=1 Tax=Claviceps purpurea (strain 20.1) TaxID=1111077 RepID=M1VX99_CLAP2  ali  18  448......................................................KWGFEWSFNGIGSFAHLDHVKCLTHPAEKYDIAIVGMPFDTAVSYRPGARFGPRAIRQASARQTSF--RGFNARAGINPYQWARVIDCGDVPVTPFHNDIAQ--EQMTQAFKALGRATPSSARSRGKPVTLGGDHSLALPALRALRELYGPIRVLHFDAHLDTWNPDEYPS--YWGSPFNHGS--------MFWMASQEGLLSNGQSVHAGLRSGTEGDNDADTAQNWVRFSADALDDMGTKGLVDAIMSVLGTR--DPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRILRGI-EGLNVVGADVVEVSPAYGRGEETALAGAQVVYEIVSSLVK............... 789
233 5.000e-82UniRef50_A0A2H5XU44 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5XU44_9BACT  ali  19  25.....................................................................................IAIQPIPLERTTSYGKGTKDGPREILRASHYVEFYDDEFDRELC----FERG-IATLEPLPLKKLP---------IEEALALVEARASAILQAGKFCVGLGGEHSITAPLVRAHAQKVPDLTILQFDAHADLRIE-------YDGTPYSHACVMARIAE----------FLDPSRITQVGIRALSKEEASFIRSAGVRTFFAHAIRRGD-----AQWMDRVLEGLSEHVYITFDVDALDPSIMPATGTPEPEGLTYSECIAIVKRLIETGRIVGFDVVELAP----------------IKKLHHPNLTAARLVYKLL..... 290
234 5.000e-82UniRef50_A0A2E7XHY4 Arginase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E7XHY4_9GAMM  ali  20  51...........................................REPGLIEIQRYPGGYAYT-GIPSFFNLPVALTPADLKAGKVDVAMMGAPLDTGSGMRG-AAWGPRHFRIANNYLPWGSYSTEHLHTMVNWREDLVVVDYGDAAIDNLSG---------ERSMKPVREIVRQIAATGAIPIIIGGDHSLEYPNVAGVADVHGNVGVIHFDAHFDA---GLFGNGHTHGKPIRRLIEEGHVL--------------GRNYIQVGLRGYWPGGFEWMREQGMRYHTMAEVEQDGWPAVMASVLKE-AREGTKYLYISLDIDVLDPAYAPGTGTPEPGGLTSRELFPLIRGLCSDNHLVGFDLVEFNPLVDPGYITGLNAERAVRECLTGIA................ 375
235 5.000e-82UniRef50_A0A0L0D619 Arginase n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D619_THETB  ali  26  5...................................................................................................RRGVDMGPSALRLADLLAELKDVSSVTDTGNIHVPTREEMADAGELD---DKVVNARNHRPIGAAVASLTEVVEDIVTRGSVPLVLGGDHSLAAGSMSGTQRARAKAGLLWIDAHMDMNTPETSPSGNLHGMPLAALLGL-EVPGLSAAVGGPDGMFDPSRVACVGIRDVDPAERDNMAKLGLNVFTMSSIDRHGMANVMERALNIIAPGVADSFAVSFDADSLDPSVAPGVGTPVPGGISFREGHLIMEMLARHGGMCGLDVVEVNPVLDTRNAT---------------AKVAVQMVLSAFGQTTL 305
236 6.000e-82UniRef50_A0A0J0XTK7 Arginase/deacetylase n=10 Tax=Agaricomycotina TaxID=5302 RepID=A0A0J0XTK7_9TREE  ali  18  45.......................................................................PWERCLEKPGYGFDIAVLGMPFDTSVSYRPGARFGPHAIRSGSRRHGPARSFLIPWGTSVTQDTGLQVVDCNDVPIS--PYDNALAIDEMQVAYAENTHYTRHLAKDGKRILTLGGDHTIVLPILGALTDVYGPISVLHFDAHLDTWNGHELGGAHTERHKVTHGT--------FFWKAYELGYINDKTSAHAGIRTRLNSMRDLLHDEGFQVFTTDDIEEMGPEGLAKKLKKRL---GSGPVYLSFDIDTIDPSMAPGTGTPESGGWTTREVKRIVRSLV-GLNIVGADIVEVSPAYDTNELTAMAAADLAQEFLALMA................ 364
237 6.000e-82UniRef50_A0A099KGZ3 Agmatinase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A099KGZ3_COLPS  ali  21  40..................................................................................HAEVAVTGIPYDLALSNRSGARLGPRAIRAASSNLAWGT----VAHWGIDPFETLPVVDYGDCGIDTS---------MPEQVPQDIEEHISHILDQDCATLCLGGDHFITYPILKAYAKKFGEISLIHFDAHYDTWND--TKGKIDHGTMFYHA--------------AKQGIVSPERSVQIGMRT------AIDDTIGFNVINNHAVHSQQPEEISAQIKKIV---GDNPCYLTFDIDCLDPVYAPGTGTPVVGGLTTYQAQRILRGL-EGINLIGMDLVEVSPAYDHAEITSLAGASLALDLLCLYA................ 310
238 6.000e-82UniRef50_A0A0S4J155 Arginase n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4J155_BODSA  ali  32  122.........................................................................................................................................................NCYEPFSVFATCENVRQKVAAAHDAGAFPMLVGGDHCLAMGSIAASLERQPNLGVIWFDAHADINTPLTSPSGNMHGMPLAALMNLRDIQ-KAPGFEHRYPILKPERVAYIGLRDVDDGEKRLINEMGLSCFNMDDLKRYGMKELVKQVLKKLCPTGTEPIHLSFDVDGMDPAEAPSTGTPVADGVRLHEALEMIQYIRATGCLYSMDVVEVNPSLGTAEVTITNAQLVMAHTLGYT-TTKAKL.......... 367
239 7.000e-82UniRef50_Q7P0S6 Agmatinase n=1020 Tax=root TaxID=1 RepID=SPEB_CHRVO  ali  20  32.......................................................................FMRRNYSRDLEGVDVAVSGIPLDLSVTFRSGARMGPQAIRAASVQLA----ELKPYPWGFDPFEDLAVVDYGDCWFD------AHNPLTIKPSII---EHARTILASGAKMLTFGGDHYVTYPLLIAHAEKYGPLALLHFDAHCDTWPDDSPDSLN-HGTMF--------------YKAVKEGLIDPKKSVQVGIRTWND---DFM---GLNVLGAPWVHDNGVDATIAEIKKTI---GDAPVYVTFDIDCLDPSAAPGTGTPVPGGLTTAQALKIIRNLGD-LNIVGMDVVEVAPSYDQSEITAIAAAHIACDMLCLM................. 313
240 7.000e-82UniRef50_A0A1H9BWP0 Agmatinase n=5 Tax=Streptomyces TaxID=1883 RepID=A0A1H9BWP0_9ACTN  ali  17  2........................................SDTTEFGLEDPERPRAQVRSGVSPRYAQLATFMRLRHDPAPVGRDVVVVGAPYDGGTSYRPGARFAPRAIRHESCLIHGTGI-----DRGPNVFELIDVVDGGDIDLSPFSMDLA---------METATEALTALLDDNAAFLMLGGDHSLSLAALRAVRHKHGKVAVLHLDAHSDTNPPVYGGT-YHHGTPFR--------------WAIEEGLIEPAHMVQLGIRGHNPDSLDYARGHGVRVITAQECADRPLADVAAEIRAVV---GDLPLYVSVDIDVVDPAHAPGTGTPAPGGLTSREVLSLL-TLVGDLNPVGFDVVEVSPPYDHSGITALLAAEIGAELLYQYAR............... 323
241 7.000e-82UniRef50_UPI000A07371A agmatinase n=1 Tax=Streptosporangium amethystogenes TaxID=2002 RepID=UPI000A07371A  ali  18  1........................................................................MGLPYEPAPQGADLVIVGAPYDGGTSYRPGARFGPRAIREESALLHGTGL-----DRGPSVFGAIGAVDAGDLDL---------NRFSMESAMSTATERLTELAERNQALLMLGGDHSMTLAALRAAHKVHGPVAVLHLDAHSDTYPP-VDGGRYHHGTPFR--------------WAIWEKLVDPARMIQVGIRGHVPGALEFARARGVRIVTAPDIDRIGVGSLMSMIQECV---GDGPLYVSCDIDVVDPAFAPGTGTPSPGGLSSRELLAILRGIGDLQPI-GCDVVEVAPAYDHGGATALLAAEIGYELIYQYAR............... 289
242 7.000e-82UniRef50_A0A2I0QP90 Agmatinase n=8 Tax=root TaxID=1 RepID=A0A2I0QP90_9EURY  ali  19  17.....................................................................................VCIFGMPFDSTTSFKPGTRLGPRAIRDASYNLEFYSMALE------RNIRDIKIFDAGD----------TGFYTNPQHAISEISEQTRELLKSDKFIVGLGGEHTVSYGIAHAMKEIYKDVAVIQFDAHADLRTVYDFE-------KFSHACVMNLIGND----------IGFENIYQFGIRSGEEEELKFAEKTNF--FPLHKYDTAQILEILDEL------NIDKKVYLTIDIDVLDPAYAPGVGTPEPGGITSNEMFKILNSL-KKFDIVGFDVVEVNPMVDMSGITAMLAAKIIREGI.................... 276
243 8.000e-82UniRef50_C1BR82 Arginase n=2 Tax=Caligidae TaxID=72034 RepID=C1BR82_CALRO  ali  32  96..........................................................................................................................................................ALNRGNVHSFNKKLKNEVADALKANEFCITIGGDHSIGLGTVSGFTSVHPEGCLLWVDAHSDINTPHTSDSGNMHGMPVSRELYEGFKDSDHSIDDWHKPRLSPERIAFIGLRSVDPGEEKILKDLNIEAYFMNDIDELGINEVIKRSLQRINPSGNRPLHVSFDIDSLDPLEAPATGTPVRGGLTLREGLRILYECHKSGSLKALDLVEVNSHLGNKERTLTAAEHLIFSAFGHLLR............... 339
244 8.000e-82UniRef50_A0A1B3NLP0 Agmatinase n=42 Tax=Proteobacteria TaxID=1224 RepID=A0A1B3NLP0_9BRAD  ali  20  14..............................ADASGADHDPHFARVAADQFKGDKRKWPFSDVATFLGAPYRPDALGLPDL-GGLDVAIIGLPMDLGVTNRAGTRLGPRAVRAIERI------GPMDHVMGTAPLGMLKAADIGDVPFRSRY--------SLESCHEDIEATFRTIVEAGVSPLAVGGDHSITYSILRAVGAR-RPVGMVHIDAHCDT-------SGPYEGSKFHH--------GGPFRQAVLDGVLDPQRVIQIGIRGGAEYLWEFSYESGMTVIHADEVDGLGIEAVIAKARAVI---GDGPTYVSFDVDSLDPAFAPGTGTPEVGGLTPREALAILRGL-KGADIVAADVVEIAPQYDATSNTAHCAAQVLFTELCLIAE------ARALGK... 347
245 9.000e-82UniRef50_A0A1B7ITN7 Agmatinase n=516 Tax=root TaxID=1 RepID=A0A1B7ITN7_9ENTR  ali  17  13.............................................................LPFVGHCTFAKSPVCLNWEEIDADVAILGAPNDMGTQWRAGSRFGPRGIREASTLFSFGHAGAYDHEDDALYLDQVRMVDVGDADIVHT---------DMVSSNANIELAVRKILASGAMPVVLGGDHSIHAPVIKAYAGR-GPIHIVHFDAHLDFVD-ERHGVRYGHGSPLRRASEMDHIVG----------------MTQLGIRNVSRSDYDAARAAGSNILSVRDVRRLGTEAVLAQIPE------GCNYYLTIDIDGFDPSIAPGTGTPSHGGFQYYEVLEIIQALAKGGNIIGMDLVEVAPAYDPTGVTSILAAQLLMNSIG................... 313
246 9.000e-82UniRef50_Q2T3W4 Agmatinase n=267 Tax=root TaxID=1 RepID=Q2T3W4_BURTA  ali  19  31.......................................................................FMRRNYTRDLDGVDVVVSGVPLDLATTFRSGARLGPSAVRAASVQLAELNPY----PWGFDPFDDLAVIDYGDCWFD------AHHPLSIKPAIV---EHARTILQSDARMLTLGGDHYITYPLLIAHAQKYGPLSLIHFDAHCDTWADDAPDSLN-HGTMF--------------YKAVKDGLIDPKASVQVGIRTWNDDY------LGINVLDAAWVHEHGARATLERIESIV---GGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLG-GVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCL.................. 311
247 9.000e-82UniRef50_H1XYW0 Agmatinase n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XYW0_9BACT  ali  20  13................................................................................YQKARTAILPVPYERTTSFEGGTARGPQAAIAVSPYLETYDEELDVEIWKAGIFTL----------------PALNFGEDVQKDFDLITRSVLKLIEDQKFVVAIGGEHSISYPLFRAFHQKFPDISVLQLDAHADLR-------ESYQGTPFSHASVMKRIFDLN------------QNLVQLGIRALSIEEREFIKQKNIKTVFAHQMYEN--------WPDDILTHLSETVYLTIDVDFFDPALMPGTGTPEPGGFFWPETLKFLKTLFKTKNVVGMDVVELRPLAETR----------------HSEYTVARLIYKLIGYKF. 279
248 1.000e-81UniRef50_A0A1Y2FU90 Arginase n=1 Tax=Protomyces lactucaedebilis TaxID=56484 RepID=A0A1Y2FU90_9ASCO  ali  27  12....................................................................................HHVNVVPVAFSGGQAKGGVDDGPAMLLNHGLMDQIKQSGWDAQLL--QDLDVLALK-----PAEDPPIGIMKNTRFVSSVTKKLSEVCGRSAATGGLTLTVGGDHSLAIGTIVGLMKQYPEACVLWIDAHADINTPTSTESGNIHGCPVSFVTGQAGPQSSLPETLQWIPCLDTSRLAYIGLRDIDPEERRIIRARNIAAYSMHHIDKYGIGTVVQMALDRVNPNLTRPIHLSYDVDAIDPVFVSATGTPVRGGLTFREGTYICEAIAETGCLVSMDLVEVNPNL-RSEGTAGD------QEVQATLDISTSLVRCALGETLL 321
249 1.000e-81UniRef50_A0A0T5ZHV7 Agmatinase, agmatinase n=11 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0T5ZHV7_9CHLR  ali  17  49...............................................................................MRRHPDVAIVGAPFDDAVSHRSGARFGPRAIRQA-----TYTDGEHSLQLDVEPWAELDVVDAGDANIVPAW---------LERAHAVIYRKVRDVAACGAVPIVLGGDHSITWPSVTAVAEAVAPIGIVHFDAHADT-APDDWGVLAGHGTPMRRLIE--------------SGAVLGKNFVQVGLRGYWPEVFAWMQAQGMRWHKMREIEERGAEAVIDDAIAE-ALDGPDMIYLSLDVDVVDPGMAPGTGTPEPGGLLSRELLRAVRRIVGRVELAGMDIVEVSPPYDHAEITAMLGHRAALEAISALA................ 334
250 1.000e-81UniRef50_E2CP87 Agmatinase n=74 Tax=Bacteria TaxID=2 RepID=E2CP87_9RHOB  ali  17  15...........................................................PRFAGVPTFMRLPHVPLEHERIGDVQIGLVGTPWDAGTTNRPGPRHAPRQLRDASTMIR-----AQNGATGIRPFEMVNCADLGDVGP---------NPASLKDSLARITACYERLVQKSIRPLTAGGDHLCSLPILRALAQ-NKPLGMIHFDSHTDLFHSYFGGMMYTHGTPFRRAVEEG--------------LLDPKRVVQIGIRGYDDEDRDFADSVGIRVIPIEEFHARGPEDVMVEAKEI---AGTGETYVSYDIDFVDPAYAPGTGTPEVGGPNSYQALQVARML-DGVNIVGADMVEVSPPFDQSGATAYLGVSIMFEILCNMA................ 315
251 1.000e-81UniRef50_A0A084YY28 Proclavaminate amidinohydrolase n=53 Tax=Bacteria TaxID=2 RepID=A0A084YY28_9GAMM  ali  17  13.............................................................LPFVGHCTFAKSPVCLDWNNIDADVAILGAPNDMGTQWRSGARFGPRSIREASTLFSFGHSGAYDHEDDTTYLDQVRMVDVGDADIIHT---------DMEGSNANIEFAVRKILESGAMPVVLGGDHSIHAPVIKAYAGR-GPVHIVHFDAHLDFVD-ERHGVRYGHGSPLRRASEMEHIVG----------------MTQMGIRNVSRDDYDAARNAGSQILSVRDVRRLGTEGVLDCIPA------GTAYYITIDIDGFDPSIAPGTGTPSHGGFTYYEVLEIIQALSKSGNVIGMDLVEVAPAYDPTGQTSILAAQLLMNSLG................... 313
252 1.000e-81UniRef50_UPI0004898695 agmatinase n=1 Tax=Rhizobium leguminosarum TaxID=384 RepID=UPI0004898695  ali  20  40....................................................................................NVGVVGVPFDLGSSYRAGSRHGPAAIREASRVLR-----LVNGHTGVAPFEIARIADLGDAKIHPLNFDQ--SIEIITRCFLQLSKMA-------VRPLVLGGDHTISLPILRGLVQR-EKVGMIHFDAHSDT-SDETRGMKISQATPFRRAVEEG--------------LLDPERVVQIGLRGYGRDDYKWARSVGMTLITIDDFEERGRSAVIEEIRDIV---GTWPAYLSFDIDCLDAVFCPGTGVPEPGGVSMRDALVMLRGL-RGIDLIGADICEVSPHFDVGGITSLHAAHLGFEMLCLLAESA............. 317
253 1.000e-81UniRef50_Q6BVQ4 DEHA2C00792p n=2 Tax=Debaryomycetaceae TaxID=766764 RepID=Q6BVQ4_DEBHA  ali  19  128...........................................................................NCFSGETKFDIGIVGATFDTGVSFRPGSRFGPLGIRMATKRMSSGSISPFRK--NFSLFKDGKIVDCGDPPMTPI--DNRIALDQLYRAERAILKTTTPSLSKVSRILTLGGDHTVTLSCLRAVYEKWGKVAVIHFDSHLDTIDPYQMNENVTEYAALNHGT--------FFHWAAKRGLISESKNVHVGLRGYYENDTQRDSAIGFERIMSRDIDDIGIAGIVKRIKDRV---GDSKVYITVDIDSLDPSSAPGTGTVEPGGFSSRELLTILDKL-EGLEVIGADVVEVAPPYDTNEITTMVASEVARSLLGLMV................ 431
254 1.000e-81UniRef50_A0A254WWD7 Agmatinase n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WWD7_9CYAN  ali  18  69.............................................................................YCDPKKARYAILPLPYDGTVSYQTGTRNGPRAIITASQQVELFDEEYCKE------FTAAGVMTCDPVAPE---------MAGPKEMHESVYQAARQVLAKKKFLIALGGEHSLTSGLVRAVKQKHKKLSVLQIDAHADLRAE-------YEGTPYSHAAVMRRVVEMGIP------------VVAVGIRNYSLGEHQFMKKHGIKPVSVREVRTN------ADWLQQVVERLTDNVYVTIDIDGFDPAYAPGTGTPEPGGLDWFQVTDLLKATAMFRNIVAADVVEVLPQPGTA-QTEFLAAKLVYKLIAHI................. 340
255 1.000e-81UniRef50_C4JD76 Uncharacterized protein n=61 Tax=Fungi TaxID=4751 RepID=C4JD76_UNCRE  ali  17  20....................NIVFPPIHA------VPVQ-APLTTDNLENIDIITGSQFSGLSTFAHVPYVNCFVDSEAEKEKYDIAFLGAPFDTGVTARPGARYGPGGIRQGSTRMKVESA-WNIYTGVNNLLSWAKIVDCGDAPLT--FLDNTIALKQLDKAHKVISSRIANSTDISLVPITLGGDHTTTLSALRSTYEKWGPVSVIHFDSHIDTWDPTVLGGGISDYAGVNHGT--------FLHIAHEEGLIR-NDSIHVGIRAPLKGDLRNDIRCGFDMITARDIDLIGTSGIIQKIKDRV---GSNNVYISVDIDVLDPAYAPATGTAEPGGFSTRELLTIIDGL-RGLPVIGGDVVEVAPIYDTRGETTVLAAAEIANSLLGL................. 371
