current user: public

If you have questions about the server, please let us know.

Query: 5Y8X Entity 1(prereleased), from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# E-value Template Links and tools%idFirst MRRLAFLVVAFCLAVGCFFSPVSKAEGVMSGGDGDKVAVGKDGMVATAHPLASKIGAEVLKKGGNAIDAAIAIQYALNVTEPMMSGIGGGGFMMVYDGETRETSIINSRERAPEGAKPDMFLDEDGKVIPFSERSRHGNAVGVPGTLKGLEAAHKKWGTKKMEDLISPSIKLTEEGFPIDSVLADAIKDHQDKLSKTAAKDIFLPDGEPLKEGDILVQKDLAKTFKLIRKEGSKAFYDGEIGRAIADVVQDFGGSMTPDDLSRYEVTTDKPIWGEYHGYDIASMPPPSSGGVFMLQVLKLIDDFHLSQYDPKSFEKYHLLAETMHLSYADRAAYAGDPEFVDVPLRGLLDPDYIKERQKLISLDSMNRDVKEGDPWKYEEGEPNYEIVPQPEDKTIGELast
1 0.000e+00UniRef50_A0A0B7FT18 Gamma-glutamyltranspeptidase n=65 Tax=Agaricomycotina TaxID=5302 RepID=A0A0B7FT18_THACB  ali  29  14.......................PTFAFQQFASRRSVVYGRKGVVSCTQPLAAEAGLEILRKGGNAADAAVAVSAALNVTEPTSCGIGGDAFCLFYDASKKTVQALNGSGRSPKALSIDVARKNG--AIGKQLTERDLNSVTVPGAAAAWIDTVASLGKVTFGEVMAPAIRLAEEGAPVSELTANSWKRSEGLIKSSPSGDSMLINGRAPLPGEVMRLPDLARTFRALVDEGKKGFYTGRIAEAIVELIKSKGGVMELSDLAEHDTEFVDPIKYTYAGVTLWEC-PPNGQGITALMALGILEAAPLLEMKHNSVEYLHALIEALRLAFADTQYYVSDPKVAKVPVEEMLSKVYLKSRAENFNSNASIPDVHHGNPTA--STDTVYFSVTDQWGNGCS. 393
2 0.000e+00UniRef50_A0A2Y9BX06 Gamma-glutamyltranspeptidase / glutathione hydrolase n=1 Tax=Georgenia satyanarayanai TaxID=860221 RepID=A0A2Y9BX06_9MICO  ali  38  31.........................HGLPQEYDKEATATGYDGAVASLDPYASLAGLEVLREGGNAVDAAVAASAALGVTRPYDGSIGGGGFFVHYSAETGEVTTIDSREEAWAAMEPDVFL-EDGEPIPFAERRVSGLSQGVPGLVRGWELALSEYGTKSLAEVLEPAVRVAEDGFVVDDEYERRTEDNLEIFRDSSSSATFLVDDEAPEAGTVITNEELADTYRLLGEEGADVFYEGEIAEAIVATVR--PGEMTLADLAGYEALEQEPTVVDYRGLQVYGMAPPSSGGSTVGEALNILEGFDLSAMAEE--EVLHHMAESSALAFADRNTYVGDEAFLDVPLTGLLSQEFADERRELIGERAQARPVPAGDPWPYDHGSTTHLTVADRWGNVVS. 425
3 0.000e+00UniRef50_A0A2E9UE68 Uncharacterized protein (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E9UE68_9CHLR  ali  29  7..............................PPSSRPTAMGFKGMAASAHPFASLAGINILNKGGNAFDAIVAIASTLNVVEPFMSGMGGVGVAMVYNAKQKKLQALNFSGSAPKLADPEKYTAE--------AKSIGPWAPLVPGNVAGWLTIQETLGVLDREEVFEDSINHAKNGFPVTHFHHTSFTNSIPRLIQFPSGEIILNNGKPPNPGTKIVMPELAKSLELVAKNGADEFYRGSIAKKIVASMELYGGLISEEDLDSVKAEWMEPLTIKYRDYEVNTV-PPNSSGFQILETLKILETLSPEKIKFQDPDFIHYFMETTKLAATDRITHGGDQSIKLTPTEKLLSNSYAKYQSSRISNDKVNPDAPQGDLNAYDGGMTTHFAVADKDGNVVS. 377
4 0.000e+00UniRef50_A0A0G9MLF7 Gamma-glutamyltranspeptidase n=20 Tax=Sphingomonadales TaxID=204457 RepID=A0A0G9MLF7_9SPHN  ali  33  19....................QTAPAPDPLSTASAVAAAPVGTGMVSAADPRAAAAGAQILRQGGSATDAAIAVMLALTVVEPRSSGIGGGGFYLRSDAA-GNVVSLDGRETAPSAATPDWFLDENGERLGYRDVVTTGLSVGVPANVALAAEAHARYGTLPWADLFQPAIRLASDGWILTERGANFAERVGERATHDLSLPTFDAEGTVLPVGTRITNPDLAITLQNLAAEGPGWLYSGESADALATHIAANPGRMVPADIASYRAIWRDPVCGEYRGYRICGMGPPSSGATTVYAILVQLESYDLSALGPDSPTFWHLFAESQRLAYADRELYLADGDFLQVPVDGLMDRHYLAERGMRIDTAARMEIVEAGEVPEPEENGTSHFSIVDADGNVVS. 412
5 0.000e+00UniRef50_D5RR14 Gamma-glutamyltransferase n=38 Tax=Bacteria TaxID=2 RepID=D5RR14_9PROT  ali  30  6...............................SPGRSPVLAMNGMAATSMPAASLAAIDILRQGGNAMDAAIAAAAVLAVIEPQSTGIGGDNFCLYAPAGTGQVVAMNGSGRAPAGATPEKLRADGLTAM----SATSAHSVTVPGAVSAWDKLNKAHGRLSLAQILAPAIKLAEEGHPVHARVASDWEAAADKLKHEATARHFLKDGKPFAIGDKFAQPALARTLRAIGEKGARAFYEGEIAADMVATLRAAGGTHTEADFAADVAEFVTPIQTRWKGLDIFQC-PPNGSGLLVLQMLGVLGQMETPEGGPLSATRLHRHVEAARLAYRDRDGFLADPSQVEVPVAKLTSDEYTTQLRGLIRDDVAMRELPPAGMAAPKHRDTVYLCVVDAEGNACS. 371
6 0.000e+00UniRef50_A0A254N325 Gamma-glutamyltransferase n=2 Tax=Burkholderiales TaxID=80840 RepID=A0A254N325_9BURK  ali  30  8..RTLRLAPLLGAVWLAPALALDQPEAATTRTAGGLTAPAKRFAVTAANPLAVDAGIEMLKAGGSAFDAVVAVQAVLGLVEPQSSGIAGGAFLLHWDG--RQVQALDGRETAPAAATPALFLKADGKPLAMRDAILSGLSTGTPGVLAMLAEGHRQHGQLPWARLFEPAIRLAEQGFAVSPRLHELLAGETALRQDPIAAPFFYDGGAPLAVGTVLKNPAYAAVLRGVAKQGVKAFYEGPVAADIVRRVKARPGLLSTDDLAAYRPVVRPPLCNDWRSYRICGFGPPTSGHLTLMEILGLLDTQPAARAARGTADWMHAYAESAKLAFADRAQYIGDPAFVTAPWQNLLASAYLKQRGALIGA-RAGGIATAGNPAPVQESGTSHVSVVDAQGHAV.. 417
7 0.000e+00UniRef50_A0A1Q9NWJ4 Putative gamma-glutamyltransferase YwrD n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1Q9NWJ4_9ARCH  ali  33  2.............................................ASSQPLAAEAGLRILQKGGNAADAAVATAAALNVTEPTSTGLGGDMFALYFDNKPKKVFGINGSGRSPKDLTLNKVNQDGYL---DDLPIFHAHTITVPGAAAGWIDTIEKYGTLSMSDVLRPAIELARDGFPVSDITARAWEAGAKKQLSPNSNEMLLNH-HAPKVGEMMKIPTLAKTFEEISEHGKSGYYEGRVAKSIIEMVQSKGGVMNLDDLKSHKTTFEDPISVNYKGIEVYEI-PPSGQGITALIALNIIEEIELHE-NPLSVEYLHTLIEVMRIAFADAREYVADPQKVEVPILGLLDKKYAKERRKLFDKNRASLDVVKGSPMSA--SGTVYLSVVDQDGNACS. 347
8 0.000e+00UniRef50_K3Y657 Uncharacterized protein n=7 Tax=Mesangiospermae TaxID=1437183 RepID=K3Y657_SETIT  ali  27  37.................................RREVVTSPHGAVAADDGRCSRIGRDALREGGSAVDAAVATALCLGVVSAASSGVGGGAFMLVRLAD-GTAVVYDSRETAPLAASKDMYGGNA------TLKARGALSIAVPGEIAGLYEAWRRHGKLPWKRLVLPAAQLARA-FRISPYLQMQMEATRDILANKGIRAVYAPGGDLLKAGEVCRNVRLARTLRAVAEQGPGVFYDGKVGKRLVKDVREVGGILTAEDLKRYQVKVRRPLTENVMGLQVVTMPPPSAGGAGMLLILNILAQYGIPS-GFAGSLGIHRLIESLKH-YMAVKMNLGDPDFVNDNVSDMMSQTFAAELKKTIYDNMTFDPKHYGGRWDLQDHGTSHLSIIDSERNAVS. 394
9 0.000e+00UniRef50_A0A2E4PXD5 Gamma-glutamyltransferase n=11 Tax=Bacteria TaxID=2 RepID=A0A2E4PXD5_9CHLR  ali  31  4............LTIKVWTSTHHWSISVSYFQSRRSAIVARKGAVATSQPLAAVAGLQIIKDGGNAVDAAVATAAVLNVVEPMSTGIGGDMFALIWDKNERKVMALNGSGRQAAAANVNDVQKAGFDSIPNNL-EGSQFAVSVPGTVHGWETALNTYGRMSLKEVLKPAIDYALKGYAVSEVIAHNWGSIETLLNYRPSGQELLPGGGPPEYGEVVTLPELGRTLQIIAEGGSEAFYKGEIAKKTAAFIQSEGGWLTETDFANHHSDWDEAISTNYRGVDIWEC-PPNGQGIAALIALNLAEGFEIASMDAQSADRYHFLIESMRQGYADAFQYVADPRVAEVPIGPLLSKDYANRRRAHISDLSTNPNVSYGDPMG--GADTVYLTAVDEEGTACS. 388
10 0.000e+00UniRef50_A0A149VTW8 Putative gamma-glutamyltransferase YwrD n=4 Tax=root TaxID=1 RepID=A0A149VTW8_9PROT  ali  32  8.............................PYLSTRAPIFARN-IVSTSHPLAAQAGLRILQQGGNAVDATIAAAAVMTIVEPVSNGLGSDCFALVWDGQS--LQGLNASGSAPQAWDLNYF---NQKYTPGTRPKRGFDTVTIPGMVKGWSLLHERFGRLPWQDLFSSAIDIAKRGFMVTPVVAKKWQLAVPELNQPGFKEHFMPFGRAPQTGERFTIPSIAKTLDLIAKEGADCFYQGEIAQHIARFAREHGGAMTLDDLSNYSALWVEPIHTSYEGYEVHEI-PPNGQGIAALMALGILKHCPIKDYAVDSVESLHLQIEAMKLAFFDVYQHVADPSSMTVSVEQLLDENYLKERAKLISLDKA--STLKGSVPAL--GGTIYLTVA......... 357
11 0.000e+00UniRef50_UPI000B90E9E8 gamma-glutamyltranspeptidase 1-like n=2 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90E9E8  ali  30  1..........................................................MLEKGGTAVDAAIAAFLCVGLYNCHSAGIGGGFFLLFYNAKAGTVEMLDARETAPLAAFEKMYENET-----EDASTSGGLSIAVPGEIAGYWTAHQRYGVLPWTDLFQPSIKLAEEGIVVSSALAYAIKRESYMKNDPSLGEIFLNEGEILKEGDTLVNIKLAETYKKLAEGGENAFYKGDLADDIVADIADRGGIITKADLENYQVKRKEPLMIELDGMKVYSPPPPGSGAVSSL-ILNIVDGYGIGPDSIATIDTTHRMVEAFKFAYAGRS-FLGDEDYVDVKVANMTSQAYADSLRAAIDDNMSHDPSYYTAYYNQPDSGTSHLSVVDTHGNAV.. 339
12 0.000e+00UniRef50_A0A2N2YV68 Gamma-glutamyltransferase n=2 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A2N2YV68_9BACT  ali  37  29.......................................GKNGMAATAHPLASQAAIEMLQKGGNAVDAAIAATFVIGVVEPDGSGIGGGGGMLIYLKDKNQSFYINFYPRAPENIPANF---------NSSNDRLTGRSICIPGTVAGLTLAHKEFGSLPLSTLLGPAIRYANDGFAIDATLGSLIDNSEALAKNKATASVYLDEGFPKMEGEILIQKDLAETLSVISKKGFKGFYKGSIAKDMVEGINKGGGNFTLDDFKNYQAELTEPVKGNYRGYEIISAANPQS-GVSIIEGLNILENADLNRMGHYTAKTLHLLAETFRKIYTDRYYFIADPGFVDVPMKGLLSKEFALERFNAINPSMPVPDTEIGNPIKYQNGETTHLCVIDKDGNAVS. 397