256 2.000e-81UniRef50_A0A1C5VKZ9 Guanidinobutyrase n=2 Tax=uncultured Ruminococcus sp. TaxID=165186 RepID=A0A1C5VKZ9_9FIRM  ali  18  29...........................................................................PYKQDIDGEDFVVLGVPYDTSVTNRTGCRFGPRAIRNA-----YGAGRLSYEQDNSYKVANLKGMDMGDIGVV---------LGYVEETMELIRESVRKVLDAGAVPIVLGGDHLIAYAELKAYSEKYGKVAMVHFDTHEDTWD-YGDRIKYNHGTPFRNAIEDD--------------ILDTEHSIQVGIRSGDTYRIKYAQDHGMKVITARELHKIGIKETCRRIKEQV---GDAKVFITFDIDFLDPVYAPGTGTPMPGGFSTYEACEIIRNGLAGLDIVGFDLVEVMENYDPAGITAINAVAILKQFVILLSKKKAE........... 318
257 2.000e-81UniRef50_A0A1F9YCD0 Agmatinase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1F9YCD0_9BACT  ali  21  1..................................................................MHFGQGVIPKKYLKYDAARAAILSVPYEGTVSYGKGTSKGPRKIIEASRYLEFFD-----EELGLLNYQAG-LTTC----------PPLKPAATPQKMVEAVRQSARQLLSDEKFIIMLGGEHSISYGLYLALRERVRDLSVLQIDAHADLRTTF-------QGSPFSHACVMRRIDESCP------------RTVQVGIRSFCAEEALFIRQKKKHLFMAKDIH--GKTDWFDQAIRRLS----RNVFLTIDIDGFDPSLVPHTGTPEPGGLFWYETLAFLKRLFEKRNVIAFDLVELAP-------TSFSA---------PSDFLAARLVYRLLGYKF. 283
258 2.000e-81UniRef50_A0A2H5VUV3 N(1)-aminopropylagmatine ureohydrolase n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5VUV3_9BACT  ali  18  24...................................................................................PKIGILPIPYDLTTSYQPGARRGPIAILEASTHLETYDEELEWDPSAFLQLETLAPV----VPDTSGP----------EATMERIYGVACEALKTHDFLVGLGGEHSVSFPLVRAVKEKHPHVGVLQLDAHSDLR-------ASFEGSPYNHACVMHRVLDLGVP------------IAQVGIRSLTAEEHELIKSGKVTTVFASEAAQRP----VHDFLPKVLAALPDEVYITVDLDAFDPAIMPATGTPEPGGLSWYRALEILREVAKSKRIVGFDVVELAP----------------FPGLVAPDFLAAKLVYKLLAYSF. 293
259 2.000e-81UniRef50_A0A1D1VD08 Arginase n=2 Tax=Parachela TaxID=210572 RepID=A0A1D1VD08_RAMVA  ali  26  33.................................................................................PNTKIAGVFGALMNRGQGKEGVRDGPNAIREAGLLTLLKDCG-------------ISFRDYGDVEISDDPWKKVKYSRTVAGGCKQIADKVQTIIRENGVPIMLGGDHASAIGSISGHLEIHGPLAVLWIDAHADINTPLTTATGNLHGCPVSFLLKEMSPYIPRPGFEWQQPCLTADRIAYIGLRALDPDELFVMDKLKIKYFPMQDVDKLGVQKCVELALQHINPNNDLPLHLSFDIDALDPSVAFSTGTPAMGGLTLREGLQIVEYVRSTGQLSAMDLVEVNPTLGNGYQRA------------KTMEAACAIIAGALGK... 348
260 2.000e-81UniRef50_A2QBG2 Aspergillus niger contig An01c0490, genomic contig n=149 Tax=Eukaryota TaxID=2759 RepID=A2QBG2_ASPNC  ali  17  24.............................................AHVQELKERWGEDWAFSG-ITTFGHLEHVHCLTNPDTPFDIGIIGTPFDTAVSYRPGARMGPRAIRTASARHIPS--RAFHAAAQINPYQWAKVLDCGDIPVT--PFDNAVAIHQMTEAYRELGSRRTTTGTGKPKLITLGGDHLVALPALRALRESYGPMALLHFDSHLDSLHPDRYPSAWSMQSQFNHGSV--------FWNAMKEGLISNSSSLHAGIRGNSFQDLDDDDKQGFLRIAADEVDSIGAAGIIDRIHQHIPK--DQPVYMSIDIDVLDPAFAPGTGAPEPGGWTTREMIKILRGVMD-LNIVGADIVEVAPAYDPGGETAYLAANLAYELVTGMV................ 361
261 2.000e-81UniRef50_A0A125STW8 Guanidinobutyrase n=9 Tax=Bacteria TaxID=2 RepID=A0A125STW8_9CYAN  ali  17  26.......................................................................FARLPYVQDPADVDVAIVGLPFDTGATFKVGARFGPEAVRGASALLRPYNPELD-----VMVFETLSCVDYGDAPVVPGF---------IEDSLDAIARTIQPLAEAGVIPLSIGGDHSVALGELRALAAVHGPLALVHFDAHGDYWDSY-FGHKYTHGTPFRRAVEEG--------------LIVPEASVQLGMRGYDSDDLDTPRRAGFTVLTTTQLMRHTPEEIGALVREKV---GDRKAFLSFDVDFFDPAFAPGTGTPEVGGPTSFQGLGYLRA-CTGLTWVGGDVVEVLPAMDHSQVTAHLGAQIGYEFLSLVA................ 314
262 3.000e-81UniRef50_K9NHJ4 Agmatinase n=239 Tax=Bacteria TaxID=2 RepID=K9NHJ4_9PSED  ali  18  13.............................................................LPFVGHCTFGKSPVCTDWDALDADVAVLGVPNDMGTQWRSGARFGPRGIREASTLFSFGHAGAYDHEDDVMYLTDVRMVDVGDADIVHT---------DMATSNKNTEYAVRKILDAGVMPVVLGGDHSVHAPVIKAF-EGRGPIHIIHFDAHLDFVD-ERHGVRYGHGNPLRRASEMNHIVG----------------MTQMGIRNVSRDDYEAAHEAGSKILSVRDVRRLGVEGVLALIPQNI------NYYITIDIDGFDPSIAPGTGTPSHGGFLYYEVLEIIQALAKRGNIVGMDLVEVAPVYDPTGMTSILAAQLLLNSIGFIVRAAAE........... 327
263 4.000e-81UniRef50_A0A1G2QQ84 Agmatinase n=2 Tax=Bacteria TaxID=2 RepID=A0A1G2QQ84_9BACT  ali  23  20..............................................................................QDYEKAKVVVFPVPYEATTSYISGTKWGPKAMIEASRHLELFDIELKRDVSRIGIFTLPEL---------------SCSKNSPREAVKEIKKVVTQLLKDKKFVLMLGGEHGITPGSVAAFKEKYRDLSVLQIDAHSDLRNE-------YEGTNFSHACAMRRVRDLGVAVTA------------VGIRSQEESEADYIRKEKIKIFYAPKIP-----------VQKIISTLSKNVYLTFDIDGLDPSIMPSTGTPEPGGLGFYEVLNLIKQVAKARRIVGADLVELSP----------------LPGMVAPDFLAAKLAYKIIGYSV. 287
264 4.000e-81UniRef50_B9WIN5 Arginase, putative n=4 Tax=Saccharomycetales TaxID=4892 RepID=B9WIN5_CANDC  ali  20  21......................................................KWGGLWPFQGIATFAHLEHFQCLIESEKQFDIGIIGVPFDTAVSYRPGARFGPRAIRDASQRQ--NNLRGFNPKALFDPYQWAKIIDCGDIPVT--PMDNSAAYKQMSEAFKDLTN--KKSLNNTEIPIALGGDHSVLLPHLRALHRIYGPLNVIHFDAHLDTWKPNKYPTDINHGSML---------------WKAYEEGLTTKHNIHVGVRTSGLEDLQDDDEQNFVRIEADDIWLKGPQWVVDKILTTIPK--DTATYISVDVDVLDPGFTSGTGTQEPGGFLPRELIYLLRSI-EGLTVVGADVVEVSPAYDIAEITATNGAQIAYEILTSMVK............... 344
265 5.000e-81UniRef50_A0A0L0NGJ5 Asparagine--tRNA ligase, cytoplasmic n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0NGJ5_9HYPO  ali  17  41......................................................KWGYEWGFSGIGTFAHLEHVKCLMDPSVAYDIAIIGAPFDTAVSFRPGARFGPRAIRQASSRQTAF--RGFNPRASINPYQWAKIIDCGDIPIT--PFDNNIAREQMTQALQLGQRRAVSALSXKPKLMTLGGDHSLTLPALRALKEIYGPVRVLHFDAHLDTWNPNAYPS-YWGATQFTHGS--------MFWMANQEGLLSNSSSVHAGLRTRLSGDAEDDSSQNWVRFSADDMDEIGTAGIIAGIMDTL--GTEDPVYLSVDIDVLDPAFAPGTGTPEPGGWTTRELIRVLRGI-EGLNLVGADVVEVSPAYGRGEETALAAAQVVYELLSSMVK............... 382
266 5.000e-81UniRef50_A0A0F2NG66 Agmatinase n=1 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2NG66_9FIRM  ali  20  16................................................................................YQKSRAVILGAPMDQTVSFRSGTRNGPRQIRSVSEVLEEYSPSLD------RDLAEFAYTDLGDVLIVPGK---------LEENLERIAKSADKVFRDGKLLIMLGGEHLVTLPAVKCAASLHSELSVIHFDAHADLR-------EQYLGMSLSHATVMRRISE----------VIGGDKIFQFGIRSGTREEFAYARA-NTNIYP--ELNTENIVRVAQDLK-------GRPVYISLDIDVLDPAYAPGTGTPEPCGCSPDQLFSALEALS-GLNVVGFDLMEVCPPYDQSERTAITAAKLVREAILL.................. 281
267 5.000e-81UniRef50_A0A146VNK5 Agmatinase, mitochondrial (Fragment) n=17 Tax=Euteleostomi TaxID=117571 RepID=A0A146VNK5_FUNHE  ali  18  9..................................................................................................FHTLHRFGPRQIRGESALLRAYNSG-----TRAAPYESLMVADIGDVNV---------NMYDLKDTCKRIREAYRKILATGCIPLTMGGDHTIAYPILQAVAEKHGPVGLVHVDAHADT-SDVVLGEKIGHGTPFRRCVEEG--------------LLDCRRVVQIGLRGYSPDSYEWSRAQGFRVVQVEECWFKSLAPLMSEVRAQMAS---GPVYLSFDIDALDPGFAPGTGTPEIAGLTPIQGVEIIRG-CRGLNLVGCDLVEVSPPYDTTG-TGNVAVFL......................... 260
268 5.000e-81UniRef50_D5SKW9 Proclavaminate amidinohydrolase n=2 Tax=Streptomyces clavuligerus TaxID=1901 RepID=D5SKW9_STRC2  ali  18  113...............................................................PRYAQPATFMRLRHRPDPIGHDVVVVGAPYDGGTSYRPGARFAPRAIRHESSLIHGVGI-----DRGPGVFDRIDVVDGGDIDLSPFSMDLAMDTATV---------ALTRLLERNDAFLMLGGDHSLSLAALRAVHARHGRVAVLHLDAHSDTNPPVYGGT-YHHGTPFR--------------WAIEEGLVDPERLVQVGIRGHNPDSLDYARGHGVSIVTAADFTRRSPRGIAEQIRRTV---GGLPLYVSVDIDVVDPAYAPGTGTPAPGGLSSREVLTLLDVVGQLRP-VGFDVVEVSPAYDPSGITSLLAAEIGAELLYQYARA.............. 411
269 6.000e-81UniRef50_A0A2M7T598 Agmatinase n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T598_9ACTN  ali  17  1....................................................MKQANLVTEARMYTSVPFNFLGIDEHNSFEESKVVVVPIPYDSTSSYRAGTREAPVAVINASRQVEFYDEELETE-----IYDKVGIHTLNEI---------MPNMEGPRHQIEVVRRVLLDMMEAGKFPVTIGGEHSITLGAVQAVKDFFPQVSVLQLDAHTDLR-------KEYEDTQYSHACVMRRIFDEGV------------RIAQVGIRNSSKEETRFIKANNIFSVSARQ-YRYGYYGI-----EEIVDALSDDVYITIDMDVFDPSEVPAVGTPEPGGLSWYEVLDILREVTFHKRVVGFDVVELCP----------------IPGNPASDFLTAKLIYKLIGYCF. 299
270 6.000e-81UniRef50_A0A2H6EN77 N(1)-aminopropylagmatine ureohydrolase n=17 Tax=Bacteria TaxID=2 RepID=A0A2H6EN77_9BACT  ali  22  18.............................................................................HTSFNNSKIVILSVPLEKTVSYGKGTAKGPREILKASHFVEFYDEELGKELCFSK----------GICTLKPLDFENQR----IETALQKIYKTVKFLINENKFVVTLGGEHSLSISPIKAYLEAYTNLSVLQIDAHSDLRDT-------YENSKHSHACVMARVAELT------------KNIVQVGIRAQSKEEAEFVKKNKINTFYARDICTKKFR---KDWQKKAVSKLKKNVYITFDLDGFDPSLLPATGTPEPGGLFWNETMSLLKLVGKEKNIVGFDVVELAPSKYH----------------PASNFVAAKLVYKILNYAFM 295
271 6.000e-81UniRef50_A0A0D5L6C9 Agmatinase n=54 Tax=root TaxID=1 RepID=A0A0D5L6C9_9BURK  ali  20  11..............................................................MPRFAGIPTFMRVPFARDPQDYDIALAGVPYDGGVTARPGARFGPREIRNMSTM-----MRAIHHVMRFNPFEACRVADIGDVPFE--------HLYDIERAHADIRAFFEPVFRAGKRALIAGGDHSITFPIFQAIAQATKPLALVHIDAHTDTWDAYK-GSKFTHGAPFRRAVE--------------AGLLDPTRTIQIGIRGATDEGWRYSLDHGMRVVFIEEFEALGPAAIAAEARRIV---GDMPVYLSLDVDGLDPVFTPGTGTPEIGGLTTRETLALLRGL-DGLNWVGGDVVEVSPPYDPSGNTALVAATLMYEMLCLFAR............... 313
272 6.000e-81UniRef50_A0A1F8TQ94 Arginase n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8TQ94_9CHLR  ali  27  6..................................................................................................NRRGVDMGPSAIRYAGLHQRLEQLGFEVKDRGNAPFTAKEIRDLS-APITDPRTPPAHHAAEIVRVVSELAASISEIERAGALPIVIGGDHSIGMGTLAGIARAGRRPGVIWMDAHGDINTPETTPSGNVHGMPLAVAVGLA----ARPFPTELRGSVRGDHTALLATRSLDEGERENIRRAGVTAITMADIDRLGMSAAMERAIDV--ASKGEGIHLSLDMDAIDPDEAPGVGTPVRGGLTYREAQLAMEMLAASGKLRSIEVAEVNPILDRENRT---------------AQLAVELIASALGQTIL 308
273 6.000e-81UniRef50_A0A2M7SJW3 Agmatinase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2M7SJW3_9DELT  ali  19  37.....................................................................................VVVLPIPYDQTVSYRAGTREGPRAIINASAQIELYDQELNSEPYRVGIHTLKELEP---------------DMSGPEGMFKRVYDTVSLFNKKKKLLIMLGGEHSLSVGAVKAFSEEYKDLSVIQIDAHADMRDTYCD-------TKYNHATVMRRV-------------LDYASTVQVGIRSLSKEEMEFIETRRLSVFFEKDVVKG--EGWMEEMISHLS----QHVYITLDLDVLNPGIMPSVGTPEPGGLDWHELLNIIRKVAENRDIVGFDVMELCP----------------IPGLIAPDFLAAKLVYKMIGYSL. 300
274 7.000e-81UniRef50_A0A1L9SLM0 Uncharacterized protein n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A1L9SLM0_9EURO  ali  18  32.................................................EEARQKWDFFWGYSGISTFGHLPHKRCLVEPYERFDIGVIGVPFDTAVSYRPGARFGPRAIRAASRHLPSRGFSTYSGLNPY--MSWAKVLDCGDVPVN--PFDNDLALRQMTEALEELSAKRQTTSDREKVPLILGGDHSIALPALRAMNKAYGPVAVVHFDAHLDTLHPSSYPSEFTHGSMF--------------WQAGNEGLVLNDSSIHAGLRGDDWADYIRDDEQGFLRLTTEDIDDIGPQGIVDRIIERV--GTERPVYLSIDIDVLDPSIAPGTGAPEPGGWTMREMNRIIRGM-DKLNIVGADIVEVSPAFDHTENTAFAAAQLGYEIILNWVKKGLD........... 403
275 8.000e-81UniRef50_A0A1V6JGP7 N(1)-aminopropylagmatine ureohydrolase n=4 Tax=Bacteria TaxID=2 RepID=A0A1V6JGP7_9BACT  ali  21  19.....................................................................................IVVLPIPYDGTSTWVKGSDKGPEALLEASANMELYDIETDSEVYLHGIHTAPAV----------------SENKSPEDMVQAAEKEALKYIDSGKFLVTIGGEHSVSIGPIQAHAKRYKNLSVLQIDAHTDLRD-------SYQGSKNNHACVMARAQELCP-------------IVQVGIRSMDSGEMERLDRN--RVFWAHHIARG------DEWMDKAIDLLTDNVYLTVDLDGFDPSILPSTGTPEPGGLQWYQALSFLKKLVERKNLVGFDIVELCPPYEKS-----------------SDFLAAKLLYKILSYKF. 279
276 8.000e-81UniRef50_A0A1W9MI09 Agmatinase n=1 Tax=Candidatus Altiarchaeales archaeon A3 TaxID=1933927 RepID=A0A1W9MI09_9EURY  ali  20  17.....................................................................................VCIFGMPFDSTTSFKPGTRFGPNAIRDASYNLEFYSMALE------RNIGDIKIFDAGNIGFHTKPQD----------AISEISKRTNDLLKNDKFIVGLGGEHTVSYGIAHAMKEIYKDIAVIHFDAHADLRTEYDSE-------KFSHACVMNLIGSE----------IGFENIYQFGIRSGEEEELKFAEKTNF--YPLHKYDTTQILEILDDL------NISKRTYLTIDIDVLDPAFAPGVGTPEPGGITSNDMFKILNSL-KKFDVVGFDVVEVNPMIDVSGITAMAAAKIVREGI.................... 276
277 9.000e-81UniRef50_A0A139AWW5 Arginase/deacetylase n=2 Tax=Fungi TaxID=4751 RepID=A0A139AWW5_GONPR  ali  19  1......................................................................MPLLKCIDENAEKFDIGVLGIPFDTAVTYRPGARFGPAAIRTGSRRIQYAK--GYDTNWGFSPFQWAKVVDCGDLPITG--FSNTKAYDQMYRGYLHLITRPPRHTFPGVVTVTFGGDHSISYPILKALHEVYGPIAVLHFDSHLDTWASATKEEELHHGTMFWHA--------------WRDGLTQHGKNVHVGIRTVDEGDYADDKKFGWKIIEFVEYYKLGIDGIIREIKETI---GEAPCYLSLDIDVVNPGEAPATGTIEPGGFLAREIQAILRGL-NGLNIVGADVVEVAPVYDHAEITATLAANLAFDMLATMVK............... 310
278 1.000e-80UniRef50_A0A132HTU6 Arginase n=537 Tax=root TaxID=1 RepID=A0A132HTU6_9BURK  ali  26  3....................................................................................PVTLIGAPTDVGASIRG-ASMGPEALRVA-------------DIAGALVRNGLDVTDLGNLNPNLPPTDGVRHLPEVVAWNRLVMDAAYQALATGQLPLLMGGDHCLAIGSVNAAARQGKKLLVLWLDAHADANTGSTSPTGNTHGMPVACLCGDGPAPLVSL--GGVTPATSPRNIRQIGIRSVDAEEKKRLRELGLTVYDMRYIDENGMRATMEQALAGI--DGDTHLHVSFDVDFLDSQIAPGVGTAVRGGPTYREAHLALEMIEDTGALGSIDVVELNPARDVHNQT---------------AELVVELLESLFGKSTL 300