13 0.000e+00UniRef50_A0A2E7VUS6 Gamma-glutamyltransferase n=4 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E7VUS6_9CHLR  ali  29  7..............................PXSTRPTAMGFNGMAASAHPYASMAGINILKKGGNAFDAIVAIASTLNVVEPFMSGMGGVGVALVYNSKEKKLRALNFSGSAPKLADPEKYTEEAKN--------IGPWAPLVPGNVAGWLEIQETLGNLERKEVFEEAINYAKNGFPMTHFHYTMFGNSVDRLNKFPSGEIILNSGKVSPPGSRIKMPELANSLQLVANKGADEFYRGSIAKKIVDSMKLYGGLINEEDLDAVKAEWTDPLTVKYKDFEV-STVPPNSSGFQILETLKILETLPPEKIKFQDSDFVHTFIETAKLAATDRIAYGGDQSLGLTPTDKLLSSDYANYQSSRISLDKANPDAPQGDLDAYDGGMTTHFSVADKDGNVVS. 377
14 0.000e+00UniRef50_A0A098DS79 Uncharacterized protein n=7 Tax=Fusarium sambucinum species complex TaxID=569360 RepID=A0A098DS79_GIBZE  ali  26  6.........VLAALLSVFPQIGLSKPCETTYPPLMHPLQSRQGAVASESEICSTIGVNILRDGGNAADAMVATVLCVGTIGMYHSGIGGGGFMLIHAPDEKNYEFVDFRETAPAAATENMFKNN------VNESISGGKASGVPGELRGLQHLHEKYGSLPWSQLVQPAIKVARYGFPVNNDTLKFMENESFLLNDPAWAIDFAPSGRLVKFGEKLTRKRFADTLETIASEGPDVFYQGAIAEATIRTLKREKGIMTMDDLKNYTVEIRQPSQINYRGGKVTSGSAPSSGAVVAA-ALNILDGYDFLGDPSRVNDTAYYTDEAFKFSYGMRT-NLGDPSFVDEYQKQMYSNKTAQEVRAKLDGRAALKDYDPKGLESLETPGTSHIVAMDSSGLAIS. 405
15 0.000e+00UniRef50_A0A2I7N462 Gamma-glutamyltransferase n=1 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I7N462_9NEIS  ali  31  9.KSVLGVLVATSFFSNAYAANQPVAPEVATAKTDKELVLGKKSMVVTNNPWASQAASEILGKGGNATDAAIAAAFMLGLTEPQSSGIGGGGYAMVYN--DKKMKAYDGREVAPRSANPQWFIGSDGKPLSFDQAMLSAKSIGVPSEVALLYKMHQDSGKLDWKKLLEPAIKLAQKGFPMSPRLYNLLVADQNVLANPAITAVYFNDGSVKAIGTTVKNPDYATTLQKIAKD-PQEFYTGSIAKDIINIINEKAGLYTKKDLKDYNVIVYDPVCSLYRNYKICSVPPSSSGGATVLELMQIYAN-NYSGNNPQDVKWAYNFLEASKLAYADRNQYLADPDFVKQPVKGLLNTDYLASRSKLVSESALATPVSAGIPDGIDPHGTTSMSIVDKNGDAV.. 414
16 0.000e+00UniRef50_A8F6E0 Gamma-glutamyltransferase n=2 Tax=Thermotogaceae TaxID=188709 RepID=A8F6E0_PSELT  ali  33  47.........................................................EILEKGGNAVDAAVATAFALGVVEPYASGLGGEGVMIIHM-SNGQSIAIDYKSAAPLDLS------------KYERASTGPLSVCTPGVVDGLIKALSEWGTMTLEQVMEPAIRLAKEGFVLNETFISVLSDNYEKLLNDEGASVYLKDGLLYEVGDIFKNPVLAKTLELIAKEGRDAFYRGEIAEKIEKFMSENGGLITRKDLEEYHAIVKEPIIGDYRGYKIITAPQPV-GGATLLEALNILERFNVSDLSWDDPLYIHLLSEALYLSTIDMRTYCGDP---NVPVEGLVSKEYAKSRFEMIPLSKAITRSSAGDPSKYESPSTTHASVVDRWGNAV.. 399
17 0.000e+00UniRef50_A0A2G9GKA8 Gamma-glutamyltransferase n=75 Tax=Magnoliophyta TaxID=3398 RepID=A0A2G9GKA8_9LAMI  ali  32  43.....................................IVASHGVVATDHGQCSAIGRDILRKGGHAVDAAVAAALCLGVVSPASSGIGGGAFMLVRSAD-GKTEAYDMRETAPKLASQNMYGGNA------AIKANGPLSIAVPSELAGLEKAWKKYGTIPWTRLVRPAAGIAENGFKISPYLHMQMRSTEAIMGDEGLRNIFTSNGSLLQSGDLCYNKQLARTLRIIARFGTKAFYNGTIGFSLVKDVKKAGGILTVEDLHKYEVKLRKPVSLDVMGVEIFSMPPPSSGGASMSLILNILAQYNLSDIS--DALLTHREIEALKNALVVRM-NLGDPDFVDVVLKDMLSEKFAAELRKTILDNTTFNSSHYGGRWNIHDHGTSHISIVDRQRNAVS. 397
18 0.000e+00UniRef50_A0A2W5CFC1 Gamma-glutamyltransferase (Fragment) n=1 Tax=Haemophilus parainfluenzae TaxID=729 RepID=A0A2W5CFC1_HAEPA  ali  37  2.....................................................................................................RVEAIDFREVAPQSASKETYLNQRGNVID-QKSIDTPFASGVPGTVKGLETAWQRGGHLPWASLLAPAIELADKGFIITRGLGDRIRESEGRLSNKATWAIYAPKGRLLQAGDRFVQKDLARTLRLIATGGSNVFYQGEIADKIARSMAPYH-WMSKQDLANYRVVIRKPLIGTFKGYTVTVMPPPSSGGVHILQILNVLEHFPLEQWGQNSAKTIHYMSEAMKWAYADRSKYLGDPDYVKVPVKGLTAKAYAATIAQKIGEKSTPVSIAPGVPQPYESNETTHISIVDKEGNAV.. 296
19 0.000e+00UniRef50_E1VS92 Gamma-glutamyltransferase n=820 Tax=root TaxID=1 RepID=E1VS92_GLUAR  ali  33  5..RLRSVACAAVIALGLGAFSALPASAEPRHTQKDSTAIGTGGAVSSVDPEATAAGIEVLRKGGNAVDAAVATAAALGVTEPYSAGIGGGGYFLYYDAKSGKVSTIDGRETAPAGISHDAFIDATGDPYNFPELVTSGVAVGVPGTLATWQRALDNWGSQNLKQVLRPATQIASRGFVVDETFREQTLDNKERFNFDSTSQLFLPGGDAPQVGTIFKNPDLAATYRMLAKQDLDGFYEGPLATEIAQSVQAPPGTLSTADLAGYEVVEQAPTTVNYRGYEVFGMAPSSSGGTTIGESLNILSEFNLSAM--DEPDALHLYFEATALAYADRGKFVGDPAFVQVPTQALTDKLFGADRACAIDPQQAAKPVAPGDVENYDGRSTTHLSVVDRWGNMVS. 429