279 1.000e-80UniRef50_G4D1A2 Arginase n=2 Tax=Peptoniphilus indolicus TaxID=33030 RepID=G4D1A2_9FIRM  ali  32  24...................................................................................................RQGSRFAPDTLRLLGLIDKIKRLGLDIDRDFNLDVKNG--------YKLEKSEDNLNHLDMILEQLDILFESVKNQMEEGRLPLVIGGDHTTVLGTMKGVLNNYPNAGLIYFDAHADINTTETSPSGNIHGMPIAALIGMGDERLKAVGGNLT---LNPENIVYVGLRDLDNGEKEILKENNIKCYTIADIDQLGMGRVMDEALEYLKN--TDGVHVSFDVDCLDPIFAPGTGIHLFGGLNFREARLGLEKCHASGKVLSLEFVELNPLLDYDNKTAELLIELICAGLG................... 299
280 1.000e-80UniRef50_UPI000C209304 arginase-1-like n=3 Tax=Onthophagus taurus TaxID=166361 RepID=UPI000C209304  ali  28  15....................................................................YPKRIRFFSDKIRESTYVGIVDAPVEEGQKKRGVSK-APQVLREAGLIQKL------KEDCNVSVKDYGAISFDGNIKSSSKKLPNMLNYERVVGYNKNLSEIVQKVINDGRICLTLGGDHSIGLGSVSGHCKAKGNTALIWVDAHADINTNKTSDSGNIHGMPVALLAQDLIPYWSNLPFMDWHHSLLPKNIAYIGLRSIDPYEEFLIQKMGIVCYDIYDVQKYGIDSVINESLRKIDPDATKSIHLSFDIDALDPSDAPSTGTPVDGGLLLREGIYIASTIHKTGRLGAMDLVEVNPTLGDE------------EDVQKTINSALQVIAAAFGY... 335
281 1.000e-80UniRef50_A0A1F9GW69 Agmatinase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_43_9 TaxID=1797867 RepID=A0A1F9GW69_9DELT  ali  19  2.............................................................SSLININNNFLDLPPELSTYGSSRVAVLPIPFEKSVSYGGGASKGPDAIIQASGQVEWYDEEINAEACQVGIATAAPVV--------------CKNITG-EEAVKEIAKRTSKLISDGKFPVGLGGEHTVTAGCVMGMLKECKDFGVLQLDAHADLRD-------SYQGDRYSHASVMRRVREFGLPIAA------------VGIRSLCQEEVEYIKREKIAVFYDRVVNKDGWP------LEGVINALPKRVYITIDVDGFSPSVVPATGTPEPGGLPWYETLSFLKQIFAQKDVIGLDVVELAP----------------IEGLHFADFSMAKLIYKLIGYRFI 291
282 1.000e-80UniRef50_A0A163JWG2 Uncharacterized protein n=1 Tax=Absidia glauca TaxID=4829 RepID=A0A163JWG2_ABSGL  ali  20  11.............................................................FMGLGTFAHLPYERCLSNSAAPYDIAVVGIPFDTGTSYRPGARFGPSGIREGSRR--TIVAGTYNVPLSIDPMTGLTMVDCGDIPVT--PFDNDKAMEQIFDGYRHPSFTYTNSYHYTPRLLTLGGDHTIVLPILRALHHHNGPVSVIHFDSHIDTWTPYTSPNLN-HGT--------------YFYFAAKEGLISPDANIHVGIRSHLPEDYADDARCGFQLVEAAEIDVIGTQGIINRIRKTV---GDNDVYLSLDIDVLDPSFAPATGTPETGGFSTRELRRIIQGL-EGLNLVGADVVEVAPAYDTNQLTAMAAADII........................ 325
283 1.000e-80UniRef50_K4LDU9 Agmatinase SpeB n=16 Tax=Bacteria TaxID=2 RepID=K4LDU9_THEPS  ali  18  6...................................................................CVREWQYLAAKGSYKEARLVLAGLPLELTVSFRPGTREGPQAIRAASQGLEEYSPYLREDLNDHLIF------DCGDLALP---------FGNLQVAFQRIEALCRVLLADAKIPVFLGGEHLITFPVVKTLAEAYSGLKVLHFDAHADLCDD-------YLGEKYSHATVIRRVCE----------IVGAGNVYQFGIRSGTKEEFEYGRSC--TVFYPFEILP-GLESCLQ-------SLEGHPVYVTVDIDVIDPAYAPGTGTPEPGGVTPQELFRVFE-LLEGCRIVGCDFVELAPVYDRSGITSLLAAKLVREALLAFSR............... 287
284 1.000e-80UniRef50_A0A1Y5R7U2 Guanidinobutyrase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A1Y5R7U2_9PROT  ali  17  3...................................................YRYPEFADPKVRPRYTGIPTFMRTPYAEDWTGLDIGLIGVPFDGGVTNRPGARHGPREIRNQSSLIR-----RINHATKIDPYALCRIADLGDAWVEQPF--------ELKGAHDEIAAFYKAVQAAGIVPVSAGGDHSVTLPIFRAIA-ADRPVGMVHFDAHCDTGDDY-LGSKFHHGAPFRRAVEEG--------------LLDPKRTIQIGIRGSDLGIWSFSHESGMRVIYIEEFHEIGVKGAIAEARRVV---GDGPVYVSFDVDGLDPVYAPGTGTPEVGGFSTLEAQLMIRALGD-LDIIGGDVVEVAPPFDPSGNTALVGATIMYEILCIAA................ 311
285 1.000e-80UniRef50_A0A0F9QK96 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0F9QK96_9ZZZZ  ali  20  1...........................................................MDEKPFAGIKTFLKQPIYTPDKDDGGIGIVGAPFDLGTSNRPGARFGPDAIRRASAMLC----EGDDPHYKLNPVEVLDIWDCGDIDTSV----------DIAACVEEIELDIHTWGLEFDQLVTLGGDHTITLPILRALHAKHGPVRLVHFDAHCDTW----VGDGNYHGSPFYYAI--------------NEGLIIPEESTQIGIRSIDSEHYKFAEDAGMQIFTARDVHEMGPSEIAHRTTKK---GHWTPTYLTFDIDSIDPSQAPGTGTPEVGGIFTWQALAILDDINTSLDWVGMDVVEVAPAYDVSEITSLTAATIIWHYLCILSQ............... 300
286 1.000e-80UniRef50_A0A1Y5TLV9 Agmatinase n=13 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5TLV9_9RHOB  ali  22  55..........................................................................................VPFDQAVTNRPGTRLGPRAIREASTLQAFDAPYG----WGYSPLEEFDVIDYGDLAFD---------YAKVADFPQALTDHIAPILAAGAGTLVLGGDHFISFPVLRAHAAKFGPLSLIHFDAHSDTWADD-DMTRIDHGTMF--------------YKAVKLGLIDPARSVQIGIRTDNPD------TLGVNIIDARAVHERGASWVASRVKNIV---GNHPAYLTFDIDCLDPAFAPGTGTPVWGGLASWQAAAILRELA-GVHLTGGDVVEVSPPYDVGNATAVAGAHVAMEILAL.................. 315
287 1.000e-80UniRef50_F8JCJ5 Agmatinase n=3 Tax=Hyphomicrobium TaxID=81 RepID=F8JCJ5_HYPSM  ali  19  26.............................................................SEQTYSGTHTFLRSPRVKQAKAGDFAVLGVPLDIATSNRPGARLGPDAVRCASAQLA----ELKAYPGGFNPLSYVNVVDLGDAWLDYGFPQTIPA---------AIEDAATKVVETGAFLCSLGGDHFISYPLLKAHAKVHGQLTLIHFDAHTDTWTPRVGRDGSVHGTMFAQAI--------------DDGLIDPAKSSQIGIRTW------VDDPKGMNIFDNMVVADKGASAVASMVKA---LAGDNPCYLTVDIDCLDPAFAPGTGTPVTGGLMPRELLAMLRQL-DGLKIVGCDVVEVAPSYDQGGVTALAAATVVYEQACRVAR............... 322
288 1.000e-80UniRef50_A0A183L8S4 Arginase n=9 Tax=Digenea TaxID=256429 RepID=A0A183L8S4_9TREM  ali  30  68......................................................................................................................................DGIQLIDCGDVETEDPQRFGMKWSRSFSLTTLKIAERVEELMKQKSTPLVIGGDHSMATGTILGHAKAKPDLCVLWIDAHGDINTPLNSTSGNIHGMPLSFLVKELQDQIPWLDFEGIKPCLNASNIAYIGLRDLDAYETHDIRKHGIAYFTMLDVDRMGIEAVIKEALQAVNPRLEKAIHLSFDIDALDPLIAPSTGTAVPGGLTLREGLRICEEVSATGKLSIVELAELNPLLGSKEKTQSSAVQILRACLGHC................. 345
289 1.000e-80UniRef50_F0T7F0 Agmatinase n=2 Tax=Methanobacterium lacus (strain AL-21) TaxID=877455 RepID=F0T7F0_METLA  ali  18  1......................................................MNFNDIESRFPYIGVSTFYGYPNSKDLNETDVAIVGVPFDHGTTNRPGARFGPRSIRTASQNYGIYEFGAFDSELKRNILGGVNIVDYGDVPILPTHTK--TNMKMINSTF-------KKIVDAGVFPVAFGGDHTVTYPIVKAFKK---PLDIVHFDTHLDFVD-GTENLKFSHSNPLKRVSEIENI----------------NNITQIGIRGFTDENYDESKNYGSKIITASEVMDRGTAWVLDQIPE------SDNIYVTLDIDVLDPSIAPGTGTPEPGGLTYNQLKDILTNLTNKGEILGFDLVEVNPLFDLSEITSLTAARLCFDFLGSI................. 305
290 2.000e-80UniRef50_A0A2H5YU77 Guanidinobutyrase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5YU77_9BACT  ali  22  83...................................................................................QDVAFVGVPLDTGTTFRSGTRWGPEAMRRISSL-----SGGANLVLGVDLVESLTMVDVGDVSVIP---------ANIEKSFDQIDKAIGYIIERGVFPVVLGGDHSIGYPDIRGLARIDGNVGIIHFDRHSDL--SEYNMDERMHGTPFFHAT--------------NIPNAPPTNLVQIGIGGWSRDGLRNARERKATVITIDDIDRYGIERICEYALE-IAWKNARCVYLSFDIDCMDPAFAPGTGTPEPGGLLPREVFQMLRLIAREG-LVGMEVVEVSPPYDVADVTSLLGTRVIMEVLGTLV................ 361
291 2.000e-80UniRef50_E8T4C8 Agmatinase n=3 Tax=Desulfurobacteriaceae TaxID=558314 RepID=E8T4C8_THEA1  ali  18  5..............................................................................CAKEKGKIAVVGAPYDSTTCFRPGARFGPDGIRNFSHNLEEFSPALN------KTLEELQFCDLGNVELPAPP----------EQMVEHLYSFVKEV----ELPVVLGGEHSVTYPVVKALKERYGSLTVIHFDAHADLRDEYS-------GTPYSHACVMRRVAELG------------CTVYQVGIRSGAREEFLYRETSPF-VFDVE----------LSELP-TLFSSLEEPVYITVDIDYFDPAYAPGTGTPEPGGASPLEFFTTLYKLPA-VKLVGFDLVEVAPPYDPSGITQALGAKVVREVM.................... 261
292 2.000e-80UniRef50_I4Z1M5 Agmatinase n=5 Tax=Bacteria TaxID=2 RepID=I4Z1M5_9RHIZ  ali  23  71.....................................................................................VALVGVPMDLGVTNRNGSRFGPRAVRTIER------VGPYDHVLRCAPFSKARIADIGDVPMQSRY--------DLALCHADIEAFYKRLVEAGVRPLSVGGDHSISSSILKAVGER-QPVGMIHIDAHCDTAGPY-EGAKFQHGGPFRLAV--------------LDGVLDPERTIQIGIRGGAEYLWEFSYESGMTVIHAEEVPRIGIEALIERTRAVV---GDGPTYLSFDIDSVDPGFAPGTGTPEVGGLTPREVLELLRGL-KGINFVGGDVVEVAPQYDATTNTAHVAAQVLFTILCLMV................ 342
293 2.000e-80UniRef50_A0A0P1INP9 Guanidinobutyrase n=33 Tax=Bacteria TaxID=2 RepID=A0A0P1INP9_9RHOB  ali  18  46..........................................................................................IPWDGGTTNRPGARHGPRQLRDFSTMIR-----AMNPVTGVAPFSLVNCADLGDV---------APNPVDIGDTLERVTAFYADIHDRGIAPLTAGGDHLTTLPVLRALAKS-GPLGLIQFDSHTDLFDTYFGGHKFTHGTPFRRAVEEG--------------LVDPKRFVQVGIRGYNTEDIEWGEAQGIRIIRIEELFDRGIDDVLAEVRSIV---GTAPTYCTYDIDFVDPTYAPGTGTPEIGGPNSFQAQQVIRKMA-GVNLVGADLVEVAPPFDPEGGTAWLGISLMFELLCVLAQAV............. 318
294 2.000e-80UniRef50_A0A1F9HT98 Agmatinase n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_46_8 TaxID=1797879 RepID=A0A1F9HT98_9DELT  ali  19  6....................................................................PHFMGLPAEETQYKNSPVVIIPVPWEKTTSYMKGTGKGPQAIIAASHQVEFYDAELKKENWKPGIHTFSPV-DFG--------------ASDSKKALEAIEKTVGQVLDDHKFPIALGGEHTLTAGCVAAAAKRYPNLSILQIDAHADLR-------ESYDGTPYSHASAMRLC------------LKSVKKLVGVGIRSVCVEEVEFAKQHGVTLIYDHE--KQTDPNWVTKALQ----GLTDDVYLTIDVDGFEPNLIPATGTPEPGGLTWYEGLKLIRSVFQKKNVVAADVVELLP----------LASQ------HASDFIAAKLVYKLIGYR.. 287
295 2.000e-80UniRef50_Q9K6B9 Agmatinase n=96 Tax=Bacteria TaxID=2 RepID=SPEB_BACHD  ali  21  29..........................................................................................MPMDWTVSFRPSSRFGPNRIREASLGLEEYSPYMDKH------LEEVAYFDAGDMLLP---------FGNPQRSLEMIESYVDKLLADQKMPIGLGGEHLVSWPIFKAMHKIYPDMAIIHIDAHADLREE-------YEGEPLSHST----------PIRKACSLIGPENVYSFGIRSGMREEFQYAKDSGM---YMAKF------EVATPLKEVLPKLAGRNVYVTIDIDVLDPAFAPGTGTAEAGGISSKELLEAIVAIAHSVNVIGADLVEVAPAYDPSEKTPIAASKFVREMLLGWV................ 289
296 3.000e-80UniRef50_A0A2B4RYE8 Agmatinase, mitochondrial n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2B4RYE8_STYPI  ali  17  30...............................................LLTSKKFNSPLTPDEVPRAAGFPTMLRLPMQSTADGLDACFLGIPMDNGSYHRTGARMGPRQIRCESCLLRP-----HNTHTGAAPYESLMVADVGDVSV---------NVFNIEANINIIHQHVASIISDGCKPLIMGGDHTISYPILKAMKEKYGPVGLVHLDAHPDT-SKTTFGEKISNATPFRLA--------------AEEGLLDCERVVIIGLRGSSPIDYEYGRNLGFKIVPAKYCWYKSMAPLMAQVRELM---GDAPVYITFDIDAVDPGYAPGTGTHEIGGLTSIQALEIIRG-CRGMKIVGGDLVEVSPMFDVQGATSILAANFLFEMLCVLPGVVYK........... 348
297 3.000e-80UniRef50_A0A1Y0EBE9 Agmatinase n=13 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y0EBE9_9RHOB  ali  20  53..........................................................................................IPFDQAVTHRPGARFGPRAIREASC-LQPYDPPYGWD--GFDPLSEFSIVDYGDMAFDYASVAGVPAL---------VEAHIARILAAGAASITLGGDHFITLPILRAYAAKYGPLSVIQFDAHSDLW-PDEDMARIDHGTFM--------------YKAVKLGLVDPARSVQIGIRTQCDDY------LGMRYIDARSCHARGVADVVAEMRGIV---GDHPTYVTFDIDALDPAFAPGTGTPVWGGLASWQAAALLRDLA-GINMVGGDIVEVSPPYDTTGATAIAGAHVAMELCCLA................. 315
298 3.000e-80UniRef50_R8BEV8 Putative agmatinase 1 protein n=8 Tax=leotiomyceta TaxID=716546 RepID=R8BEV8_TOGMI  ali  22  34.....................................................................................................................STYSIGGYNVPLETNPFSWATVLDCGDIPVTS--YDNTYALQQIEEGHFELLSRVTAAKEKGPRIITLGGDHTITLPLLRSINRAYGPISVIHFDSHLDTWRPKVFGGSPSEVASINHGT--------YFFHAAMEGLLSNHSNIHAGIRTTLPSDYDNDGYCGFEIVEAREVDKIGTDGIIKKILDRV---GDSPVYLSLDIDTLDPAFAPATGTPETGGWTTRELRTIIRGL-ESLNIVAADIVEVAPAYDTNELTTMAAADALYEIMSIMVK............... 308
299 3.000e-80UniRef50_UPI000D7FEAFF Arginase/deacetylase n=1 Tax=Tilletiopsis washingtonensis TaxID=58919 RepID=UPI000D7FEAFF  ali  19  53.......................................................................PWTSCLHNEQVRFDVALLGMPFDGGVSYRPGARFGPKAIREASRRQRTNSWSL---EYEQAPYEALFFMDCDDVPIT--PYDPAVALAQMEAAYVTLLQRVSRETERGQRVIVLGGDHTVVLPILRALHKTYEPIAVLHFDAHLDTWKVYNSPSRINHGSFFARA--------------ADEGLIDRNASVHAGLRTNGPMDIRHDDQVGFERVMTSDLDLLGREGVIERIRSRI---GDRPVYLSIDIDVLDPSAAPGTGTLETGGWTTRELHGILRGL-RGLNWIGADIVEVSPPYDHAEITAYAASDLVFEIANLFA................ 371
300 3.000e-80UniRef50_A0A2C5WUX4 Guanidinobutyrase n=9 Tax=saccharomyceta TaxID=716545 RepID=A0A2C5WUX4_9PEZI  ali  17  51......................................................KWGTDWGFAGIQTFAHLPHVKCLVEDKYPFDIGVIGVPFDTSVSYRPGTRFGPRALRSGSSRQTPF--RSFNHRAGINPYSWARIVDCGDMNVS--PFDNGLALRQMTEGYAELSKRTAPVHTGGKKLVSLGGDHSIALPALRALKSAYGPINVLHFDAHLDTWHPAKYPSVWVEAFPQSFFT-----HGSFFWMAHSEGLIANG-SVHGGIRGVDDADFRDDTEQGWFRILADDIDDIGVEGVINTIMERL--GTENPVYLSVDIDIIEPGLAPGTGTPEPGGWTAREFIRILRGI-EGLNVVGADIVEVSPSYDDAGETALLGAQIAFEIITSMVKKGVEAAGAA...... 400
301 4.000e-80UniRef50_Q5WB32 Agmatinase n=349 Tax=Bacteria TaxID=2 RepID=Q5WB32_BACSK  ali  21  29..........................................................................................MPMDWTVSFRPGSRFGPARIREASLGLEEYSPYADKH------LEEINYFDAGDIPLP---------FGNAARSLDIVEEYVDSLLADGKFPLGLGGEHLLSWPIFKAMYRKYPDLAIIHIDAHADLR-EQYEGEALSHSTPIRKACE----------------LIGAENVYSFGIRSGMREEFAYAKEAGMHLYKFD---------VAEPLKNVLPHLSGRPVYITIDIDVLDPAHAPGTGTAEAGGITSKELLEAQMLLSQDIQIVGADLVEVAPAYDPTEQTAIAASKFVREMLLGWV................ 289
302 4.000e-80UniRef50_A0A1I5U9U9 Agmatinase n=3 Tax=Caldicoprobacter TaxID=715222 RepID=A0A1I5U9U9_9FIRM  ali  20  9..............................................................QMLKEYRWSNRFMGSRECYDESDVIMVGAPMDYSVSYRPGARFAPQKIREVSYAIEEYSPYVD------RDLSEVRFFDVGDLELP---------MGNIVSSLEIIQQAAREVLEDGKKPIFLGGDHLITYPVVKEVYEKYGDLRLLHFDAHADLREE-------YLGERNSHASVIRLCSQ----------FLPSKNIFQFGIRSGTREEFKWAENLNFYPF-----------EVLQPLKEVIDVLKPYPVYITLDIDVVDPAYACGTGTPEPGGCMPHEIFQAFRAM-KGLNIVGMDLVEVNPVYDTAGVTSILAAKIIREAMLII................. 294