20 0.000e+00UniRef50_A0A2E5LQ75 Gamma-glutamyltransferase n=9 Tax=Bacteria TaxID=2 RepID=A0A2E5LQ75_9CHLR  ali  30  11.........................REGFDLTAHRPVVASLKGMVTSAHDASSMAGARMLLQGGNAADAVIATAAALNVVEPYMSGLGGIGFLVMSSSYGQERKVLNFSGLVPEKAVPEAFSPETH--------TIGTRCPLIPGNPAGWLEILEKYGSLPKEKVFGPAIELAEHGYIVSELDERFFEANEDRLRFPTSKKTFMPDGKPMKAGEILRQPDLARSYKVLAEHGADGFYRGEIAEEIVRFMKEQQGLLTLNDLDSYQPRWEEPISTKYRGYDIIT-PAPNCNAFQVLETLNILEGFDVKSLGHNTSNYIHLLSEAIKLAATDRIMFGGDPNFMDVPVEGLISKSYAAAQRSRINHYHASGSMEAGFPATYLSGETTHFAAADSVGNVFS. 387
21 0.000e+00UniRef50_A0A2E8GMT2 Gamma-glutamyltransferase n=21 Tax=Bacteria TaxID=2 RepID=A0A2E8GMT2_9ACTN  ali  30  2........................PVPGTTLRSFRPQIQGVNGVVVSSHPSASMAGLDVLRRGGNAIDAGVAVGLALNIVHADDCGFLGVAPTIMYLADRAEVTTIDGLGVWPKAASVEYFQRNHNGQMPSGIPR-----ALTPGAADAWFTALARYGTMSFAEVVGPAIALAEQGFPMYRYLADRLRDAFDLYAWPSNAEIFLAGGRAPTVGEMFYQKDAAETLAQLRAQGREGFYKGELAQKIVSFYQSQGGLLTMADLAEYKVRIEPPVTVNYHGYDLYCCGPWCQGPL-LPQALKILEGFDLKAMGHNSAEYIHAATQALNLAFADREQYIGDPAFVDVPIDEMMSEAYAKERRTLIDPERAWPVPPAGDPAGEEGGGTSYFGVIDSAGNIFSS 409
22 0.000e+00UniRef50_UPI0003F0DD30 gamma-glutamyltranspeptidase 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0DD30  ali  32  111........................................SHGAVACDVEQCSNVGVEVLKKGGNAVDAAISTMLCLGVVNPQSSGLGGGGFMMV---KTKTVDAFDFREVAPDAAQEDMFQTNE------TLSVKGGLAVAVPGELKGIEMVWKKYGLLKWGELFEPAINLATDGFTVTEATESSIDDTFDELS-PELKALLAPNGKKLKAGQTLTRPTLAATLQIVATSGASAFYDSVLSDNIVNSVTSTGGILTRQDLRNYAAIERLPVETKYHDYTVYSHPAPAGGPVF-LSIINILENYNFTSADSNDPLTYHRIIEAFKFAYSQKLQ-LGDPDKVNDVQDIMISKEAALFIKQKILDNSTFNASHYGPYFPDIGQGTASVTVIDKDDNMV.. 458
23 0.000e+00UniRef50_A0A268J417 Gamma-glutamyltransferase n=9 Tax=Bacillales TaxID=1385 RepID=A0A268J417_9BACL  ali  28  2.........................................NGAVTSPHYLATQTGKRILDQGGHAVEAAIAVNAVLCVVIPHMAGLGGDLFALIWDQDEKEVKSMHGSGKSGSYVNREAYKQKELREIPER----GPLAATIPGTVDAWWELHQQYGRLKWEVLFEDAVHYAESGFPITDKVSNFIQEKAELLSDHATKQVFFKNDRPILAGELLVQPDLAWSFNQIAQSGRDAFYNGEITDKIIASMEKHGGLLVKEDFKEHSLEWERPLSTSYRGFEIYQVK-PNTQGIAVLMMLNMLEKNDMTSIQDGTPEYYHLLAETAKLKFRFRDKWVTDLETIDLPYDELLSKSFSSEVYDHFSWDDVYREEELEELPKVDDGDTAYLSVVDKEGNSIS. 355
24 0.000e+00UniRef50_A0A2E8T802 Gamma-glutamyltransferase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E8T802_9PROT  ali  28  7................................PGRSPVFGLRGAAATSHPLATGVALDILKSGGNAIDSAVAAAATLAVVEPQSTGVGGDCFALCSFKGIVPPIAINGSGAAAKDIDINWFKTNGLTQIEPE----SPHAITVPGALRTWAKLVNDYGTQNLSKLLKPAINYARDGYVVTPRVALDWEEQVDKLSKPHSAKTYLVSGRSPSAGSVHRQPVLADTLSKISEFGVDEFYSGSIARDIVTYLRGLGSALNIDDFASFEPQYVKPIYTNYRGYDVYEC-PPNGQGITALMILNILCGYDMGSFDALGTDRFHLQAEATRLAYRDRFKYLADPDKSLVPIEKLLSESYAEELRSQISLNKVMPFIK--NNSEIRHRDTVYLSVVDSDGTAVS. 365
25 0.000e+00UniRef50_A0A1R1XCA3 Gamma-glutamyltranspeptidase 1 n=5 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1XCA3_9FUNG  ali  30  134..............................YVTDSNEAFGRTGAVATDEGRCSQIGIDVLKEGGSAVDAAIAGGLCVGLLNAYTSGIGGGGFMLIRKP-NGESETIDFREMAPSGSKPDMYVANN------TLSTFGGLAIGVPGVIRGYELAHKKYGKLSWSRLFQPTIKLAREGYVIGTPLANSMRNREKDLRTPGFLEVYFPNGTLLQAGQISKRVKFSETLEKVAKLGADEFYKGETTKSMVKAIQDAGGIITLQDFANYKPEIKKTQVMEYNGRKVITAAPATSGPV-VSTVLNILQGYKLKQASKR-PLSTHRIVEAFKFGFSLRTD-MGDPNFVDNSINKCVDKEFGNSLRARITDDLT-HSYQYYDLKNENDRGTTHLAILDKDDMAVS. 495
26 0.000e+00UniRef50_UPI0005C334B7 uncharacterized protein LOC100640595 n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=UPI0005C334B7  ali  30  3......................RESERLPGPRSGRSMVLASEGMVATSQSLAAQAGLSILQSGGNAVDAAIATAIALTVVEPTSNGIGSDAFAIVHDGQN--LHGINGSGPAPRRLSAQALREAGFRAFPER----GWTSVSVPGAPDTWGMLHERFGRAPFESLFTPAIRLAEEGFPVSPVIARLWHDGRALFSFAEWERIFLPAGRSPGTGEIWRSPDHARTLRRLALQGVRDFYEGEIAHRIAEHARSNQALLDEDDLADFHCEWVEPISIPYRDHEVWEI-PPNGQGIAALQALGIVAGTPMHTFPQGSEASWHYQIEAMKLAFADAYRHVADPRFSRVPVQGLLDPSYLASRRDRID-ERAQDH-GPGMPP---SGGTVYLCSADRDGMMVS. 371
27 0.000e+00UniRef50_A0A1Q7WRU2 Gamma-glutamyltransferase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Q7WRU2_9PROT  ali  36  25.......................................GERGMVVSAQHEASEAGLQILRAGGNAIDAAVAVGYALAVVDPCCGNIGGGGFMLIHTAD---------------------VLDPAGNPVRER-SLYGYLAAGVPGTVMGLDNALTRYGKLGRAAVMAPAIALARDGFALGEADAAIIAARAERLKDPEAARIFLPDGGPHPAGDRLVQPDLANTLALIAEGGPDAFYRGPIAAAVATASAAQGGIFTKEDFAAYTATEMPPIRCTYRGYVILSAPPPSAGGTILCEMLNVLAGWDLGASGAASAQTIHLMAETMRHAYVDRNSFLGDPAFVTNPLDRMLSQQHATAIRAAIDPDKAAASAALGPLAPHERAETTHYSVADGEGNAV.. 362
28 0.000e+00UniRef50_K1R5Z8 Putative gamma-glutamyltransferase ywrD n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1R5Z8_CRAGI  ali  31  196..............................................SDCPEGAPVGLDILKAGGNAADAAVAMAATLNVTEPCSTGIGGDAFCLFYDAKRRKVECVNGSGRAPSKLTLDLLHQQGYSTYKPYPDQTHGHSVTVPGAPAAWVDTVERFGKLSMLEVLRPAIELAETGFPVQQIAASFWNKGSHLLSDPNNGKDMLLNGRAPRHGEVVRLPLLANTFKELGTHGKPGFYSGRVAKAIAEVVQQHGGVMTTEDLASHVTTFEDPISADYKGYRVWEV-PPNGQGITTLMALNILEGMDLKGMGHNSAEYLHSLSESFKLSFADTTWFCADMSQIEVPVSELLSKDYAAKRRSQIKPDSVLSDVQHGGISV--GSDTVYFTTADCDGNACS. 551
29 0.000e+00UniRef50_A0A016XII6 Gamma-glutamyltransferase n=2 Tax=Hylemonella TaxID=232523 RepID=A0A016XII6_9BURK  ali  34  13.......................TQAAWGQAAWPDQAWSGKRQAVASANPLATDAGYAMLRAGGSAVDAAIAAQMVLTLVEPQASGIGGGAFLLHHDG--QITESYDGRETAPSDVDEDLFLDAQRKPLAFAEAAVGGRAVGAPGLLRMLELAHKQHGRLPWKQLFEPAITLSEQGFPVSPRLHMLLNEPNALRQDPIAAAYFFDGGQPWPVGHRLRNPELAAVLRRVAEGGASVFYLGEIAPAIVQKVRRNPGHLTLSDLADYEALVRAPLCGTTRDVQICGMPPPSSGTLALGQIFGILARTPAATLPMQSADWLHLYAEASRLAMADRALYVADPDYVPPPWGTLLEPAYLAERAKLINLAARMKQAPAGIPLNFEEYGTSHISVVDARGNA... 453
30 0.000e+00UniRef50_A0A2H5YSR3 Gamma-glutamyltransferase YwrD n=20 Tax=root TaxID=1 RepID=A0A2H5YSR3_9BACT  ali  28  5......................AMSPRPSTLTSYRPAIQARHFAAASGHYLATAAAFRILAQGGNAIDAGVAAGICLNVLLPDLTSFGGVAPIIVYHRASGELRSISGLGWWGKRASIDAFLREEGGQIP-----LGVRRSIVPGAPAAWLTALARYGTKSFAEVVAPALELCERGFQVYPSLRRNLAREAEQIARPSTAAIFLPGGAVPEIGDVLYQHDLARTFRRIAAEGRDAFYRGDIAKEIVAFIQREGGFLDEDDFADFSVEVEEPPSVTYRDIVVYGCGTWCQGPV-LLEALNILEGFDLKAMGHNTPDYMHTVIGALDLAFADREAYVGDPRFVDVPLATLLSKEYAARQRGRIHPGQTWAEPAPGGADMPPQPDTSYVCVVDAEGNAFS. 402
31 0.000e+00UniRef50_A0A0G3XMN4 Gamma-glutamyltranspeptidase n=2 Tax=Croceicoccus naphthovorans TaxID=1348774 RepID=A0A0G3XMN4_9SPHN  ali  34  16........................................TTGMVSAADPRAAEAGVAMLRAGGNATDAALATMIALTVVEPQSSGIGGGGFLVLDPDGDGDPTTYDGRETAPAAATEQWFLDNDGKPLPFRTAVESGLSVGVPGSIALAAKAHGEHGALPWAKLFEPAIALARDGFDVTPRLRASLGEWRSVGAMTPAARTYGPNGEPVPVGTRVYNPALATFLDRVAEAGPDAFYHGDNASKIANAVNAADGKMMLTDITAYEAKERPSPCGTYRAYLICGMGPPSSGATTVFAILKQLESQDMAAYGPTDPVAWHLIAESMRLAYADRGKWLGDSDFVDVPLPGMMDGGYLTQRGKAIRADRTIANAEPGLPPPQPEKGTSHFVAVDGQGGVAS. 409
32 0.000e+00UniRef50_A0A284QMG9 Related to gamma-glutamyltransferase n=4 Tax=Agaricomycetes TaxID=155619 RepID=A0A284QMG9_9AGAR  ali  28  34.RVVFLCCFLGLLAWISLCQRHQPPNSWAITQQSRNPAYAEHGAVASENKRCSDIGVDVLKEGGNAVDAVISATFCVGVVNMFSSGIGGGGFMTVRIPSSSEVFNIDFREMAPALSNSTMF------PAGSNASMFGGLSVAVPGEVRGLEEAHKRWGTLPWKRLVQPSVDLAA-GWQVDKELGRRIPWFADLLGNPDWRDIFAPNGVFLKEGEMIRRANYSRTLATIATEGADAFYKGPIADALVQKIAATGGILSHADLERYKVKVTQALEGTYRGRKVYTTHAPTSGPV-LLHMLNLIEKYDLEK--RNGV-NTHRLVEATKFGFAARTR-ICDPEFQNNTIKSISTKAFANIIFPNITDGHTHP-PDYYNPEYLTDHGTSHTSIVDKNGMAVS. 429