303 4.000e-80UniRef50_A0A060S926 Uncharacterized protein n=13 Tax=Dikarya TaxID=451864 RepID=A0A060S926_PYCCI  ali  17  40............................................QAVYHPGDNEVTADSIFSGITTFARLPWVKCLGREKDAAFDIAFIGAPFDTGTSYRPGARFGPAGIRAGSRRLTLY--GGYNVPLAVNPFSGLKIVDCGDIPVT--PYDNNYAIKQIEEGHKELLQRTAPISADGKRIVTLGGDHTIVLPILRSIYSAYGAISVIHFDSHLDTWKPQVFGGAPSEQAAINHGT-------------------SYSSLQHGAIRTTLPADYTNDDASGFQRIEAREIDTIGTDGIIKKIRETV---GDKPVYLSIDIDSIDPAFAPATGTPETGGWSTRELRTIIRGL-DGLHIVSADIVEVAPAYDTNELTTMAAADVLFEVLSVMAKT.............. 383
304 4.000e-80UniRef50_A0A1G9ZRE4 Arginase n=1 Tax=Paenibacillus sp. yr247 TaxID=1761880 RepID=A0A1G9ZRE4_9BACL  ali  29  30...................................................................................................RPGSELGPESMLQSGLIRQIRNLGLELAAD--------HQVDCPDHKVPSSGKAKVKYISEVKEMSGLVAEQVSQAAAGQTFPLVLGGDHSVSVGVVAGLTSHFSNLGLIWFDAHGGLHTEETTSTGKMNEMSLAAILGEGGSQLAD--MSGIDAPIKKEHLVIIGTRELDSCERELIRSKGITCYSMHDIDRMGIQNVIEKALQ-IAGNGTDGIHLSFDADCLDPLEAPGVGSPVLGGLSYREAHFALELLAESGRITSMDVVEINALLDVDRRT---------------ARLAVGLIASLLGKRIL 311
305 4.000e-80UniRef50_A0A0U5ARI7 Agmatinase n=52 Tax=Firmicutes TaxID=1239 RepID=A0A0U5ARI7_9BACL  ali  21  1.............................................................MHFFNPSYSGHAFIEAQSTYEDAKAVIYGMPMDWTTSFRPGTRFGPTRIREVSINLETYSPYADRE------LEEIAFFDAGDIPLP---------FGSAQRSLDAIEEYVRKVVADGKFPIGLGGEHLVSLAPIKVMAEKYPDLVIVHIDAHTDLRHE-------MEGEELSHSAIIRRALD----------YVKPENVYQFGIRSGLKEEFQFAKEN------MH----LNKFKVIEPLKACLEELKGRPVYVTYDIDAVDPAYAPGTGTAEPGGISAADAIESIYLLSE-LNVVGFDLVEVSPVLDQSERTQILASKMIREVLLTMIK............... 288
306 5.000e-80UniRef50_Q3IVT5 Agmatinase n=26 Tax=Proteobacteria TaxID=1224 RepID=Q3IVT5_RHOS4  ali  16  20.......................................................................FMRLPMATELQGLDAAIVGLPSDSGAPFRTGARFAPNALRAMSVMLRPINPYRGH----INIFEVLRVADAGDATCVPGYE---------IESLAALERALDAVVEAGAVPFGIGGDHSVSLAGLRAVAKRHGPLGLVHFDSHTDTWDSYFDGKRYSAGTMFRRAIEEG--------------IVDPARSIQVGMRGFQPADVSQSVDLGLEVITCDEMFALGLPETARRIAAR---SAGHPAFLSFDLDFVDPAYAPGVETPECGGPTARETLSLLRSL-QGLNLVGCDVVELNPSYDPGQITALLGATVMAELLAILAEARVR........... 316
307 7.000e-80UniRef50_A0A2P4HD27 Protein DETOXIFICATION n=2 Tax=Quercus suber TaxID=58331 RepID=A0A2P4HD27_QUESU  ali  19  904.......................................................................NYHPCLTSDAHKYDIAFIGAPFDTGTSYRPGARFGPSGIRQGSRRLNLY---------------WAKVIDCGDIPVTS--YDNAYALQQIEEGHNSILMRAPATHADGKRVITLGGDHTITLPLLRSMNRAYGPITVIHFDSHLDTWRPKVFGGSPSHQAAINHGT--------YFYHAAQEGLMRNDTNMHAGIRTTLSGDYENDGYCGFEISEAREIDTIGTEGILKKIHDRVGHKN--PVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGL-EGIQLVAADIVEVAPAYDTNELTTMAAADVLYEVMTLMVKNG............. 1211
308 7.000e-80UniRef50_M2T571 Uncharacterized protein n=19 Tax=saccharomyceta TaxID=716545 RepID=M2T571_COCSN  ali  17  59....................................................................PYIHCLAPEGDDVEPFDIAILGAPFDTAVTARPGARFGPSGIRAGSRRI---GPLWSVYTGENVFFDWAKIVDCGDAPLT--FLDNTVALNQLDRSHKIISSRDTNSSEHGRTPITLGGDHTTTLPALRSAHHHWGQVSVIHFDSHLDTWDPKVLGGGISHYAGVNHGT--------FLHIAHEEGLIR-NTSIHAGIRGAPKGDVRNDIRCGFEMIKARDIDRIGVSGIIDKLKARV---GDSKVYISVDIDVLDPAFAPATGTAEVGGWSTRELLSILDGL-EGLDVVGADVV--APVYDNAGETTVLAAEVVQSLIGLMVKAPA............ 371
309 8.000e-80UniRef50_A0A0K2SLE4 Guanidinobutyrase n=2 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SLE4_9FIRM  ali  18  1....................................................MKYRPVTEEMQPRFVGLQTFMQMPHNRQTDGVDVAIVGLPFDTGGTYRVGARFGPAAIRAASQMLHPY-----NPATGVDLTERLSAVDYGDLRVVPG---------AVERSHALLADGLEPLHRNGLRVIGLGGDHSVSLPHLQAAASVHGPLALIQFDSHSDLWDEFWGERRN-HGTVIRRALEEG--------------FIDPSASIQVGLRGSNRAESAFSREFGFAVLSTADLRHR--PGALREAPRKIRERGERRSFVTFDVDFVDPAFAPGTGTPEVGGFSSWETLELLRGLS-GIEFVGFDVVEVIPAYDHASITALLAATVVHEMLGLVA................ 310
310 1.000e-79UniRef50_A0A250V3E8 Agmatinase n=27 Tax=cellular organisms TaxID=131567 RepID=A0A250V3E8_STROL  ali  19  11.................................RGLDRTSDPRREPGPINLQRYAFVPAYAGIATFFGLPL-CLNPDDLRAGHVDVAVVGAPVDMSTGHRG-AAYGPRAIRADERILPNTPQMLVNPSTRIKPFEELTVVDYGDAAVDSFSIDN---------SMEPIRTLVREIAGTGAIPIVLGGDHSILWPDAAAVADVYGKIGVIHFDAHPDC-SNDLFGHLVSHATPIRRLIEDEH--------------IPGRNFIQIGLRSPDDELFDWMREHGLRAHFMAEIDRRGFDVVLQQAIDE-ALDGPEYLFVSLDIDVLDPAFAPGTGTPEPPGLTNRELLPAIRRICHETPVVGMDIVEVAPHLDPGYTTTMNARRAIFEALTGIA................ 346
311 1.000e-79UniRef50_A6NUU0 Agmatinase n=16 Tax=Bacteria TaxID=2 RepID=A6NUU0_9FIRM  ali  16  9.........................................................................YMGCDCPFEQAETVLFGAPFDSTTSNRPGTRFGPSALRRESYGLELYSPYQD------KDLSDCAVLDSGDLELSMGSSELALA---------DIEARAEEILSAGKRPFLIGGEHLVTLGAFRAVHRKYPDVAIIHFDAHTDLRED-------YLGVPLSHACVIRRCWE----------LTGDGKIFQFGIRSGDREEWRWGRDH----VTCHPFDLEGLEDVVERL-------GDAPVYFTVDLDVMDPSVFPGTGTPEPGGVSFDALRRAATLVCSRCNVVGCDVNELCPPFDQSGVSNAVAAKVVREMLLAL................. 282
312 1.000e-79UniRef50_A0A2H0PGW0 Agmatinase n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_47_16 TaxID=1973975 RepID=A0A2H0PGW0_9DELT  ali  20  1..................................................................MTNIYYDIPKEFSLYNNANVVIVPCPYEHTTSYGQGTSNGPAAILEASRQVEYFDEELWTEPYKAGIFSADPIAFAG---------------KTGEEAINQIAATVGKFYADNKLPIILGGEHSLSTGCIMAAHRAYPDLTVVQVDAHGDLRT-------SYHETPWSHACIMRRVDDLGIP------------SVGVGIRAICEEEAVLIREKKLKRIFAHELDAQ--EKWIDRALDGIK----GPVFLTFDVDGIDPSLIPATGTPEPGGLTWQQSTHFIKALCERCNVVGMDFVELAPN----------------PEQSASDFAVARLVYKSIGY... 282
313 1.000e-79UniRef50_A0A1Y5K807 Arginase n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A1Y5K807_9BACL  ali  29  27......................................................................................................TEQGPTSILAAGLLDELKHLAPHDEVRLEQPHRDADSEDTNNLSPRSRQDGIIKYEPQVRAMSERTADRVARAALYGSFPLVLGGDHSVAIGTLAGMSRVYDKLGVIWVDAHGDLNTEHTSSSGNANGMVLAIATGLAAFKQTDIGQTRR--LLRNRNIVLVGIRQLDDGEKTLIRSHGIHCFTIMDIDRLGIQEVIERAL-LLAGNDSDGIHLSLDMDALDPGEAPGVGTPVHGGLTFREARLAMEGLAASPSIASMDIVGVNPLKDKESRTSG---------------LAVALAAAFMGKRIL 327
314 2.000e-79UniRef50_G2XV70 Uncharacterized protein n=27 Tax=leotiomyceta TaxID=716546 RepID=G2XV70_BOTF4  ali  17  60..............................................GLKPTFEWRTFEEEDLISNAGGTFAHVDCFDPENDGTFDVAIVGHPFDLGVTYRPGARFGPNAARQGARRMSPFGWRQVCIENNVNPFDWATVVDCGDI--SNTPFDKHLALKQLENGMKSINSRSPKNDTDGKRAISIGGDHTITLPILRALHSTWGRVAVLHFDSHLDTWDPVQLGGGLSKYTDVNHGT--------MLHIAHEEGLLSNHSNMHLGTRCMDQHDLNNDLRCGFTYIRARELDKLGIKEVVRKIVERV---GDEYVYLSVDIDVLDPAYAPATGTIEPGGWTTRELLQIIGGLSEGLKIVGSDVVEFTPIYDNSAETTGIAVEIIYEILQWMV................ 403
315 2.000e-79UniRef50_S3CSE7 Arginase/deacetylase n=2 Tax=leotiomyceta TaxID=716546 RepID=S3CSE7_GLAL2  ali  18  72..........................................................FDDDYPYEGIGTFAHLEYVECTESKFDIGIVGHPFDLGVSYRPGARFGPNGGRNGARRLSPA-AGWDMDHNGVNPFSWAKVVDCGDIY--NTPFDKLVAIHELERGMKALGKQTPQSAADAVRLIAIGGDHTITLPILRALHSTWGRVAVLHFDSHLDTWDPKQLGGGLT-----RHAEV---NHGTMLHIAHEEGLLSNHSNMHLGSRSSLFDEHYDLNRCGFSYIRARALDQMGVDKVVQKIIETV---GTEYVYLSVDIDVLDPAFAPATGTIEPGGWTTRELLAIIKGLSDKLPIIGSDVVEFTPIYDNAETTGIAVSQIILEILHWMVHVPVK........... 403
316 2.000e-79UniRef50_A0A2V6T5F6 Agmatinase n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6T5F6_9BACT  ali  16  3.....................................................HPEPIDSMIYPRYSGIATFMRLPHLQDTRELDVAFVGVPFDTAAGYRVGARLAPRAIRNASSQVR-----IHHPIYDLTVHKAIRIADYGDVRTTPF---------EIERTFAWITEEFDAIYGNGCRTIAVGGDHGITYPILRAVARRHGPLAIVHIDAHTDTHD-----TQFAH--KLTHATTFRRAHED--------GLLQPGKVVQMGIRGFYPDDLKWSKEH-YRMMPAHELHRRDMDGVVAEVREIV---GAAPVYFTFDIDGMDPSCAPGTGVPEIGGLTNWQVMQIIRGLV-GLNLVGADLVEVSPPCDTNDITSITAAHMLFEIASVFA................ 308
317 2.000e-79UniRef50_UPI000C8199B3 agmatinase n=2 Tax=Eggerthellaceae TaxID=1643826 RepID=UPI000C8199B3  ali  17  16...................................................................................YDVAILGFPFDVGASARSGARFGPRGVRDASTVYCDGLYGLYDPVRNVEYLDQGRIIDCGDVDVSPCGF---------EQSFENCEAAVRCIIDSGAVPVVIGGDHSTTIPVVRAL-DRYDDVCIVQFDAHLD-WTDSYGEFTCSHSSPMRRSSELAHV----------------GRMMQIGLRGLGPADFAEARAWGSTIVSAPELRREGMEAIIARIPDA------EHYYITVDIDGLDPSLCPGTGSPQPGGLLYEEVNDLVYAVVKKGDVVGFDVSEVAPPYDHADQTSLYAAQIILDFIC................... 291
318 2.000e-79UniRef50_A0A2N2DFA7 Agmatinase n=4 Tax=Firmicutes TaxID=1239 RepID=A0A2N2DFA7_9FIRM  ali  21  1..........................................................................MGSCDTYESADTVIVGVPMDFTASYRPGSRFAPQAVRNVSYVLEEYSFYLD------RDLADYRFYDWGDINLP---------IGNVGESLNRINRVAARLFADGKFPVFIGGEHLISYPVISEACKKNPGLAVIQFDAHADLRSDY-LGEGNSHATVMRKACE----------------VIGSGNLYQFGIRSGTREELEYAK-TNTNLYT---------DAVLEPLMEVAKTLAGRPVYVTVDIDVADPAFAPGTGTPEPGGISSRELISAVHAL-RDLDIIGMDVVEIIPSIDPSERTAVLGAKIIREAI.................... 270
319 3.000e-79UniRef50_A0A139AAR0 Arginase/deacetylase n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AAR0_GONPR  ali  19  106................................................................................YPKFDIAVVGIPFDTSVTYRPGARFGPRGIRGASMRLSLN--FAHDPLLDVNPLSWATIVDCGDVP--AAYSDNAVAIAQMEAYLSEVVEASPDWTKGHPRVVTLGGDHTIVLPILRALHKIHGKFHVIHFDSHMDTWEPSSLGSGQTESNPYPRVTSLGLNHGTPLWHAAKEGLMDGRNL-HVGLRGVDMGDYATDDSVGFKRIHAADIDTLGVKGVIERIVEVVSGGNTDLVYISLDIDVLDPAFAPATGTPEIGGWSTRELKSIIRGLQGRLRVIGADVVEVAPAYDTAEQTTLAAAEVAYEFVNLM................. 439
320 3.000e-79UniRef50_UPI0007131E7B agmatinase n=2 Tax=Rhizobiales TaxID=356 RepID=UPI0007131E7B  ali  14  12...............................................................PRFCGVPTFMRLPQATSLKELDAAIIGLPSDSGGPYRTGARFAPNAVRAMSVMLRPINPYRGN----LNIFEALRVADVGDANVVPGYE---------IQSLERIEESVSALVSAGIVPFGIGGDHSITLAELRALAKVQGPISLVHFDSHTDTWDSYFAGQKYSAGTPFRRGVEE--------------QIIDTASSIQIGMRGFQKTDIRQSIELGYEVLTTDEALDLGPRALADRIASRVA---GKPVFISFDMDFVDPSAAPAVQTPEAGGPTARETLQIIRALH-GIDLVGCDVVEANPLYDSTGITALLAATIMAEFLALLA................ 311
321 3.000e-79UniRef50_F2LTM0 Agmatinase n=7 Tax=Desulfurellaceae TaxID=117942 RepID=F2LTM0_HIPMA  ali  21  1.......................................................................MKFYCSIHEIKKTKTVLVGVPYDGTSTYRPGSRFAPQAIREASYGIESYSPYQD------KDLRDIRFYDIGDIPLS--YGDKELNLKLIEAF-------IIKLIMKGKKTLALGGEHLITYPLIKAYAKKYKEFAIVQLDAHSDLIDSYRGES-------LSHATVMRRCSE----------IVGFENLYQLGIRSMVEED---------KLLPHRDV-NMGLFD-LSKAEEFLKRIGDKPIYLTVDLDVLDPSIFPGTGTPEPGGITYKEILSFLK-LLRQKKIIGADVVELSPHYDPTGVSSVVAASIVREILLIM................. 275
322 3.000e-79UniRef50_A0A069DLT8 Uncharacterized protein n=7 Tax=Bacillales TaxID=1385 RepID=A0A069DLT8_9BACL  ali  17  19.......................................................................FMHLPHIKTLDHVDYAIIGNPFDTGAGYAVGTRFGPSAIREMSQRIRT-----TNPAQGIDSSEYLSGIDYGDLSI---------YPGYIEQTYETVQEQLAPIYDKGIVPIILGGDHSISYPHVKAAAAQYGPISLVHFDSHSDAWEPMDEIRRFSHGNMFYH--------------GAKEGWINTQTSIQMGMRGHSSTHYEETRALGFDLLTTDDVKRMGTEQLCQRVKDRVK---DTPVFLTFDIDFLDPVFAPGTGTPEVGGFTTYEAIQMLRGLA-GINIIGCDLVEVLPDRDPTRVTALNAATIVSEFITLLA................ 307
323 4.000e-79UniRef50_A0A0P0Z5D7 Agmatinase n=2 Tax=Aurantimonas manganoxydans TaxID=651183 RepID=A0A0P0Z5D7_9RHIZ  ali  22  479.....................................................................................VAMIGVPMDLGVTNRNGSRFGPRALRTMER------VGPYNHVLKTMPTASLKVADIGDVPFRSRF--------DLATSHEDIERTAATIAGAGVLPLFVGGDHSITLPILRALG-ADRPVGMIHIDAHCDT-------SGPFDGCKFHH--------GGPFRQAVLDGVLDPERTIQIGIRGASEYLWEFSFESGMTVIHAEEIPGLGLDAVIARARAVV---GDGPVYVSFDIDSLDPAFAPGTGTPEIGGLTTREVQMILRGLA-GINMIGGDVVEVAPQYDATTNTAHAGAQMLFELLSLLDFT.............. 752
324 4.000e-79UniRef50_A0A0F7SKD8 Arginase deacetylase n=1 Tax=Phaffia rhodozyma TaxID=264483 RepID=A0A0F7SKD8_PHARH  ali  17  390.........................PVGEGARIGGAS-GTLASEQFNPWLEKFGSAGDLSF-TGVPSFAHLPHIRCLEEASTDFDVAVFGLPFDSAVSFRPGARFGPFGIRSGSRRQLPA--RGWNVALGTNPYQSGKILDCGDAPIT--PYDPALAIEQIEAAYHHPTHSTEKSKKTHPRIVSLGGDHTIVLPILRSLHSVWGPITVIHFDAHIDTWNPVRYPGSLTAQSQINHGT--------FFWKAYEEGLLRGNSSIHAGVRTTSLADYEDDLTAGFELIHTFDIDRFGVDHIIKTIRDRV--GTTNPVYLSFDIDVIDPSMAPATGTPESGGWTTREIRRIIHGL-KGLNFVGFDLVEVSPAYDTNELTNIAAADLIFDFLSIM................. 751
325 4.000e-79UniRef50_D3F8N5 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=D3F8N5_CONWI  ali  16  8.....................................................HYGPPDASLAPRYTGIRTFARCPHATDWANADVAVLGVPFDTATSYRPGARFGPAAIRDQSQLIRPW-----HAALEVDVFATLSVLDGGDLTVTPG---------NAARTAEQIHAGLRPVLEAGATPLVLGGDHSIVLGELRAQAERHGPVGVVLLDAHADTWDEY-YGERYFHGTPFRRALEEG--------------LIDPRRSLLAGMRGYAASDLDTPREWGFEIVTCDELRTLTPAEYGRRVRERI---GDGPTFLSFDIDVLDPAFAPGTGTPEIAGLLPHEAVAFLRALA-GIRFTGFDVVEVSPQFDPGQVTALHAASIGFELLALCA................ 315