33 0.000e+00UniRef50_A0A2E6ZSQ6 Gamma-glutamyltransferase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E6ZSQ6_9BACT  ali  33  48................................DTRPNV-AANGMVASPEPLATDVGLAILKAGGNAFDAAAAVQFALAVTYPTAGNIGGGGFMVGLLAD-GDTFALDFREEAPSAATTDMFVDAHGK-MKPELSTNTHQGVGVPGSVDGMLKLVERYGTLDRQQILAPAIELARDGFPISYSLARSLKRSQRLRRFPSSIKTFGLDGDSPEMGNRLTQSELATTLQAIADHGRDGFYAGVVADLIVADMEANGGLISHNDLAAYEAKWREPLVFHHDRYELITHPVPSSGGMTIAQTLALLNMPVLQRIGYHSAEAVSMVTEAQRLAFADRNFWLGDPDFFDVPVDRLLSREYMEQRRRLLPQDGMAGRSEGVSHGPAESEETTHFTVADRWGNV... 407
34 0.000e+00UniRef50_UPI000BA43306 gamma-glutamyltransferase n=1 Tax=Mesorhizobium sp. ICMP 18942 TaxID=1208188 RepID=UPI000BA43306  ali  29  7.......................RPHAGAAFTCEKQPATGSRGMVVTNHPLASSAGAEMLAAGGNAIDAAIAALFTLSVVEAMMVGVLGGGIAHIRLA-NGTHHVLDGMSTAPLATGPTVYTPDPKAAPGGRRNAIGPTAVAAPGNLLGWCETLRRFGTFSLADVTEPAIRHALRGFRVTPYLQECVKSAADLARDAEIAKLYLPGGMPIQPGTRLVSGDYAETLRSIARKGPDILYGGELGRHYAEHMAQEEGFLTLDDLTGYRTVDREPLRGLYRGFEVLGPPAPSFGPLHIIQTLNIVEGYDIGTLGFATPDTLHLLAEVLKIAFADRAEASADPAFVPEPIGKLLSKDYAAARRARIKMDRA-QSWSAGV-APSEGAHTTHLTVADGFGNVVAS 384
35 0.000e+00UniRef50_E0TH71 Gamma-glutamyltranspeptidase n=2 Tax=Parvularcula TaxID=208215 RepID=E0TH71_PARBH  ali  33  28...................ALDSVATDAAQVEASSLAAPSEQWVVVTANPLATSAGAAILREGGTAIDAAIAVQAMLGLVEPQSSGLGGGAFLLYYDAQADKLQAYDGREVAPLSARPDMFLTEDGERLNFYDAVTSGLSVGVPGVVAMLDLVHREHGKLEWSSLFADAEEKARDGFEVSPRLHSLLGRTTRLIDTPAAAAYYTEEGEPVAEGTLLQNPAYAETLSAIAGSGAGAFYTGDIAEQIVAAVKAGEGTMTTEDLAAYEVQIREPVCAEIFSAEICTMPPPSS-GLTMLQILALSEAAGLPESPSASI--WPTYAEASRLAYADRGLYIGDPSAMGTDVEGLLSAPYIDHRAGLIGA-MAAESVEAGDPSSADLPGTSHFSIRDRYGNIAS. 423
36 0.000e+00UniRef50_P19440 Glutathione hydrolase 1 proenzyme n=107 Tax=Gnathostomata TaxID=35060 RepID=GGT1_HUMAN  ali  30  37......................................VYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFN-------SSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNNYRAEIEHPLNISLGDVVLYMPSAPLSGPVLAL-ILNILKGYNFSRESVESPETYHRIVEAFRFAYAKRT-LLGDPKFVDVTVRNMTSEFFAAQLRAQISDD-TTHPISYYKPEFYDDGGTAHLSVVAEDGSAVS. 395
37 0.000e+00UniRef50_A0A0F8B2Y3 Gamma-glutamyltranspeptidase 2 light chain n=2 Tax=Ceratocystis TaxID=5157 RepID=A0A0F8B2Y3_CERFI  ali  29  3............ACISVRAASKFLLAAALAGQTIAQAVEATEGAVASENEVCSKIGADVISKGGNAADSMVATVICIGTVAMYHSGIGGGGFMLIRSSD-GNYESIDFRETAPAAAHQDMFNEN------VKLSEFGGLSVAVPSELRGLEYLHKKYGSQDWADLLAPSIDLARNGFVVSRDLQRYMDNSVDLVEDPCWGIDFAPNGTRVVAGDIMTRKRFADTLEIIAKDGVDAFYYGEIAESTIRAVQADNGIMTMEDLDSYTLVHGEPFQVDYRGYKVTGTHAP-SGGVVTLNALKVLDGYSGFDDPSQRNQSAHLLDEAMRFAYGMRTK-MGDPQFTDNYTQAMISDETVRKIRSQIHLNETFP-MSYYNPDGIESPGTAHISTADKSGLAIS. 386
38 0.000e+00UniRef50_A0A2E8D890 Gamma-glutamyltransferase n=15 Tax=Bacteria TaxID=2 RepID=A0A2E8D890_9PLAN  ali  33  20.........................AADLPARTSVQVARASQGMVVSETPHASRVGRDVLTRGGNAVDAAVATAFALAVTWPEAGNIGGGGFMMVHPADGKPPVCVEYRETAPAAATETMF--------ELGESRYNCKAVGVPGTVGGLQLAHESFGRLPWRDIVMPAVRLAESGFVVDDWLAYSLEQENVRLRYAELRRVYSPQGRPWRKGDVMVLLDLARTLRTIAERGGNAFYEGRIADLLVAEMQRGNGIISKQDLEGYRAKIRKPIGGTYRGYDLYGPPPPCSGGTCVIETLNILEPFKLREHPRFGARNLHLIAEAARRAFADRAKYLGDPDFTSIP-KHLTGKEYAAKLAGAIKLDEATPSIAPEIQLADESPDTTHFSVIDGDGMGVS. 391
39 0.000e+00UniRef50_B2B0V7 Podospora anserina S mat+ genomic DNA chromosome 3, supercontig 2 n=3 Tax=Sordariomycetidae TaxID=222544 RepID=B2B0V7_PODAN  ali  29  1.MYIPILPLALSLASTLTLTSGLPAPFRYSPEQPSTAPNGTRGAVASESKLCSQIGIDMISQGGTAADALVAATLCVGVIGMYHSGIGGGGFMLVRD-ELGRHEVIDYRETAPSSAHKDMYKHD------RNASVIGGLAVGVPGEIRGLGYLQEKYGRLGWKEVVMPAVEVAREGFTVGEDLVKYMKAASALVSDPVWAQDFAPNGTLLGLGDRITRKRLASTLEKIATEGPEAFYEGEIADSIIKTIQENNGTMTHDDLREYTIRMKQPLSIDYRGFKLYTTVAPSSGAVT-LNILKVMEQFPPEDLADKS-LTAHRLTEAMKFAYGARQE-LGDPDFIRAFQKTMLSEEKAQQIRKMIMDNQALDVYNPQSVYAAESSGTSHLVASDE....... 397