326 5.000e-79UniRef50_A0A2E0ZZX2 Arginase n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E0ZZX2_9GAMM  ali  21  8......................................................................................................AASGPKSLRESLGVLDGGS--LPHMHVGVAWKRELRVVDYGNSPIDRL---------SVERSMPPVRKLVREIASTGAIPLVIGGDHSLEYPDVAGVADVYGNVGVIHFDAHYDAAAEGYSGHLISHAQPIYRLIEEGH--------------ILGSNYIQVGLRGYWPGEFQWMRENNFRYHTMVEIERDGWDAVMQRILTE-ANDGPEYLYVSFDIDVLDPAYASGTGTPEPGGLTTREVFPLVRALCTENNLVGFELVELNPLVDPGYTTVMNANRLVQECLTGIA................ 274
327 5.000e-79UniRef50_A0A1B9F6Y2 Agmatinase n=2 Tax=Dissulfuribacter thermophilus TaxID=1156395 RepID=A0A1B9F6Y2_9DELT  ali  18  1..................................................................MQNQFLNLTPPYSSRDQAKWFLIPAPFDASTCYRPGARFGPQAIIEASTQMELLDEELLFEPYKIGIHTTQAIEPVLD----------------PEKMAELVREEVSKAIDQGKMVCTLGGDHSVSIGAITAFFNAFGPLNIIQFDAHLDLR-------ESYQGSRFSHACVMRRVWDLGNP-------------IQVGIRSFSGEELTFLKETGAKPIFAKDIFSD-PQGSIDSVIKSLDKSL--PTYITIDLDCLDPSVMPAVGTPEPGGMLWYTLLNFLQTIISNSNIVGFDCVELSP----------------VPGINFPEFTAARLIYKVIGY... 283
328 6.000e-79UniRef50_A8MKX3 Arginase n=2 Tax=Clostridiaceae TaxID=31979 RepID=A8MKX3_ALKOO  ali  29  1....................................................................................MKINLIGVPLTYGCGKDGAQYGPSVLRE-------------NNMIDLIKNNGHTLYDLGDLVIPPASHENIKYLDLITEVNTNLAHQVYCSLEGESFPFVIGGDHSLGMGSIAGISKHFNEVAVIWIDAHSDINTHLTSPSGNPHGMPLAASMGVGHPKFTDIYFKGQ--KVHPKNVYIIGVRDPDAGELALVDDLNLSYYSMKTVREKGLENVLNEVIENIKGSGVDGVHISYDIDVFDKSIVPGTGTPVADGFTLEEGKFTIETLLKEKFVTSMDFVELNPLLDDASKTTV---KTAVEFLNHT................. 295
329 6.000e-79UniRef50_A0A2M7UXG6 Agmatinase n=3 Tax=Bacteria TaxID=2 RepID=A0A2M7UXG6_9BACT  ali  19  21..............................................................................QNYKSSKVVIVPVPYESTTYYLSGTKEGPWAIIDASRHMELYDIEKDTNASKVGIFTLEEL-------------EPSKN--SPKETVLRVENVVAKILEDGKFPFTLGGEHSVTLGAVSAFKKKFHNLSVLQMDAHTDLRNEF-------EGTKFHHGCVMRRIVDDLKL-----------SVTQVGIRSTTEEEMIYIKESKKNIFYGKQYE-----------IEKVISTLKENVYLTFDLDALDPSIMPSVGTPEPGGLGWYESLDLLKAVAQSRNIVGADVVELSP----------------IPGLIAPDFLAAKLVYKIISYAI. 290
330 7.000e-79UniRef50_UPI00041583B9 agmatinase n=1 Tax=Thermodesulfatator atlanticus TaxID=501497 RepID=UPI00041583B9  ali  20  1.....................................................................MPMTFLGLPENPAKARVVFCPAPYDATTSYLPGTRFGPRRIIEASPYLEFYDEEKDCEVYQKAPFLTL--------PEEELPVD-------PEKMLKTLKSRLDPYVNAGLFPVTLGGEHTVSLAPMALLKEKYGRLCVIQIDAHADLRNE-------YQGTPFSHACTMRRALELGIELYP------------IGIRAISREEIVFAREKGLKIHWARELVSK-LSEVVNEILTRI---GKRPVYVTIDLDGFDPAEVPGVGTPEPGGLKWYEGLFILQAVS-SLNVVGFDVVELLPKDDRS------------------AYFAARLIYKFLSYLF. 280
331 7.000e-79UniRef50_A0A1G2ZHM1 Agmatinase n=1 Tax=Planctomycetes bacterium RBG_16_43_13 TaxID=1801967 RepID=A0A1G2ZHM1_9BACT  ali  20  12......................................................................FMGIEPQYTELDKSRFVVLPVPYEQTTSYKKGTRFGPGALIDASCQVELMDEELMQDTYKVGIH-------------TLPPFPINK---DPAVFIRELSDYTRRFLDKGKFVITLGGEHTVTAGTIIPYAKKYPKLSVFHIDAHPDLRNE-------YEGSIYNHACALRRV-------------LDYAPIVQVGIRCITPEEVEIINSGRVKTFFAH------SYKSVKEIIPSVLKTLSDDVYITIDLDGLDPSIMPGVGTPVPGGLMWYDTLEILREIIYKKNVVGADVMELCPLQDN----------------VLSEFTAAKLTYKIMGY... 287
332 7.000e-79UniRef50_H0EBD0 Agmatinase n=9 Tax=Bacteria TaxID=2 RepID=H0EBD0_9ACTN  ali  18  36.................................................................................HGVDAAIVGAPMDDLVSDRPGARFGPRAIRAASC------PPGPHLEAGVDAFEILEVIDFGDAPVLP---------ADPERSHAAIEATVGQVLAAGAIPIVLGGDHSIAEPDVRACAAKHGPVGLIHFDTHTDTRT--VFGVERSHGTPMYRLVESGH--------------VDPTRYVQIGLRGYWPGEQEFGRERGITSLFMHDVRDRGIKAVVADAVAAAAPDGSRPVFLSVDVDVLDPAFAPGTGTPEPGGMTSADLLWACRTVAAEVELVGMDVVEVLPERGSRDVTALVAERIVRETLTGVA--MRRLATSA...... 327
333 9.000e-79UniRef50_U5MR00 Agmatinase SpeB n=85 Tax=Bacteria TaxID=2 RepID=U5MR00_CLOSA  ali  19  1..................................................................MNRNIETFIGCDNEYDEAKMVIFGAPFDSTTSFRPGTRFASKAMRSESFGIETYSIYQN------KDLEDMSIFDGGDLELP---------FGNPQKALDQIEEFASEIINDDKVPCMIGGEHLVTLGSVRAVAKKYPDLHIIHFDAHADLRD-------SYLGETLSHASVMHRVWD----------IVGDNKIFQFGIRSGDREEIYWGKDH---VYTSK-FNFTGLEEVIEKLK-------GKPVYFTIDLDVLDPSVFPGTGTPEAGGVTFMQLLGAILKVSK-LNIVGMDVNELSPIYDQSGSSTALACKVLRELLLSTYKA.............. 283
334 1.000e-78UniRef50_F6FR46 Agmatinase n=16 Tax=Actinobacteria TaxID=201174 RepID=F6FR46_ISOV2  ali  17  84.....................................................................................VAVLGVPWDSTATGRTGTNHGPLAIR-ACDYKGGYGRPHFSLDTHVDAFAELVMADYGDAPVS---------VGNTARTFEGIRKFVGTVVDAGAIPIILGGDHAITWPCATAVADHYGKVGIVHFDAHADTGDD-MPGSLASHGTPMRHLI--------------NSGAIPGKNFVQVGLRGYWPDQLDWMDDQKMRTHFMAEIVRDGFDKVLERAVDEALDQAD-HLYISLDIDVCDPAYAPGTGTPEPGGITSNDILRAVRRLAAEVGIVAMDVVEVSPPYDDRGITALLANRSVREAMTGIA................ 368
335 1.000e-78UniRef50_A0A174Q308 Arginase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A174Q308_9FIRM  ali  26  16...........................................................................................................ASQRGASMGPAAIRFGGLVEGLE---RQGHHVRDRGDIPRTGASREKLLHYEQVSEVNRRVYLSVTETLEEGRFPVILGGDHSIAAGSIAAVSKRHGNIGVIWIDAHGDWNSEESTCTGNMHGMPFSAVCGYGPDCMVEFGQGA--APVNVAHCVQVGGRDIDDLERQRMAQAGVTVFPINMIDKLGMGAVIERAIQ-IAGEGTDGIHLSFDVDAITPEAVPGTGVIVYNGLTPREAFLAAEAIAESRKLISMDMVEVNPFLDTANKSGILASELIQSALGKSV................ 296
336 1.000e-78UniRef50_A0A1G1JSA4 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=A0A1G1JSA4_9BACT  ali  18  1...................................................................MKHFGGIDEEYANFKKSKVVLIQVPYEKTTTYKKGTKYGPAAIIDASGYMELFDDELNQETYKIG------IHTMPELEVENIP---------PEEMTEKIHDSALEILKSNKFPVIIGGEHTVSIGAVRALKSVYPNLSVLHLDAHCDLRDEYF-------GSKYNHACVARRISEICP-------------VVQVGTRSLSRLEKDFLASQRVKTLSVYDILEMPM------WKDTVWSSLSENVYVTIDLDVFDPCLVPAVGTPEPGGIGWYETLDLLREVARERKIVGFDVVELSPLKDQ----------------AASDFLAAKLIYRFLGYIF. 285
337 2.000e-78UniRef50_R5W6S2 Agmatinase n=1 Tax=Clostridium sp. CAG:167 TaxID=1262777 RepID=R5W6S2_9CLOT  ali  17  21...........................................................................PYDKDAKDADVALYGMPFDISTTNRTGCRFGPEGIRQ------YGQCKPYHEELDINIFDDFKAVDTGDFAIPLSYVD---------RDMDAVENQLYELLEKGVKTIGVGGDHTLSYPELLALKRKFGKVAFVHFDSHTDTWDDENGNTLINHGTPFRLAIQHD--------------CIDMDHAIQIGMRGGTLEDHDFALEHGMQIIFGNELHEMGMSACAKRIREVV---GDTPVFVTFDIDFLDPAVAPGTGTPIVGGFTTAEALQILREGLTRLNIVAMDLVEVAPAYDPTGQTQVVANEILREFLSIL................. 307
338 2.000e-78UniRef50_A0BHR2 Arginase n=2 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0BHR2_PARTE  ali  32  1............................................................................MNQWKFVRNAVGLFGSAVHEGQTKTGTELAPRALREGGLISALYNLGW-------------EINDMGDIQGKNYRLHNVKNSQQIGVINGEINKKSFDIAKQNKFMLNIGGDHSVASGSIHGLLQHYGDLRVVWVDAHADCN-YEIGPNRNYHGMPLAHL---------YGSIVEPIKRLDPKNLIYVAIRDIDPMEREFIRDQKIVYYGMDEIIELGIGQVMNRILKQFE---GKPIHVSFDVDSIDPEFAHGTGTLVDGGITYREAHYLLRKLASSKQLVGMDLVEVNPQLETTEEFFGDFQQIGRIQGTQTVALGIELIASALGRTLV 315
339 2.000e-78UniRef50_Q6WVP6 Arginase n=4 Tax=Schistosoma TaxID=6181 RepID=Q6WVP6_SCHMA  ali  30  59......................................................................................................................................DGIQLTDCGDIEAEDPQRFGMKWSRSFSLTTLRIAERVEELMKQKSTPLVIGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSASGNMHGMPLSFLVKELQDQIPWLDFEGIKPCLNASNIAYIGLRDLDAHETHDIRKHGIAYFTMLDVDRMGIEAVIKEALLAVNPRLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATGKLSVVELAELNPLLGSQEKTQSSAVHILRACLGHC................. 336
340 2.000e-78UniRef50_A0A2C9KMN4 Arginase n=3 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9KMN4_BIOGL  ali  24  7..........................................LRFLKYKPLEHVSFRPHRTRNDNKHRRHRQPRTKIKIVYRIPTPRPSDRPPRVGIIGGPLMYGQPKGPDTAPDLLRSSYLESRLKKKG------ASVYDYGNLQFETVRNDGCKHSRTVGLANSQIAERVEMVLKTERKVLLLGGDHSVAIGSIAGHSNFKRNVAVIWVDAHPDINTPLTSLSGHLHGMPVSFLSEMPHIHPKLPGFEWLNPCISVKNLAYIGLRSIDPEEQDFIEKLNICAFSAKDVRTLGVDFVMSAIMSQIDPWDRLPIHLSFDVDAMDPGIIPATGTPVKCGLNLKEGLDIAKYIFKTGRLSVMDVVELNPKLAESNWSADVIVEIIVRAFC................... 357
341 2.000e-78UniRef50_A0A1M5C026 Arginase n=6 Tax=Rhizobiales TaxID=356 RepID=A0A1M5C026_9RHIZ  ali  24  1...........................................................................MHQPADAVRSIDIFGIPTDAGASCRGDGM-GPEALRVAGLLDTLAALG-------------HTVSDHGDIVWHERPAPNAQSPADVLALAAQSCQRAQASLQAGHLPVFLGGDHSLSMGTLGGVARHCKPLFVLWVDAHGDFNTPETSTTGNLHGMPLALLCGE--PDFGPEFDGPWRGAIDPRNVTIFGARSIDRPERTLLEARGVDVMDMRRIDEMGAVALMRGVIERVEAV-DGHLHVSLDVDVMDPSIAPGAGTPVAGGLTFREGHLAMEMLHDSGCVSSVDIVELNPFLDHAGMS---------------ARLLVDLAASLFGRQIM 312
342 2.000e-78UniRef50_A0A2G4JFS7 Agmatinase n=3 Tax=Thaumarchaeota TaxID=651137 RepID=A0A2G4JFS7_9ARCH  ali  16  17...........................................................PFVGINTFLHLPWIRSHQELINAKPDVAIIGEPFDFGTTIRPGARYGPRAIRAAST-IPSPPYERFNIETGADPFGTFRTVDYGDVQVSPG---------DVIESHKRMTKKVKEVLDEQGIPVMLGGDHSITFANVRAFAKKYKNIGMIHFDTHADCAPQGLTGYKYDHGAHIRRIMEMG--------------CLRGKNYTLVGPRGYWPGLYKWMADQDFQWFTMLDVEELGIDMIAKEIADR-ANDGTDAVYLSWDIDSFDPSYAPGTGEPEPNGLTSREGMRMVRLLSKSPNRFAMDLVEVAPAYDVSGITSGLGQRLIIELLAGL................. 333
343 2.000e-78UniRef50_A0A2E2X200 Agmatinase n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2E2X200_9RHIZ  ali  18  30.......................................................................FMRRKYTKSLDGVDVAVWGIPFDAAVSNRPGARFGPQAIRRASAIFDNDPQXPFERDL----FENMAVIDYGDCLLD---------YGNHQETPGRIQSEAAKILGAGAFLLTLGGDHYVTWPLLKAHVDKHGPLALVQFDAHQDTWDDD--GERIDHGSFVGRA--------------AKQGLIDTSKSIQVGIRTHAPE------XCGIRMIYGHEVEDMSAQEIADAIIEH---TGGXPVYLTFDIDCLDPAFAPGTGTPVAGGPSSAKALSILRKLGA-LDIRGADVVEVAPAYDHADVTAIAGATIAMYMLGLLAE............... 311
344 2.000e-78UniRef50_A0A0U9HJ14 Agmatinase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A0U9HJ14_9THEO  ali  19  1.............................................................MKELDFVSGHNGFLGAKEDYDRAKIVIIGAPMDFTVSFRPGTRFGPERIRSVSYGLETYSVYADDA------LDDKSFCDIGDIELP---------FGNVKKSLDMIEEAANKILNDGKIPFFLGGEHLVTYPIVKKVAEKYPDLVVLHFDAHADLRDTFF-------GEKLSHATVLRRVSEQ----------VKNKHIFQFGIRSGVKEEFLYAQQH----------TNMYPLEVKTPFLQVLDSLKGKPVYITLDIDAVDPAFAPGTGTPEPGGCTSCDILEVVASFGK-LNVVGIDLVEVSPASDLSDRTALLAAKIVRETI.................... 283
345 2.000e-78UniRef50_A0A268E999 Agmatinase n=1 Tax=Bacillus sp. 7586-K TaxID=2021690 RepID=A0A268E999_9BACI  ali  17  19.......................................................................FMKLPHTNDLENVDFAVIGVPFDTGAGYAVGTRFGPAAIREMSQRLRPINPALNMIELSKY----MNGIDYGDLTVHPGY---------IEYSYEEIEAQLEPIFEKGIIPILLGGDHSVSLPHIRAAAKKYGPVSLVHFDAHSDTWRSDDPKKKYSHANMFS--------------LGADEGVIDPHTSIQMGMRGGGPPDFESSIALGYEVLSTDDVKKLTVSELCEKVKQRVK---NRPVFLTFDVDFLDPVYAPGTGTPEVGGFTTYEAMQMIRGIC-GINIIGFDIVETLPDRDPAKVTALNAATITHQVLSIIA................ 308
346 3.000e-78UniRef50_K0A8T4 Arginase n=33 Tax=Bacillales Family XII. Incertae Sedis TaxID=539742 RepID=K0A8T4_EXIAB  ali  29  61........................................................................................................................................................PQLKRLEGVVHTTNDLHLIVRDTLTEQRFPLLVGGDHSMAIGTIAGLQQVVPRLGVIWFDAHGDLNTPDTSPSGNIHGMPLAVALGEGHQRLTEIGGSDV--KLQPEHLVFIGLRDVDAGEQELIDRLGIRVYDMEAIRTRGMDTIMEEAIAYLKET-TDAFYLSFDMDGLDPSLVEGTGTRVADGILLDDAKTVLRHCAEQEDFIAAEFVEVNPLLEEGNGTALLANELIGNLLQYM................. 295
347 3.000e-78UniRef50_A0A2M8FY96 Agmatinase n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M8FY96_9DELT  ali  20  18................................................................................YEKAKVVFLPVPLEKTTSYAKGTANGPEAILQASTQVEFYDEEIDDEPLGLHTKASLQFEDL-----------------TLEESVALIEKEVEAIVKDKKLPFVFGGEHTISAPVVRAVGKFHPDLTVVQIDAHADLRQE-------YEGTPLSHASVMARILEKFPA-------------VQIGIRALSKEEALWIKKDKLPVFFAHHIHRN--PEWIDQALAAIK---TEKVYLTIDIDGLDPSLVPDTGTPEPGGLSWLHTSSFLRRLMQEKEVVGMDLVELMP----------------KEGSHGSNFIAARLASKCIGY... 285
348 3.000e-78UniRef50_A0A2W4KHT1 Arginase n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4KHT1_9BACT  ali  31  48..........................................................................................VPLHLGGSHRG-ASMGPAAMKVA-------ELPERIKALGFAVAEEIDI----EVPHSVCWWDNEKCVPEIYQVSEAVADAVEAAMEAGNLPITIGGDHSLAIGSIAGAASYYRKFGLVWFDAHGDINTPDTTASGNVHGMPFAVSLGLGDEKLVNLKGF--SPKVPAKRSSLIGIRDVDPPERDMITQTGITAFTMKEIDHLGLGRVTDMALGAVGADVNG-IHVSFDIDVIDPDVAPGVSTASRGGLSYRESHLALELLAESDLVRSIDIVELNPAFDVRNKT---------------AELAVELILSALGKRIL 341
349 3.000e-78UniRef50_A0A2C9D6R5 Agmatinase n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2C9D6R5_9RHIZ  ali  21  35.......................................................................FMRRMLSRELENVDAVVWGIPFDSAVSNRSGARFGPQAIRRASAIFD----GDPNYPFGFDIFEELAVVDWGDCSLDYGRPQDARL---------QIEAQAGEILDAGCHLFTLGGDHYVTWPLLRAHAERFGPLSLIQFDAHQDTWHGD-DDDRVDHGAFVA--------------WAVRHGIIDPSTSIQVGIRTHAPED------CGLEILYGHDIDRLGIAGVLDRICNRV---GDNRAYMTFDIDCLDPAFAPGTGTPVSGGLTTREMIALITGL-EDIDFVGGDVVEVAPAYDHADITAIAASTVAQSYLGLLA................ 316
350 3.000e-78UniRef50_N0DY31 Arginase n=12 Tax=root TaxID=1 RepID=N0DY31_9MICO  ali  27  18....................................................................................................IGARLGPGALRVAGIQRALENFGN-------------NVVDRGDLTGPDPPVDGYRHLPEVIAWNQTLHDAVFAELEGDRLPITLGGDHCLAVGSISAVRAAGKKVLVLWFDAHADFNTASITPSGNLHGMPVACLLGHGPDGLTSMAGA--TPAMRHDEVRQVGLRSVDQGEKELLHEVGVECYDMRYIDEKSMRKVMQKALAGVDE--DTHVHVSLDLDFIDPVVAPGVGTPVVGGPTYREAQLCMEMIADTGQLGSIDIVELNPALDQRNAT---------------AELAVDLLESLFGKSTL 299
351 4.000e-78UniRef50_A0A0S8CKT0 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0S8CKT0_9CHLR  ali  18  11...........................................................................PPYSDLQKAKAVILPVPYDSTSEWRGGSRHGPQAIIDASEYLELYDLELDREIYRAGICTLPRVEPL---------------LGSPQGMIDRVYQVVGDLVQKGKFVVLLGGEHSLSLGAVRAFKEAFPTLSVLQLDAHADLRDQ-------YLGTKYGQACVMRRILEVCP-------------ICQVGVRSLSWEEKQFSAEKQLKVFYMTDFASNGAE------IDRITESLSRDVYITIDVDVLDPSIMPAVGTPEPDGMSWRQILDTVKSVMIHKHVVGFDLMEFCP----------------VEGSSSCAFLLAKLAYRLIGYAV. 284
352 4.000e-78UniRef50_B5YF20 Agmatinase, putative n=3 Tax=Dictyoglomus TaxID=13 RepID=B5YF20_DICT6  ali  20  23.....................................................................................VLIISYPLEVTTTYKKGTKEGPQAILSASYNLELYDEELDDIPAEIGIYT---------------YPDLLLSLGNVEKVLEEIEELTFNIIDYDHFPIFIGGEHTITKGILRAYNKKYKHFSVLHLDAHSDLRNE-------YEGTKNNHACALREASETL-------------DIVQVGIRSMSEEEKKYVKERNIKVYFDYKFQERFNTTLIEDILKSLKDE----VYITLDFDVFNPAEMPAVGTPEPGGLSWYQVLSLLREVFKNKKVIGIDLVEFSP----------------IPGLIYPDYMAARLIYKIIGY... 287
353 4.000e-78UniRef50_A0A0B7G0F3 Agmatinase n=76 Tax=Dikarya TaxID=451864 RepID=A0A0B7G0F3_THACB  ali  19  78.................................................................................HLFDIAILGVPFDSAVTYRPGARFGPYGIRSGSRRISPYL--GYTTAWGYNPYDNTTIMDCGDVP--TIPFDIPMAMDQIDTAYNFGSNITKNAAKDGKRIMTLGGDHAIILPILRSLHSIYGEIAVIHFDSHLDTWPVQATNNTITHGTMFWTAM--------------NEGLIAKGNSIHAGIRCMMTGDIQNDQQVGFSMITTDDIEELGTGGIIEAIKRRVA---DKPVYISIDIDVVDPGLAPATGTPEPGGWTTREVKRILRGLA-GMNIIGADLVEVAPAYDTNESTTIVAAGIVHDLLSVL................. 387
354 4.000e-78UniRef50_A0A021XBK7 Guanidinobutyrase n=9 Tax=Rhizobiales TaxID=356 RepID=A0A021XBK7_9RHIZ  ali  18  24.......................................................................FLRTRRHDIVRGIDIGLCGVPFDLGLNYRSGPRQGPAGVREASRII-----RRIHPVTGVRPYDLCTVADIGDAPINPLNKDA--SIDQIQAYFQ-------EVKDAGIRPIAIGGDHTIPTPILRALAS-DRPVGILHIDAHADVMDT-------MCGTKVNHATFMRRAYE--------ENLIDPRRVVQLGLRGFGDDDVQFGYDKGYNIITLDEYEEMGRAAVIEKINSVL---GDGPFYISLDIDSIDPAYAPGTAVPEIGGLLPRDLQVIIRSL-QGKDLVGADISEVAPVYDPTGITCVTAANMMFEMLCVMAKAVEK........... 316
355 4.000e-78UniRef50_A0A1J8QFH2 Uncharacterized protein n=1 Tax=Rhizopogon vesiculosus TaxID=180088 RepID=A0A1J8QFH2_9HOMO  ali  20  445...................................................................YSHLPYTRCLDDISTTFDIAVLGMPFDTATSYRPGARFGPYAIRSGSRRQSPA--GGYALNWMTNPYNHATVIDCGDVPVN--PYDNALAIDQMETAYTSASTRTAKLAHDGARILTLGGDHTIVLPILRSLHQVYGPISVIHFDAHIDTWPDFSEQSKVTHGTFFTLAFEEGLMSNT---------------SIHAGIRNHGPELIEHDEEVGFELIMADDIDDLGTDEIIKHIRQRI---GNSPVYLSFDIDTIDPGQAPATGTPEPAGWTGRETKRILRGLA-GLNFVGADIVEVAPAYDNADITGILAAGLADDFLTLFV................ 765
356 5.000e-78UniRef50_A0A2E4FF50 Agmatinase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E4FF50_9GAMM  ali  21  1.............................................................................................................MREASASLAWERQAVG---WGFSPLETLAIVDYGDCDFD---------AGNPARVPEEIYECARQILATDTALLSIGGDHFVSYPLLKAHAEKYGELSLIHFDAHSDTWAEDS--QRIDHGTMFYHA--------------AQQRLISPAHSAQIGLRT------HNDSDHGFNIFDAPAVHDMKPADLAEEVKGIV---GGRPCYLTFDIDCLDPSFAPGTGTPVVGGLSTHQAMQILQQL-KGINLVGMDVVEVAPQYDVGAITSLAAATVALQQLCLFASAG............. 247
357 5.000e-78UniRef50_L9WF24 Arginase n=2 Tax=Natronorubrum sulfidifaciens TaxID=388259 RepID=L9WF24_9EURY  ali  27  7...................................................................................................RRGVDMGPSAIRYAGLADGLSDAGVEPVDAGDLSIPRAE---ERDPDAKQPNRGTAKFLREVEDVCTRLADQVQATLEAGEFPLVLGGDHSVSIGSMQGSARR-ADLGVIWFDAHADLNTPETSPSGNVHGMPLAATLGRGAFDESAWAHAAHAPRVRETSIAYVGLRSIDERERTLLRDSEMTAFTMADIDDRGMTSVVDDALD-IATTGTDGVHVSLDLDWLDPKTAPGVGTPVRGGVTYREAHAALEAVSRRHELRSMDVVEVNPILDEGNETAT---------------LAAELSASAFGNRIL 328
358 5.000e-78UniRef50_N6UIJ9 Uncharacterized protein (Fragment) n=9 Tax=Hexapoda TaxID=6960 RepID=N6UIJ9_DENPD  ali  27  479.........................................................................NEQQFNDWEGCKVGLLGVPFEKGQTKKGVAA-GPEAIRKLGLVERLEEIEG-----------KLDIKDYGDVDLKEKDVPNMKEYAHIAACNQQVSKTVEKIINEGRICVTLGGDHSLGVGTVDGHIKAKGNICVLWIDAHPDLNTNKTSSTGNVHGMPMALLAKELSDYWPYLPGMWQKPVISLRHIAYIGLRSVDSYERLVIDKLGINAFGMEDIENYGIRTIVDMALNKIDPESNKSIHVSFDIDSLDSLEAPSTGTSVRGGMTLREGIQLMEIIHQTCRLGALDVVEVNPSIGSE------------ADVKRTVDAAIHVIAAALGHS.. 794
359 6.000e-78UniRef50_Q7VRG4 Agmatinase n=4 Tax=ant, tsetse, mealybug, aphid, etc. endosymbionts TaxID=84563 RepID=SPEB_BLOFL  ali  18  6........................................................HKHDDSLFSNSFGFLRLPLEFYPYTRHNDWVITGVPFDIATSGRSGSRFGPASIRKASINLAWENCRW---PWNFDIRQKLKIIDCGDLIYKSG---------NVQDFTNILQKHIENLLRFRKKILLLGGDHYITLPVLRAYSKFFGTISIIHFDAHADYYD---NNNQYDHG--------------AVILYALHEKLINPNRSVQIGIRT------EYDKNFGFTVLDAEYVNTTAVHVLINQIVSVIQ---NRPVYLTFDIDCLDPSVAPGTGTPVIGGLTTSCALQIIRG-FQKLNIIGIDIVEVAPVYDCAQITALAAATLGLEMLYTQVK............... 302
360 6.000e-78UniRef50_A0A2G6CLY4 Agmatinase n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6CLY4_9PROT  ali  15  3.............................................PPMLPLTRASSLALRQMAIEQLHDTFLGLPPDECTYDESRVVLLRAPYDGTTSYMAGARDGPAAILAASAQVEPYDRELGCEPCEVGIHALPALVP--------------PAAAGPKAVIDQIEALSLPVVADGKLPFVLGGEHSVTLGAARAVAEVHPRLSFLQIDAHLDLRP-------SYEGSPYSHACVAYHLLGLRG---------DGGQVVQVGVRTACPEELAVIEEHGLAPIWGEDVWREEDDAWIARAVEGLA---DHPVYVTVDVDGLDPSVIPGTGTPVPGGLGWYQTLRLLRAVGQACRVVGCDVVELAPG----------------PGDHRSAYAAAQLVYKMIGY... 312
361 6.000e-78UniRef50_UPI000D80591F Arginase/deacetylase n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D80591F  ali  19  117...................................................................................FDIAVVGMPFDTAVSFRPGARFGPSGIRHNSKRMS--KFRGYNVPLGVNIYESGKILDCGDIPVT--AFDNNLAVKQMQRGYTSLLQRVKTPAKEGKKPITLGGDHTLVLPVLRSLETVYGPVSVIHFDSHLDSWDP-----GFYGGDEASKASTINH--GTFFWHAANEGLIRNGSSTHAGIRTAHPTDYDTDKQCGFSLQEAHVIDDIGIKGIVKNIRKAVE---GNPVYLSIDIDVLDPSAAPATGTPETGGWTSRELRKILRGL-DGLDIIGADVVEVAPAYDNAALTQMVAADLVFEILGLMVK............... 427
362 6.000e-78UniRef50_A0A0G0WII6 Agmatinase n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A0G0WII6_9BACT  ali  17  1.............................................................MPYQRRVTPNNFGGLTGQSFENAKAVILQVPYEGTVSYGSGTSNGPQAIIQSSRFMESYDIELDAEIYGIFTLEPMAVRDL-----------------QPEDMTLQVEKEYTKLVAANKFVVMIGGEHSISYAADRPLREKYPDLSILQWDAHADLRD-------SFEGTKFSHGCAMRRFYD------------NAKRIVQVGIRSFSVEEAEYIKKNNLRIFTPAEFD-------VEKIIERLSP----NVYITVDLDGFDPSILPATGTPEPGGLYWPDFLKLMRAVFAKRNVVGCDVVELAP----------IAGQPASDFLSALA------VYKMIGYKF. 287
363 8.000e-78UniRef50_A0A2A4ZGQ4 Agmatinase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A4ZGQ4_9RHOB  ali  18  22.......................................................................FMRLPQATSLDGLDVAVLGIPIDIGTSWRSGTRFGPKQIRAESAMIRPYNM-----ATGAAPFDXLQVADIGDL---------AINTFSLPDSXRIIXXSYDAILXXXVXPVAMGGDHSITLPILRXXAXXXGPVAXVHIDAHADVND-XMFGEXETHGTVFRRAXEEG--------------LIXXDKTYQVGLRGYAASDFAEAAGWGFQQFPASELWHRSLNNLGAEIRRDI---GDRPVYVTYDIDSLDPAYAPGTGTPEIGGLTTPQALELIRAL-RGVNIVGCDLVEVSPPYDTTGNTALTGANLLYELLCVL................. 309
364 1.000e-77UniRef50_UPI000B90794F arginase-1-like n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B90794F  ali  34  85........................................................................................................................................HDVVDYGDLDTSSSSTVALRNVVEVGKANLLISKSTAKIIQEKRIPLTLGGDHSIAIGTIHGVSEVVQDLAVLWVDAHCDINTPGSTPTGNMHGMSLSFLLKELKGHG-IPEFSWAIPRISARNLAYIGLRSVDAGERKLLDNLGITAYSMRDVDRLGIVEVTRCALEKIAPSGSRPLHISFDIDVLDDLELGGTGTAVEGGLTLREGMTLLEEVREKANIVSMDLVEVNPALGSD------------EAAKRTATLTKHLFGSVFGY... 355
365 1.000e-77UniRef50_B5IFF7 Agmatinase n=4 Tax=Aciduliprofundum TaxID=379546 RepID=B5IFF7_ACIB4  ali  20  4........................................................................HFADTNKNFNESFFIIFGVPFDGTSSYRHGSKFAPDEIRKASYNLESYVMEHKIS------LSELPIHDMGDI-------GTLDEFGNVEDVIETVYSTMQSIL-PNKFPIMIGGEHSITIGAAKALKKL--NAGIIFIDAHGDFRDE-------YLGNKYSHACTARRAYD-----------ILNGKIISIGVRSASQEEVEDAKDLNYEWIDSYEFQRLGWKRTIKKAMEILD---VQKVYLSIDIDGIDPAYAPGTGTPEFFGLSPMDVKNIINFLA--PNLIGADITEVCPPYD-NGNTSILAARLVQEIIAA.................. 280
366 1.000e-77UniRef50_A0A1A8LME6 Agmatinase n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1A8LME6_9GAMM  ali  21  34.....................................................................................VVVSGVPFDLACSGRSGTRMGPNAIRQSTANLIWEGKRW---PWDFALPERLNVCDAGNVDY---------AYGEPESLVDNLETHAMRWLKAGKKMLTLGGDHYITLPLLRAHAREHGPLALIHLDAHTDT---YEHGTRFDHGTIFHHAL--------------KEGLLVPEHSLQIGIRSYDR------HNHPFEVLEADWVNEHGAAAVLERIRARV---GHHPVYVSLDIDGLDPAYAPGTGTPVCGGMSTDFMLKVIRGMV-GMDLIGMDVVEVNPAYDHGEITSLAAATLGLEFLYVLA................ 301
367 1.000e-77UniRef50_A0A2S6UJB0 Proclavaminate amidinohydrolase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A2S6UJB0_9PROT  ali  18  32.................................RGLELGLEAADSINDRSISLFSRGHLPAFAGINTFMKSRY-CENIREVGNYEAAFVGVPFDTGTTYRPGARFGPQAVRRISALYD-----GYCVDGAVDLFEELDLCDAGDIFVIPG---------NIEKTFDQVSKGISHVFTSGAFPIIVGGDHSLGYPNVRGVAQISGNVGIIHFDRHLDTQDIDMD--ERMHTTPWNHESVDHSKAHQHHSHMHDVGLSNPKNLVQVGIGGWNRPGSEVARDRGTSVITMKDFEELGIQGTASLALE-LAWKDADAVYLSFDIDSIDPAFAPGTGTPEPGGFMPREALEMVRLIAREG-LCAMEVVEVSPPYDVNDNTSQLACRVILDVIGTMVSVG............. 383
368 1.000e-77UniRef50_A0A0B5HQI5 Agmatinase n=1 Tax=Archaeon GW2011_AR10 TaxID=1579370 RepID=A0A0B5HQI5_ARCG5  ali  18  12.......................................................................NFVEHPQKPLSECKAVLLPVSFEATASYMKGTKAGPKAIIDASKHLEWFDLELGKEI----------------VKEVPIFTSETLKPKNVKGLLESVESSVKEIVSQKKFPLLFGGEHSITFPAVKACASSFDNLSVLSIDAHADLRNE-------LNGEKYSHACVMRRCSET-------------SKIVLAGVRSLSAEEKKFAEKSGVKIFFGNDFS-----------VKEVVDSCSKNVYLSIDLDAFDPSIMPAVGTPEPCGLDWGTVLGLCRELFKRKTVVGADLVELSP----------------IKGLRAPDFAAAKLAYKILGYKFL 284
369 1.000e-77UniRef50_A0A2B2AR72 Agmatinase n=4 Tax=Bacillus megaterium TaxID=1404 RepID=A0A2B2AR72_BACME  ali  20  4............................................................DKFLAYGGNPTFWRCEQTREINGADIVVMGVPFDVGTSNRPGARYGPRSIREMSLHVGNFYY-----PWSYDVKEKHKIIDYGDVGLGVQN-------DLTQFMIQDTYEHAKSILASGAKLLTLGGDHTIPYGMVRAAKEKYGKLALLHFDSHQD--SLASDGTQIFHGS-FAH-------------DLAEEGCIDAEKSVQVFIRTEMPNE------CGYNIIHANEALEMKSAELADKIKSII---GDQPVYLTFDVDSLDPAYAPGTGTPVVGGPSTYQIRSLLRNL-EGLNIVAADLVEVAPMYDPAQVTPLAAATIAGDLIYLLAEN.............. 298
370 1.000e-77UniRef50_A0A0B6X0Y5 Agmatinase n=2 Tax=Pyrinomonas methylaliphatogenes TaxID=454194 RepID=A0A0B6X0Y5_9BACT  ali  20  18....................................................................................RVLVWPVSYEGTVSYGAGTARGAEAIIDASRNMELYDEELDAETYRIGIHT---------LPIFPP-------APSPAEMNQKLYEEARRLVSTGKFLVTLGGEHSITAPIVRAHAERYANFSVFQIDAHADLRATYDD-------TPYSHACVMRRIVEDLRIPA-----------VQFGIRSMSAEEARVKDRLPTRIFWAKDV--VGRPQSWNEAI----SLLTENVYLTIDIDGLDPSLVPHTGTPEPGGLGWYETLGLLRALAGRRRIVGMDLVEYAPAGEH----------------HASAFLCAKLVYKTLGYIF. 283
371 1.000e-77UniRef50_A0A239TBV3 Agmatinase n=6 Tax=Bacteria TaxID=2 RepID=A0A239TBV3_9FIRM  ali  18  12............................................................................CDKEFEEAKIVLFGAPFDSTTSYRPGTRFASRTMRAESYGLETYSPYLDL------DLEDAAVFDGGDLELP---------FGSVENALEDIEEFTQKIIDCDKLPLMIGGEHLVTLGAVRAVAAKYPDLHIVHFDAHADLRDD-------YLGAKLSHATVLHRVWN----------IVGDNKIFQFGIRSGDKSEFVWGKDH---------VKTQRFN--FNNLKETVMALKGKPVYFTVDLDVLDAAVFPGTGTPEAGGVSFDELRCAMKLVAENCNIVGTDMVELSPPYDQSGISTATALKLLREYLLALDYN.............. 285
372 1.000e-77UniRef50_A0A2E7NHL5 Agmatinase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E7NHL5_9BACT  ali  18  27........................................................................MRAQLCEGFDGLDIALAGVPFDGGSSFRAGARHGPAQMREMSRLIR-----QAHYSTNIAPFEICRIGDVGDAPI---------NPLDMSASLESIETFFSAIRXAGALPLVAGGDHTITLPILRAIA-VDAPVGLLQIDAHSDTQD-RMFGKIYANGTPIRRAIEEG--------------LLEPSHIIQIGIRGFSTDELDWAREQGITIMTIDDVYELGTNGIMNAAREVLSDL---PTYVTVDMDAIDPAFAPGVGGLEPGGMTVRDVQLLLRGM-EGLDXVGADXNEVSPPLDPTGNTAVVACNLMFELLCLLA................ 313