40 0.000e+00UniRef50_A0A2E9TWI5 Gamma-glutamyltransferase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E9TWI5_9CHLR  ali  30  10..........................SVSPFDTKKSCAYGSNGMVVANHPLAAAAGAQILLSGGNAIDGAVASLFALSVTEPMMVGIFGAGFFNIRLA-TGQHLIVDNYAKSPRKSFPDMFRTTNGQEGSNKKNVTGPLSIGVGGSLKGWCHVQKKLGNLDLSDVIAPAINIAKQGFVVSDYLSNAIKNNEEAIRFPATSREFIPNGQLLKTGDRFTRYEYAESLGVIAKEGESALYGGSLGNIICDFLNRNGGLIDKKDLEDYSVIESDPVKGSYRNYEIFGPPPPCAGGIHLIQLLNILEGFDIQRMGFGDPKVLDIIAKSVAKAFIDRDKYTGDPKFSEIPIERIISKSYADDIRSELDLN----DELMITNTPNESDYTTHVTVGDGDGNVVS. 381
41 0.000e+00UniRef50_A0A2E4ITR1 Gamma-glutamyltransferase n=10 Tax=Bacteria TaxID=2 RepID=A0A2E4ITR1_9RICK  ali  32  19.........................PHGDNYGSINTNMVGFNAAVVTNHWMASSVGRDILMKGGNAFDAACGISFILGVVEPQMSGIGGDGFIMMYDSKKDKVNVINATGPAPE------FSYKIGDKIP----IKGISSASVPGLVSGVLKMHKLKGSLSLQECLAPAIEAASNGIALSQDQSASLKSDSKAENFQSSLKIWGDKKKGLKFGDRVVNKDLAETLKLISIEGEDGFYRGKIADKIVKISEENDGLFSINDFKNFDAEIQDPISTSYRGYDVYEA-PPNSSGITLLQQLNIIENFSQKDLSPFSKSAMHLMVEAKRLAFYDRERYLADPKFFDVPVDLMLDKNYAKELSNKININRISNKELEINYKPDRVGDTTYFCVVDKEGNSVSQ 383
42 0.000e+00UniRef50_UPI0009D6A3F5 gamma-glutamyltranspeptidase 2-like n=4 Tax=Sesamum indicum TaxID=4182 RepID=UPI0009D6A3F5  ali  30  13....LPVIVLSLISLALFLNSSSAARGER--------VKANNGVVATDETECSKIGRDMLRQGGHAVDAAVASTLCIGVLRPADSGLGGGGFILVRSHK-GEAKVFDMREMAPGQASKDMF-----SKMNGTEWKHSPLSIAVPGQLAGLYAAHQQYGKLSWRSLVKPAENLARKGFKVSRSLFQKMADARSMIADKEIQSIFAPNGTLLIEGQTLRLKKLADTLAAIAKDGMSIFYNGSIAQGLADDITRVGGIVTKEDLQKYRVIVRKPLVAYVLGCKMVTVPPPASGGAVVILILKILSIYNMTGVP--TALLVHRTVEALKYALALRM-NLGDPGFVDVTLKSMISDNTAENLRKLIDDNKTFDPPHYGSKWSLNDHGTSHICIVDRQRNVV.. 391
43 0.000e+00UniRef50_A0A158HQD0 Gamma-glutamyltransferase n=1 Tax=Caballeronia sordidicola TaxID=196367 RepID=A0A158HQD0_9BURK  ali  30  7...............................PTYRPMIASVKCSVSAGHYLAAEAGMRILRKGGNAVDAGVAAGVCINIVQPDLTNLGGVAPIIIYLAKSKQVLTISGLGRWPQTATLEHFRDELNGEIP-----LGVKNAITPSACDAWLTALARFGTLPLAEVLQPALELAVDGFPASRLMTHMLTGIHDNLRWPSSSDYLRPDGTPLQPGDIVRQPMLAKTLKVLAEEARDVFYKGDIAEKMARFSKEQGGFLDYDDLASFSVGIEPAVSSTYRGYEVFTCGPWCQGPV-LAQTLNILEHFDLASYGHNSPRALHAIIESLKGSFADRHAYYGDPEFVDVPIKGLLNKQYARQWFERIRPDSAWNDPEPGNPWLYEGSDTSYLCVVDSEGNGFS. 401
44 0.000e+00UniRef50_UPI000947D553 gamma-glutamyltranspeptidase 1-like n=4 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947D553  ali  28  34..............IAAVRPPCLRPQPAGLDLTGGP---YTHGAVAADALECSAIGRDILQKGGSAVDSAIAALACVELVHGHSAGVGGGLIMTIYNKETGTAQVINAREKAPSGASTHMFGSNN------ISAQFGGLAVAVPGQVRGFWEAHQRHGKLPWKDLFQPAIQMAEQGFCIGRPLQNAISKNLEFINDPHLCDVLCDNNNVLGVNMTMKRPQLAETLRAVADGGADAFYTGEIARNLAKDIQDAGGIITEEDLRDYQVEVSDPLKTSLGGLTLLTPPPP-GGGAALSLMLNIWDGYGLNASSVDGVDTYHRMLEAFKFAFARRTE-LGDPNFVDVVVQKMTSKSFADSLRQRISDTET-HDWRYYDPVYYEDGGTTHVSVLAPGGDAVS. 416
45 0.000e+00UniRef50_A0A0J1FG66 Putative gamma-glutamyltransferase YwrD n=281 Tax=root TaxID=1 RepID=A0A0J1FG66_9FIRM  ali  28  4........................DPLYYPYASRRATVYARNGMVATSQPLAAQAGLDVLRRGGNAIDAAIAAATALTVVEPTSNGIGADAFALVWTG--GKLYGLNSSGPAPKSLSYKTLLDRGSTEIP----KYGWIPVTVPGAPAAWAELSQRFGHLSLTDVMQSAIAYAQDGYPLSPTLGRNWKLAFGNYRFKHWFETFAPNGRAPEIGEMWRSPAHAQTLQSISETKAQSFYHGDIADRIDRFSRNYGGYLRKEDLAAFQPEWVEPIKVDYRGYQVWEI-PPNGHGLVALMALNILNGLEFTE--KDSVETYHLAIEAMKLAFADGRKFIADPLSMRVRVEDLLSPAYAEERRKLIGQEALQP--EPGQPPQ---GGTVYLATADKNGNMVS. 369
46 0.000e+00UniRef50_A0A0G4KWS7 Uncharacterized protein n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4KWS7_9PEZI  ali  28  13.....LLYGSFIWITGSSAVPFSSDQVVLTAQDGA-------GAVASENMECSRIGRDLLRLGGNAIDAMVGTQLCVGVTSMYHSGIGGGGFALVRTAD-GEYETIDFRETAPAAATQDMYNDDVH------ASIEGGLAVGVPSELRGLEYMHEKWGDLAWESVVMPASHLAREGFSVTADMVRYMAGRDFLIDEPSWAEVFAPNGTLLGVGDTMYRTRLADTLSTVAKKGASAFYTGDLAASFVKTVRDADGIMTLEDLTAYRAEIREPLSTTFRNHNLYTTGAPASGAIT-LNMLKTMEQYPLPPT-PDTNLTTHRYNEAMRFAYGARS-LLGDPDFVRPYEASLIDNATAAHTRARILDNETQPHYAPHALFVPDTHGTSHVVTADSAGRAVS. 398