373 1.000e-77UniRef50_A0A1Y5SL52 Proclavaminate amidinohydrolase n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y5SL52_9RHOB  ali  17  68...........................................REPGIIQTQRFLNMGWGLLPTFLNQPLAF--TPADLAAAEVDVAIMGAFTDMGSGARGASR-GPNAVRN-SARYIPYGVRAPHMDVMVDPLEEMVVVDYGNAP-----NDLMSTERTVQAVRSFVRQAIEVKHEDGRIPVIVGGDHSLMYPDVAAMADVYGNVGVIHFDAHYDA-TKYMMGHLISHGMPIYRLVEEGH--------------VEGKNFIQVALRGYYPDEFNWMRENGLRYHTMAEIDARGWDPVMEDVIAE-AQDGPEYMFISFDMDTFDPAFVPGTGTPEPGGLLPREVFPIIRRLCAESNVVGFEVVELSPELDPTYVSALNANRVIRECLTGLA................ 396
374 1.000e-77UniRef50_UPI000CDE9C66 arginase n=1 Tax=Helcococcus massiliensis TaxID=2040290 RepID=UPI000CDE9C66  ali  29  1................................................................................MNKNNISILGIPMDLGASTIG-TRLGPDSIRMTGVLDDLIDLGL-------------NVTDLGNVDIDNGYVDNMTNLDRLLPSLAKINEQAYDLFDRDSFPLILGGDHSLVLATFKAFLKKHDNPGLIYIDAHADINTEKTSTSGNVHGMPIAALLNLCDDRLNKIGGDY---YLKPENIVYIAIRDIDEGEEKIIEDLNIKYFSMAEIYEKGIKKVLEETFEYLKD--VDNIYTSYDIDSIDMDIAPGTGVPVRGGLDYNMARDIMSRLGKNDKIKGLELVEVSPSLDIGNKTSLIAK---------------ELLLGFFGKKFI 298
375 1.000e-77UniRef50_A0A1I6GFN6 Agmatinase n=5 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1I6GFN6_9RHOB  ali  19  53..........................................................................................IAFDQAVTHRPGTRFGPRAIREASC-LQPYDPPYGWD--GFDPLSEFAIIDYGDMPFD---------YANVAQVPSLIEAHFARILHAGPGTVALGGDHFMTLPILRAYAAKYGPLAVIQFDAHSDLWADD-DMSRIDHGTFM--------------YKAVKLGLVDVARSVQVGIRT------ECDDYLGMTYIDARACHERGTADVVAQIKQIV---GAHPTYVTFDIDALDPAFAPGTGTPVWGGLASWQAAAMLRDLA-GINMVGGDIVEVSPPYDTTGATAVAGAHIAMELCCLA................. 315
376 1.000e-77UniRef50_A0A1H0K2K6 Arginase/agmatinase,TIGR01230 n=2 Tax=Nakamurella panacisegetis TaxID=1090615 RepID=A0A1H0K2K6_9ACTN  ali  19  38..........................................................................................APYDSGTSYRSGARMGPMALRTVDYSEHTGSR--PHLSLRVDPLLDLGVVDAGDVEM---------APTETIRSLRALQTVITQLAAADKIPIVLGGDHTVAMADITGLAEHYGRIAVIHFDAHADTGDIQ-FGSLYGHGLPMRRVIE--------------SGAVKGSKFFQIGLRGYWPEELAWMAEQGMRGFEMAEIQRRGLDDVLTEAIA-LASVDTDGVFLSVDIDVVDPGLAPGTGTPEPGGLTGRELLDAVRRIGREVNLVGLEIVEVAPPYDHADVTAMLGNRVVLETLSGI................. 314
377 2.000e-77UniRef50_A0A0F5FKK0 Arginase n=18 Tax=Proteobacteria TaxID=1224 RepID=A0A0F5FKK0_9RHIZ  ali  27  28........................................................................................................MGPEALRVAGLAEALMDL-------------DHAVADHGDLTSPSTHPSSARMPEDVLEMAARISDAGHAILQSGHVPVFLGGDHSIAMGTVSAVARRQKPVHVLWIDAHADYNTPQTSPSGNLHGMPLALLCGE--PGFDEAFQGDWLGRIDAHNVTILGARSVDREERRLVQARGIEVIDMRKIDQIGVVAAVQKVIDK-AKAAEAHLHVSLDVDSLDPAIAPGGGTLVPGGLSYREAHLVMEMLHDCGLVGSLDVVELNPFLDHGGKSAT---------------LLVDLVASLFGRSIM 311
378 2.000e-77UniRef50_A0LG67 Agmatinase n=9 Tax=Bacteria TaxID=2 RepID=A0LG67_SYNFM  ali  17  29..............................................................................CAFENAGAVIIPVPYDATTTYRAGTREGPRAILAASRELEPYDEETCTEAYRHG------IATLEELPVV------VSSPRDMLDSVRVVGAQV---LRSGKLPVLLGGEHLLSLGMIEAAADHFGDLSILHLDAHADLR-------EQYQGSPYSNACIMRHGAALAP-------------VVQVGIRSLTAEEHEFIRAKKIPCFFAHDLHRDP------SLYARVIPCLGKRVYLSIDLDVFDPAVMPSVGTPEPGGLSWYEVIDLLRAVFRERQVVGFDVMELLP----------------VPCFAAPDFLAARLVYKLL..... 295
379 2.000e-77UniRef50_A5GWX2 Agmatinase n=487 Tax=root TaxID=1 RepID=A5GWX2_SYNR3  ali  18  88..................................................................................EFDVAVVGIPHDCGTTYRPGTRFGPQGIRRISALYTPYNYE-----MGVDLREQITLCDVGDVFTIPANN---------EKSFDQISKGVAHVFASGAFPILLGGDHSIGFPTVRGVCRHLGDVGIIHFDRHVD--TQEIDLDERMHTCPWFHATNMANA--------------PAQNLVQLGIGGWQREGVKVCRERGTNVLTVTDITEMGLEAAARYAIER-ATDGTDCVYISFDIDCIDAGFVPGTGWPEPGGLLPREALKLLELIVRNVPVCGLELVEVSPPYDISDMTSLMAARVICDTMAHLV................ 369
380 2.000e-77UniRef50_A0A2W4HVX9 Agmatinase n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4HVX9_9BACT  ali  17  39......................................................................FFGLPEEHSNEETSQAVIIPAPYENTTSYGRGTKNGPKAILDASQQVELFDDELWVEPYRVGIHSGAEVK-------------MAPVVSETEAPFQELTDAVKAQLSRGKFPIVLGGEHALSIGPVRACMERYPDLSILQVDAHADMR-------KSYDGNAYSHASVSYHLYKMLPKPA----------LTNVGVRNISAEEVEWMEQENVKIFWARQQKTWNFQEIVN--------TLSDNVYLTIDVDGLDSSIMPSTGTPEPGGMDWYQLMDLIKTVCVRKNVVAADIVELSP----------------IPKLHGPDFLVAKLLYKLIGYKF. 322
381 2.000e-77UniRef50_A3LWL7 Agmatine ureohydrolase (Agmatinase) n=37 Tax=saccharomyceta TaxID=716545 RepID=A3LWL7_PICST  ali  17  37..............................................GSSPSLKEMWDDLWPFQGINTFAHLDHHKCLLEPGNTYDVALIGVPFDTAVSYRPGARFGPRAIRAASQRQT--SLRGYNQRANFNPYSWAKIVDCGDLPIT--PMDNSIAFTQMTKGFEELLLRRSSNSSSELPPVALGGDHSVLLPHLRALHEVYGRINVIHFDAHLDTWAPDKYPSWHSDQSEINHGS--------MLWKAHHEGLTSHHN-VHAGLRTSGLEDYEDDDSQHFIRIDADDIWLKGPQWVVQKILDTVPD--DSPTYISVDVDVLDPGFTSGTGTQEPGGWLPRELLHVLRSI-EGLTVVGGDVVEVSPAFDTAEITSTNGAQIAFEIITSMVK............... 372
382 2.000e-77UniRef50_A0A1G8S5T5 Agmatinase n=4 Tax=Bacteria TaxID=2 RepID=A0A1G8S5T5_9RHOB  ali  19  36.......................................................................FMRRRYTKDLSGADVAVMGVPFDLAVSSRTGTRLGPRAVRSGSSHIAWSAPW----PWTLDPFEALSIVDYGDCELDTGYPH--KVPGQI-------TEAARAVLAQETALLSIGGDHYITYPLLKAHAEKFGPLSLIQFDAHTDTWADE--PDRIDHGTMLWHAT--------------REGLVDPSTSVQIGIRTHNPEP------LGFNIIDAIEVQRLGPQAVVEKVRAIV---GARRCYLTFDIDALEPASAPGTGTPVIGGLSPFQAQEILRGL-EGIDLVGMDVVEVAPSYDVSEITAIAAATIANDLLCLYAAARAK........... 321
383 2.000e-77UniRef50_C0RIC4 Agmatinase n=613 Tax=root TaxID=1 RepID=C0RIC4_BRUMB  ali  21  47........................................................................................WGIPFDAAVSNRPGARFGPQAIRRASAIFDNDPQYPFERDL----FENLAVIDYGDC---------LLNYGNHTKTPSTIEREAAKILKSDAFLLTLGGDHFITWPLLKAHAAKYGPLALVQFDAHQDTW--FDDGRRIDHGSFVAR--------------TARDGIIDPDLSIQIGIRTHAPED------CGIRIIYGHEVEDMPAAAIADAILKR---TNGRKAYLTFDIDCLDPAFAPGTGTPVAGGPSSAKMLSVLRKLTA-LDFVGADVVEVAPAYDHADITAIAGATIAMYYLGLLGE............... 311
384 2.000e-77UniRef50_A0A2G9MN50 Agmatinase n=3 Tax=cellular organisms TaxID=131567 RepID=A0A2G9MN50_9ARCH  ali  20  18....................................................................................QIVILPAPFDGTSTYGKGADKGPAAIIDASPHLELYDVETQTEVWKKGIFTAKTL----------------KFNDDPEEVVNMVHEAVSKFLKDDKLVVVLGGEHSISTGFARALKEKYSRLSVLQFDAHGDTREE-------YNGSKYNHACVMARIRDLNVP------------IVQVGIRAIDKCEVESRKEDQ-HVYFAHDIYSD------DKWMDDAVSKLTDEVFITFDLDAFDPSIMPSTGTPVPGGLGWYQVMKFLEKVSASKKIVGFDVVELAPQKGNNG----------------PDFLAAKLIYRLL..... 277
385 2.000e-77UniRef50_A0A2E6GXC6 Arginase n=3 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E6GXC6_9FLAO  ali  27  18...........................................................................................................AGTRGASKGFELKSAAEAAGSKLFSDYEIISIKDENNSLLKNINFPSAKRIQSIYEVLNRVKKTVNDEVKQNHFPLLISGDHSISMGTISGIKSAFPNIGVIWIDAHADIHTPFTTPSGNMHGMPIAASLGLDNFSCASNTLGGNTPNLEPKNIVYVGVRDTEWEEDKLITKLGIHKYSVDFIRRNRGIKSAETILKKL--ENVDLIYISFDVDVLDNSLSTGTGTPVPNGLFLNEVKSLISELSKSKKLCCFEIVEINPTIDNKGNLMAEMGLEVLETLIQCLKT.............. 318
386 2.000e-77UniRef50_Q3J2B4 Agmatinase n=10 Tax=Rhodobacter TaxID=1060 RepID=Q3J2B4_RHOS4  ali  20  53..........................................................................................VAFDQAVTNRTGTRFGPRAIREAST-LQPYDRPFG---WGFDPLEELTVVDYGDLAFDYART---------AEFPARLTAHVAGILAAGAGALTLGGDHSITLPILRAHAAVFGPLSVVQFDAHSDLWVDD-DPGRIDHGTFM--------------YKAVKEGLVDPARSVQVGIRTDTPDW------LGMNVIDARTAHEQGPAAVAARVHAIV---GHHPTYLTFDVDALDPAFAPGTGTPVWGGLASWQAAAILRDLA-GLNLVGGDVVEVSPPYDPSGITAVAGAHVAYELICL.................. 313
387 2.000e-77UniRef50_A0A0K8L5A7 Putative agmatinase 1 n=4 Tax=Aspergillus TaxID=5052 RepID=A0A0K8L5A7_9EURO  ali  21  125.................................................................................................................SSSRKLGFSGGYNVPLEANPFSELKVLDCGDIPVTS--YDNAWAIRQIEEGHNSTNADAEGLSRAGKRVITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDTWKPKVFGGSPSQVAAINHGT--------YFYHAAMEGLLKNDTNIHAGIRTTLPSDYENDGYCGFEIVEAREIDTIGTDGIIKKIRDRV--GTDNPVYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGL-DGLNFIGADIVEVAPAYDTNELSTMAAADVLYEVLTIMVK............... 404
388 3.000e-77UniRef50_A0A2E3UWH8 Arginase n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E3UWH8_9PROT  ali  26  20..................................................................................................NIPGASLGPSWLRAASLHEILHAVGLETSDLG-----DLTVVDRG---LVGKEHIADQYRLLLAELLQNLAERTYLSMKNNNKPLILGGDHSLSIGSVGGVQKYFKSLGLVWFDAHADMNRPESSPSGNLHGMPVSVLLGKGHEHFTDI--IARSSFLLPENIVLIGLRDVDNKEQQILEKSGVLYFRMDDVFKLGIESIMSKTVNHLKEK-VDAVHISFDMDAIDPLYAPGVSTPVPNGLMVKDALLALEMLSSAIDVQSMDLVELNPLKDQDQKTAQLAVDLIKSAI.................... 301
389 3.000e-77UniRef50_A0A0N0K6Q4 Uncharacterized protein n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0N0K6Q4_9PROT  ali  26  39..........................................................................................................................................MVDRGDVQGPTRDETGSRSVRETAAWCTAVRNAVSGVFADGGLPVMMGGDHAMALGSVAAAAEHGKNFFVLWFDAHPDFNTPETSPSGNTHGYPAALACGIGHPAL--LRVGAFTPLLRPDRLVQFGIRDIDEGERANLRRSGIEFHEMPAVRERGLATLVAHTISRIQAAGGGHVHVSFDIDALDPSVAPGVGTPVPDGLTLDEAVDALRLLGASGLVQSLDIVEYAATQDQGNRTAHVVEHLLAGLMA................... 294
390 3.000e-77UniRef50_A0A0F2QBW8 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium BRH_c20a TaxID=1629719 RepID=A0A0F2QBW8_9CLOT  ali  19  28.................................................................................WEANAAVFGVPFDASAGYRPGARFGPRSIRDLSTRLCFFESGYWDIDLKKRFLENAVLVDCGDVDVISVNS---------EYTFKETVKIVEKIIKKGAIPVALGGDHSISIPCIEGFKNQ-GPLDIVHLDAHLDLRD-SLLGAKHGHSSVIRRAMEMEHV----------------EKVASVGIRGLSEDDYYWAKEQGNQIISYGEFKQAGLESVLAS-LDYMKN----NCYVTIDIDVLNVSEAPGTGTPEAEGLTYTELKKLLQGLASTKKIVGFDLVEVNPLFDPTGITSLAASRLIIEFLGAIIK............... 313
391 3.000e-77UniRef50_A0A2A5NX52 Agmatinase n=1 Tax=Candidatus Geothermarchaeota archaeon ex4572_27 TaxID=2012530 RepID=A0A2A5NX52_9ARCH  ali  16  28.....................................................................................FVVLGVPFDSTSTYRPGSRFAPYAIREASINIEGYSWRYGVDVGEV------KVHDLGDLLV---------ALGDIRETISRVERVVRALRGAGKLPILLGGEHTITYGAVRGL----GGAAIVCFDAHLDMRDEYP------QGVRLSHATFMRRLIEDY----------GPDSVVMVGVRAACREEVEYARREGVEVITSRECLREGPSRVAERVRGRV--EGHDKVYISVDIDVLDPSYAPGVANPEPMGLSLEGVLEVLSPILDG-RVVGLDVVEVCPPYD-NGLAAIHAAKLLFEELASLSR............... 295
392 3.000e-77UniRef50_A0A0D2XKS3 Uncharacterized protein n=1 Tax=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) TaxID=4  ali  18  567......................................................KWGFDWAFGGIGTFAHLNHVKCLTEPTEPYDIAIIGAPFDTAVTYRPGARFGPRSIRHASGRQ--HSLRGYNPRADINPYQWAKIVDCGDIPITPIDNDIAQ--KQMTQALEQMRKTVSSI-SSKPKLFTLGGDHSLTLPALRALKKVYGDIQVLHFDAHLDTWNPHAYPS-YWGTTPFNHGS--------MFWLANQEGLLSNSSSVHAGLRTTGIQDNEDDTAQNWIRFSADDIDKIGTQGIIGGIMKLL---GTENVYLSVDIDVLDPAFAPGTGTPEPGGWSTREFINILRGI-EDLNLVGADVVEVSPVYGAGEETTFAAAQVVYEILTSMVK............... 898
393 3.000e-77UniRef50_A0A2H5W3N2 N(1)-aminopropylagmatine ureohydrolase n=9 Tax=Bacteria TaxID=2 RepID=A0A2H5W3N2_9BACT  ali  18  24....................................................................................RILIWPVPFEATTTFLKGTALGPHAIIEASRHLELYDEELDAEVYR------LGIHTLPPAPVN----------ASLEEVIERLYHEARRWVETGKFLCTLGGEHSITSPIVRAFAERYPDLSVLQIDAHADLRQ-------SYDGTPYSHASVAAR-------------LVEICPVVQVGVRALSLEEARARHQLPVTTFFAKDLHDP------RAWIPQVVECLSPQVYLTIDVDGLDPSLIPATGTPEPGGLSWSETLRLIRQVAEHRTIVGMDVTELCPMPGHE----------------ASNFIVAKLIYKALGYVF. 287
394 3.000e-77UniRef50_V2X2K0 Agmatinase 1 n=17 Tax=Agaricomycotina TaxID=5302 RepID=V2X2K0_MONRO  ali  20  53............................................................FSGITTFAKLPWVQCFGKERDVAFDIAFLGAPFDTGTSYRPGARFGPAGIRAGSRRLTLY--GGYNVPLGTNPFSGLRIVDCGDIPVT--PYDNKYAIKQIEDGHKSLLHRTGKPLKHHPRIITLGGDHTIVLPLLRSIYTAYGQISVIHFDSHLDTWKPSVFGGAPSDQAAINHGT--------YFYWASQEGLIKNGSSIHGAIRTTSLDDYDNDDASGFLRIEAREIDIIGTDGIIQKIRETV---GNAPVYLSIDIDSIDPAFAPATGTPETGGWSTRELRTILRGL-DGLHIVSADIVEVAPAYDTNELTTMAAADVLFEVLTVMTKT.............. 391
395 4.000e-77UniRef50_A0A256Z2Z8 Agmatinase n=1 Tax=Desulfurococcales archaeon ex4484_42 TaxID=2012520 RepID=A0A256Z2Z8_9CREN  ali  16  1.............................................................MKELYLLRNPYVFNGVECRREDSIFSLIGVPFDSTSSYRPGSRFAPQRVREASQNIELYSLRSGL------DMERVPIYDEGDLAVVHG---------DVYEVMKRLEYVVEDIVNEGKVLIALGGEHIITYGILRGFKK---PTCVLYFDAHADLRDE-------YLGYKLSHACTLRRLVE----------IVGPDKVFIIGLRALCSEEVDYIRKSGIKYLTSLMCQGLSFMDVVNNVRKFL--RGCENVYVSIDIDVIDPAYAPGVANPEPEGLSPTYLLNLLSEVINES-VWGFDIVEVVPPIDPSGITSVLAAKIINELAS................... 289
396 4.000e-77UniRef50_A0A1F9FD69 Agmatinase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9FD69_9DELT  ali  20  13...........................................................................PRFSDYKTAKTVILPAPFEASTSYQEGTKLGPKAILEASQQVELYDIELARDCHTQGIHTLETF----DFSKTDAPT-----------ACKMLYEKTKKVLEDGKFPIMLGGEHTISYGMFEALFEKYPNLSIFHIDAHTDMR-------EAYEGNPYSHASVLYLMRK------------SCKKTVSIGIRSMCEEERLYVNENKVPVYYDFQTQKTGFNP------KDLLKHLTQDVYVTIDVDGLSPTLVPSTGTPEPGGLGYYETLDILREIFKNKNVVGCDFVELMP----------------IPGLVHGDFAVAKLIYKCIGYK.. 286
397 5.000e-77UniRef50_A0A1V5SX04 N(1)-aminopropylagmatine ureohydrolase n=1 Tax=bacterium ADurb.Bin270 TaxID=1866926 RepID=A0A1V5SX04_9BACT  ali  19  14................................................................................YEESKVVVLPIPYEATVSYGKGTALGPAAILDASTQVELYD-----EQTGCEPYQ-IGVATLPPLDFSGISHERIGDLITP---------AVSKILADDKWPLLLGGEHSITPPVVKAVQKKFPDVTVVQFDAHADLRD-------SYEGSKMNHACAMARVREI------------VKDAIQIGIRNLSEPEAKLAREKKYKIFYAHQIHHD--RGWIKKALDSIKSEE---VYITFDLDGFDSSLMPATGTPEPGGIGWYDAVDFMNELFAKKTVVGMDIVELAP----------------IANLHACDFLAAKLGYKAIAY... 282
398 5.000e-77UniRef50_A0A2E0BLS7 Agmatinase n=1 Tax=Rhodobacteraceae bacterium TaxID=1904441 RepID=A0A2E0BLS7_9RHOB  ali  19  17.......................................................................FFRRDFGTDFGNADVVIQGLPYDLGVSNRPGARFGPRSIREASCQLAWGE----VWPWGFDPFDKIAVMDTGDIEYS---------YGNSKEFFRNAAKQTNKIVSAGAIPFTLGGDHSISSALLMEVSKAHGPVSLLQFDAHADT----GIGPKIQHG--------------AMFKIAADAGTINPAKSIQIGLRTP------FNSTLGFNTITAVEAMYQS-SKILSERIETVI--GKSACYVSIDIDCLDPSHAPGTGTPIPGGLTTLQLLEILRALGGTKNIVGLDLVEVAPDYDHAQITSLAAAQICQESLCLISRT.............. 299
399 5.000e-77UniRef50_A0A1Z9AJM6 Agmatinase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z9AJM6_9GAMM  ali  20  50...........................................................................................PFDLATTFRPGARFGPQAIRAASVQLAEIADHAF--PFNDDPFSHLAVADYGDVDFVSGYPDQAVAV---------IEAHAQKLLAEDVTMLTFGGDHFVTYPLLKAHAKKYGPLSLIHFDAHVDTWPDD--GEQLDHGSMFLRAL--------------REGLIDPHTSVQIGIRSFSEDDY------GFTVMSSPWVAENGVRATVLEIQKVV---GRRKAYLTFDIDCLDPAFAPGTGTPVAGGLSSLDALTILRGLGQ-IDIVGMDVVEVAPAYDHSEITAIAAATLAHDFICLKA................ 312
400 5.000e-77UniRef50_E9EAG6 Agmatinase n=2 Tax=Metarhizium TaxID=5529 RepID=E9EAG6_METAQ  ali  16  11.............................................ASLEASLEELWGFDWAFSGISTFNHLPHSRCLVNRSEVFDVAIVGVPFDSLVTYRSGAREGPKAIRWASGRHLSG--RSFHPSLHFNPYEWALVLDCGDIPVV--PNDPVLAMEQMGEALTELLSHPTSQASSHPRLVILGGDHSIVLPMLRALNRVRKPVALLHFDAHIDTMAPDSYPRKAWK----SQASEINH--GTVFWLAAQEGLLRPGHLVHAGVRISSLQDFHSDESIGFLRIAAEEMDDVGPAAIIQRIRNTIGQ--DAPVYVSIDIDVLDPAFAPGTGAPETGGWTSRELMKVMTVLSD-LNVVGVDIVEVSPAYDSAGDTAFAAANLAYEAISLMIQ............... 351
401 6.000e-77UniRef50_A0A1F3SVX8 Agmatinase n=1 Tax=Bdellovibrionales bacterium GWB1_55_8 TaxID=1797386 RepID=A0A1F3SVX8_9PROT  ali  17  28.....................................................................................VVLLGIPFDGGTSFRPGSRFAPRAVREASVLSRNY-----HPEMAVHVYERLNVVDGGDVSVNPLNF---------QKTMASIEAEVTRVRRAGARSICVGGDHSVLLPELRALHRTRKKTALIHFDAHTDTAD-QAWGEKYHHGTPVRRAIEEG--------------ILRGSRVFQIGIRGTSKDQESFVRESGIHVLGIDDFHDRKYRAFFSKLKK---AAGRSPCFLSFDVDVLDPAYAPGTGTPVVGGMTSFDALRALRGLA-GLNIAAADVVEVSPPYDHAQLTSLVGAAVIFEILALMA................ 312
402 6.000e-77UniRef50_UPI0004249251 agmatinase n=2 Tax=Alicyclobacillus TaxID=29330 RepID=UPI0004249251  ali  20  10...........................................................................YSNPDYRAASVVLFGVPMDYTVCFRPGARFGPAHIRQASYGLEPYSLQFGDTLL------HRSYHDAGDLVL---PFGNAK------DSLLRTETYVSGLVKDGKTPFALGGEHLISLPIIRVLHEHHPDLHVIHLDAHADLADVYFGES-------VTHATVMRRVLD----------FLPHNQFAQFGIRSADWSELEFAAARPLRQCTMD------VAEPLAQWLAEVPQAT--PLYVTVDIDVLDPAFAPGTGTPEAGGISPRELFAAL-GLLRGRNVVGADLVEVAPQLDASGCTAVLGAKIVREML.................... 280
403 7.000e-77UniRef50_D8FAF1 Agmatinase n=3 Tax=Proteobacteria TaxID=1224 RepID=D8FAF1_9DELT  ali  20  32.....................................................................................FHVIPVPYEKTVTYGTGTRKGPAAILEASQQLELYDGKGIPAEKGIYT---DTVHSCG---------------GEEDVVLDALAVRVEGILAKRKIPLILGGEHTITAGVLKGVARLLGSIGVIQFDAHADLRD-------RYEGSRYNHACVMRRVLEMG------------HRLFQIGTRSLSMEEAVYRKKRGLDTLDAEDIAKSGIPETL------LPENFPDNVYLTIDVDCMDPSLMPATGTPEPGGMTWYQMMEALSRVCRQRKVIGFDIVELAP----------------MTGFHAPDYTIARLIYQMMG.... 290
404 7.000e-77UniRef50_A0A235E5Y8 Agmatinase n=2 Tax=Sphingobacterium cellulitidis TaxID=1768011 RepID=A0A235E5Y8_9SPHI  ali  22  81...................................................................................YDVAFVGAPFDAGTTFRPGTRFGPEAMRQISKLYRTYHFEA-----GIDLAESISMCDLGDIY----------SIHNLEKHNAQLEKALHHIISNGVFPVVLGGDHSIAYGTLRGVAKAEGKVGVIQLDRHLDMQPSEMDEK--MHDTPLFHAS--------------KLPNIDGKNIVQIGIGGWQNDVKGSIKKNGNTILTMADVDEYGIAKIAEIALEKAWADGVKAVYLTVDIDSVDSGISMGTGWPEPGGFLPREILQLVKKLAEPG-LIGMELVEVSPPYDHHNQTALMGTRIICDTLSSLV................ 359
405 7.000e-77UniRef50_W0U7R3 Agmatinase n=6 Tax=Firmicutes TaxID=1239 RepID=W0U7R3_9FIRM  ali  20  29................................KRAVELG---LEPADSIKSEGMSCFARTNLGPTYTSHETFLRSPFCHKVSEYDVAVVGIPYDSGASNRSGTRLGPAGIRHASSQISPF-----NPDYGVDLYENIKLCDAGDIYTLP---------ANAEKTFDQITKGIGYIFSQGVTPIVLGGDHSTTFPTLRGISKIDGNIGVIHIDRHSDC--DAIQMDEKMHGTEWYHST--------------HLPNLSAKNLVQIGIGGCCKSWSKFTRDSGCTAISMEDIDKYGIDKVAELALD-IAWKGCKAVYVSLDIDVLEAAFCPGTGTPDFGGMLPRELLRLLKLVTAPG-ICGMDVVEVSPPFDVSEITSLAASRCIINVLCNLA................ 357
406 7.000e-77UniRef50_UPI0009FB181D agmatinase n=1 Tax=Syntrophomonas palmitatica TaxID=402877 RepID=UPI0009FB181D  ali  21  25...................................................................................CNKVIMGLPMDSTTSYRPGTRLAPYRVREVSDAVEEYSVYQD------RSLAEINFYDAGDVCIP---------YGNVVESLQRMEQAADCFLGQGKKLYCIGGEHLVSLPIIKAYHRHYPELVVIQMDAHADLRSD-------YLGEPLSHATVMRHVLEE----------LGERRLFQLGIRSGTREEMMYAREKSNLYLD-------SFLEVLEEVKVKI---GERPVYLTLDIDVLDPAFAPGTGTPEAGGISSRDLFKAFHEL-KTLNIAGFDMVEISPPYEKGDNTSILGAKIMREALLA.................. 287
407 7.000e-77UniRef50_A0A1Y0N5M4 Guanidinobutyrase n=4 Tax=root TaxID=1 RepID=A0A1Y0N5M4_9BURK  ali  21  26.....................................................................................YALAGIPFDGAVTNRPGARFGPQEIRRASLMLCDGL----HPVFEVSPLAHLG--DAGDMAL-----PNASPLKVVREAIETQA----ALLMDKHHCVFLGGDHSVTLPLLRALKRRHGQVALIHFDAHCDTW-EDHFGEPSGHGT--------------WTFEAIQEGLVVPEKTVQIGLRSGERAAREYVKDQGGLIFTARDLRGQGLAGVISQIRERL---GDTPCYLTLDIDCLDPAFAPGTGTPEPGGMTSSQVLTLLEELAP-LHFVGMDCVEVAPAYDHAELTSNAAATFVWTYLS................... 298
408 7.000e-77UniRef50_A0A1E7ZAP5 Arginase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1E7ZAP5_9ALTE  ali  18  121...........................................REPGPFYLSRYATAGRQQPGVQTFVGAPVAIYPDDLIAGKVDVAIVGAPLDMGSYYRG-QRFGPQAIRSG------RYRGGIDMATLVDPSKVLSIVDYGDIAIDNMSTEI---------SIQHVRERVREIAETGTIPFIVGGDHSLEYPDVAALADVHGKFGVIHFDSHYDA--GKGSVHWMTHGQPVYRIVKEGH--------------VNPENYIQVGLRGPSPEGFEWMRNNGMRYHTKAEVEKKGWDAVVEEALTE-ARNGPEKLYISFDVDVIDPAFIPGTGTPVPGGLTMREAIPLVRALCAEHDIVGFELVELDPLLDPTYRSALNAGYIMQACLTGVA................ 439
409 8.000e-77UniRef50_A0A2H0P5N9 Agmatinase (Fragment) n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_49_13 TaxID=1973976 RepID=A0A2H0P5N9_9D  ali  20  2.............................................................RRDIRAMIYKGDIPEKFLKYDNAHFVIVPVPYEKTTSYGRGTCKGPGAICAASEQVELFDEELQKEVYQKGIATVKEVTDL-----------------------DELQKVTEKILEDKKFPIVLGGEHTISAPPVRAFKKFYNDISVVHFDAHADLRDE-------YNGSKLSHACVMRRVVEEKVP------------LVQIGIRNHSLEEAEVIKKEGLNRFYSHLIH--GSDYWMEEAVALLS----KNVYISFDVDAFDASIMPSTGTPEPGGMNWFQVVKFFRLLCKSRNVVGADFVELAPVKGNSG----------------PDFTVAKLIYKL...... 278
410 8.000e-77UniRef50_A0A2E2UA25 Arginase n=2 Tax=Halobacteriovoraceae bacterium TaxID=2026745 RepID=A0A2E2UA25_9PROT  ali  30  49.........................................................................................................................................DFRDIGNVFESSDELSITKKLKKLSHYSERLSEVIFRELSQDRFVLTIGGDHSIAAGTLAASLQFDENIKVLWVDAHADLNTPRTSPSHNTHGMPVAIAMDLVNEV-SENNLFSFLPKLKPQNIAYIGLRDVDPGERAFLDRFNIKSYDAQDVHRLGIEQVLTECKQYLDPDSTNNIHLSFDVDAIDPLYFPATGTPVPEGLSLKDGRRIIEFLNSETNLISFDLVEINPLLGGKEELDQTFASTM-ELLSALKRT.............. 311
411 8.000e-77UniRef50_T0LFC6 Uncharacterized protein n=2 Tax=candidate division Zixibacteria TaxID=1379697 RepID=T0LFC6_9BACT  ali  18  13..........................................................................PPPYSDFKKSKFVILPVPYEQTTTFKTGTKNGPQAIISASREVELFDEELEFEPH------TIGIATLQDMEVTALG---------PEKMSQRIYQTAKKLVSQNKFVIMLGGEHSITYGLVKAYQKKYKDLTVLQLDAHADLR-------ESYQDNKFSHACAMKRVWEICP-------------VVGVGIRNLSEAEFRFVKQKKINLFYARDLQNYGTYY------DEIVNSLSNNVFLTFDLDYFDPSIMPAVGTPEPGGLYWYETLELLKKVIQKKNLVGFDVVELSP----------------LPGNVAPDFLAAKLIYKLISYQV. 287
412 8.000e-77UniRef50_UPI000DBEA13F agmatinase n=1 Tax=Bradymonadales bacterium B210 TaxID=2211119 RepID=UPI000DBEA13F  ali  19  28..........................................................................................IPMDFTCCFRTGTRLGPREIRYFSDNLEDYSVEQRRG------LEADTFYDAGDLELP---------FGNPAQCLDVIEAAVDQILQAGKRPVAMGGEHLVSAGIVRAIAKHFPDAVILHVDAHFDLRHTYAEQE-------LSHATALRLCWNALEMSAED----QPPRLVQIGVRSGPAEEAEFAHRH------IPQIHSESTAELLAELEKVRELWGDRPVYCTFDIDAVDPAYAPGTGTPEPGGLSSHQALAIARFLPSFKHLVGFDLVETSPPLDHAGITSALSAKMIREFMIAT................. 295
413 8.000e-77UniRef50_D2AZZ8 Agmatinase n=1 Tax=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) TaxID=479432 RepID=D2AZZ8_STRRD  ali  15  13...................................VDPSAFPRREPGPINVQRYQFVPAY-SGIATFLGLPLCLTPEDLRAGGVEVAIVGAPVDMGTGHRG-AAFGPRAIRASEWVVAHTPSMLMDSDTRINPFNELIVVDYGDAAVDAM---------SVEDSMEPIRGIVREIAETGAVPVVLGGDHSILWPDAAALADVYGKVGVVHFDAHADC-AESVNGHLASHATPIRRLIEDEH--------------IPGRNFIQVGLRSLDDELLAWMRARGMRSHFMAEIDRIGFPAVLDKAIAE-ALDGPEYLYLSIDIDVLDPAFAPGTATPEPPGLTTRELLPALRRICHETPVVGIEVVEVAPNLDPGNTTAMNARKAIFECLTGLA................ 346
414 9.000e-77UniRef50_A0A2J6W559 Agmatinase n=1 Tax=Caldisphaera sp. TaxID=2060322 RepID=A0A2J6W559_9CREN  ali  24  26.....................................................................................YVIFGVPFDSSTSYKPGTRFGPDSIRQAASSLESNSYFSDIY------LEDIGIDDEGDITPV---------IGDINETMNRVTSITSEIVKENKIPIVLGGEHTITYGVLRGIKKAL-NICLIVIDAHYDLRDD-------YLGLKLGHASVMRR----------NLEILGLTKINYLGVRAYSKEERNYASKNNINTLKPSDIYRLGILNTINTIKRFLSDC--KYIYLSIDMDGFDPSFAPGVGNPEPGGINNVEGLSIVNQLVD-KRLIGADVVEVSPPYDSNDITAALGAKLINEII.................... 294
415 1.000e-76UniRef50_A0A150J7W7 Agmatinase n=9 Tax=Euryarchaeota TaxID=28890 RepID=A0A150J7W7_9EURY  ali  21  16...............................................................................NYENSYFVVLPVPLEKTVSYKGGTSEGPKAIINASQNMELLDEEFFVSPCTKGIHTKNEI----------------NCQQDMETVMQLIEDESYLILKDNKFLCVLGGEHSVSQAPILAAKRLYKDLSVLQFDAHLDLRD-------AYLGDKYSHASVMSRVEEH-------------SKIVQVGIRSFSEEEYEKIKTGRYNIFYAKDIYDN------KTWFNRAIEGLSDNVYITFDIDAFDPSLIPGTGTPEPGGLSWYLVCDFLKEVFFNRNVIGVDVVEVAPQ----------------ENSAVSEFVASKLLYKMMTYKYI 285
416 1.000e-76UniRef50_A0A0G1VFJ1 Agmatinase n=5 Tax=root TaxID=1 RepID=A0A0G1VFJ1_9BACT  ali  15  6...........................................................SEDFSYPRVEPWNFGGLDNQDYKTAQVVVFPVPYDSTTYYMGGAKQGPFALINASRHMELYDLEKGKDVSTVGIF-------------TLEPLEPSKN--SPEETIDRVESVIAKIIQDAKFPLMLGGEHSVTLGCVRAFHKKYGDFTVVHFDAHTDLRDEF-------QGTRFHHGSVMRRTTELGIP------------VTHMGIRSVSEEEMEYLKGKGKEVFYAER----------KHTLEEMINTLRENVYITVDVDVLDSSAMPATGTPEPGGLTWYQIIDAVRAIGAKKKIIGADVVELAP----------------IPGMVAPDFLAAKLAYKIIGFAL. 296
417 1.000e-76UniRef50_A0A1V4XKC2 N(1)-aminopropylagmatine ureohydrolase n=25 Tax=Bacteria TaxID=2 RepID=A0A1V4XKC2_9DELT  ali  17  8...........................................................................PEYTRFDQATFVVVPVPYDLTSTYQSGSRMGPAAILDASAHMELYDEELRRETYLAGIHTLPSLE---------------ADARGPREMMETVRRQIFEVVSAGKIPVTLGGEHSISFGCVQAVQEVYPGLSVLQLDAHADMRD-------SYQGSPFSHASVARRISERCP-------------LVQAGIRSMSAEEAAFLPASAVKTFSADFILDDPDG------CRAIAACLEGDVYISVDLDVLDPAFLPATGTPEPGGIRWNDVLRLIRAVSGRCRVRGFDVVELSP----------------IPGMIASDFLAAKLVYRMMGYAL. 281
418 1.000e-76UniRef50_A0A2T3YXI3 Uncharacterized protein n=1 Tax=Trichoderma asperellum CBS 433.97 TaxID=1042311 RepID=A0A2T3YXI3_9HYPO  ali  16  38.......................................................WGSDWAFSGISTFNHLPHSRCLVNRSEAFDIAIVGVPFDSLTTYRSGTREGPKAIRWASGRHLSG--RSFHPSLHFNPYEWAKVLDCGDIPVVPI--DPVLAMEQMGEALTELMSHATSDKSSHPRLVLLGGDHSIVLPMLRALNRVRKPVALLHFDAHIDTMDPDSYPRKAWK----SQASEIHH--GTVFWQAAQEGLLIPGHLVHAGVRVSSLQDFHSDDSLGFLRISVEEMDDEGPNAIIKKIHDKIGE--DVPVYVSIDIDVLDPAFAPGTGAPETGGWSSRELMRVMTVLSK-LHVVGVDIVEVTPAYDSAGDTAFAAANLAYESISMMVQNEIK........... 372
419 2.000e-76UniRef50_A0A1Y4NSM9 Agmatinase n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NSM9_9FIRM  ali  15  15............................................................DENTYGLAMASFGGIPLKREFDNEDFCVVGIPYDTCTSRRAGARFGPRAIRAGVHSIAGINEKGIYSQDAHYVIRNLKGMDYGNIPVKNGYTEI---------SFQVIYEHMKNILDHGCTPIALGGDHSITYPELRAYAEAGKPVAIIHFDSHNDT-TDTPENRKFTHGTPFRRA--------------FEDGFLDAAHSIQI<