47 0.000e+00UniRef50_F3KPF0 Gamma-glutamyltransferase n=2 Tax=Comamonadaceae TaxID=80864 RepID=F3KPF0_9BURK  ali  34  1MRFRRPLRVSGPFLYPLLIALTLHPAAWGQPQGDDKPWSGKYYAVATAHPLATDAAYAMLRAGGSAMDAAIAAQMVLTLVEPQASGIGGGAFLLHHDGKI--TESYDGRETAPSDVDEDLFLDAQRKPMGFAEASVGGRAVGTPGLLRMLELAHGQHGRLPWKQLFEPAITLAEQGFPVSPRLHMQLAEPNSLRQDPVAAAYFFDSGQPWPVGHKLRNPELAAVLRRVANAGANAFYLGEIAPAIVRKVRRNPGHLSLADLADYEALVRAPLCFVYRDVQICGMPPPSSGTLALGQIFGILARTPAASMPMQSAQWLHLYAEAARLAMADRALYVADPDYVPPPWMALLEPDYLAERAKLVNVSPGTPEVPAGIPMSVEEYGTSHISIVDGQGHA... 468
48 0.000e+00UniRef50_A0A0B7N6Q9 Uncharacterized protein n=1 Tax=Parasitella parasitica TaxID=35722 RepID=A0A0B7N6Q9_9FUNG  ali  26  5.RRFKNWIFTACITLVVTIQSFAYARVLPQESKISHKVSGEHGAVAVENERCSRAGLDVLKDGGSAVDSAIASALCIGVINSFATGIGGGGFMLVRTSD-GEYDFIDYRETAPGASTEDMY------VLNGTLSRISGLAVGVP-----YWRD-SRYGKLSWSRLFRDAIDIAKNGFVANELMYKRLKGSQALLNSPEWIEVFAPNGTIAQPGDIIKRPTLGKTLEVIADQGADVFYSGYIAKSIVKTTAKNGGIMTLADLGNYKALSRPVVSTSYHGYKIFTTSAPTSGPI-LLNILNLVEPYNFAQDGRRNTLNMHRLVEAFKFGYAARTE-MGDPSFTDIRMEEVISKEWADLVRKNITDDET-HNAEYYQPAGNDPHGTMHLSVVDRDGSAV.. 394
49 0.000e+00UniRef50_J3NT46 Gamma-glutamyltransferase n=21 Tax=Sordariomycetes TaxID=147550 RepID=J3NT46_GAGT3  ali  30  24........................ASASPTYSYQEPVANAQHGAVASESRICSQIGVDLMRRGGNAADAMVGTNLCIGVVSMYHSGIGGGGFMLVRGAD-GSHEVIDYRETAPAAASEDMYRNN------VAGSVYGGLSVGIPGELRGLEYLHSKYGSLPWRAVVNPSVKVARDGFPVTEDLVRYMAQALKLVDDPAWAEDFAPNGTLLKLGDTITRKRFAKTLEKIGRHGADAFYKGEIAESIISLIRATNGTMTLADLASYSVTTPPAVSVEYRGYRVWSTPSPTSGAVC-LSILKTMEQYPRADLLADANLTTHRFAEALRFGYAARSR-LGDPAFVPDAAARLLTGSFAASTRRRI-LDGATQPVEAYGPDTEPSHGTSHIVTADSTGLAV.. 406
50 0.000e+00UniRef50_A0A2G8KW06 Putative gamma-glutamyltranspeptidase 1-like n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8KW06_STIJA  ali  28  43...............................PVPRSQKHFENAVVAADSIECSIIGRDMLRQGGSAADATVASLICTGLFNAQSSGIGGGVFILYYDRETQKKVFYNGRERAPLGATENMYEANLHSLRKHVHTVTGGLAIGVPGEVKAFWELHKEYGKLAWKDLFAPSIKFAREGFVVPVSLSKAIAAREDDIKDPNMSEVFLKDGELYEDGDLMTRPKLADTLQTIADEGVEAFYSGSLADNIIADIKDYDGIVNRTDLETYTLAIKDALHIYLDSWDVYSVSPPGSGAVLAL-ILNILEGYDLTPESDRSVLTYHRMIEAFKFAYAKRSA-LGDEDYVEDFVAEMISQEYADEMRDKITDDKT-HTYEYYEPANDEDSGTSHVSVVDADGSACS. 440
51 0.000e+00UniRef50_A0A067EXF2 Uncharacterized protein n=3 Tax=malvids TaxID=91836 RepID=A0A067EXF2_CITSI  ali  32  65...............................ASGADIVESEQGVVAADDGRCSEIGASMLRQGGHAVDAAVATALCLGVVNPMASGIGGGSFMIVRSSATSQTQAFDMRETAPLAASQDMYENNPG------ANYAGALSMGVPGEIAGLHEAWLKHGRLAWRTLFQPAIKLAKEGFVVAPYLGRHIAKSGGRLNDRGLQEVFAPNGKLLKPGDKCYNEKLAQSLEAVAEQGPQALYNGTVGEMLVKDVSKAGGILTMEDLRNYKVNVVDAVSVNVMGYTISGMPPPSCGTAGMAMVLNILDSYG-SSDSAKGNLGLHRIIEALKHMFAARM-NLGDPNFVNISLSEMLSLSFAKQIQQKIFDNTTFPPDYY.......................... 400
52 0.000e+00UniRef50_B8KXZ9 Gamma-glutamyltransferase n=29 Tax=root TaxID=1 RepID=B8KXZ9_9GAMM  ali  30  37...............SARIVAAAGSRAQGWLAQGRSEVLARHGVVATSDPLASEAGLEILRKGGNAIDAIVAAAAVLDVTSQNDTGIGGDLFALVWSAADQKLYALNSAGWAPEAWTREFFTEELGVT---EMPDFGVNAATVPGAISGYDALLTRFGTLGFAETFERAARLAEEGWGQAERRHADLSRVQDRLRDPDSAATFLVDGAVPPLYSIIRNPDLADALRLIQRDGRDAFYKGPIADAIVAKVQAGGGVMTHADLAEYTSEWIEPVSSSYHGYDIFQLPPP-GQGFAALEMLNILEKVDLAALGPAHPDYWHFMVEAKKLAYSDLYAYNADPKFVDVPIEELLSKSYAASLCDRIDMNAASEPSVEGGL----KGGTVYLTAADRWGNMVS. 417
53 0.000e+00UniRef50_A0A257VM02 Gamma-glutamyltransferase n=1 Tax=Solibacteres bacterium 12-62-4 TaxID=1970571 RepID=A0A257VM02_9BACT  ali  30  9....................TLATAGFGQERWQSRSMVLTTQGVAATSQTLASQAAAQILARGGSAVDAAIAANAVLGVVEPMMCGIGGDLFAIHYDAQTEKLTGLNASGWAPAKMTE---APKGGFS--------GIHSVTVPGAVDGWWKMHQKFGRVPWADLFAPAIHYARNGFPVTEIIHEDWATSGEKWP-----------GRVPAVGEIWKTPGLAKAYEVIAQQGRDGFYKGPLAADILKTSARLGGLLAENDFTEYQSEFVEPISTTYRGAKVFEL-PPNGQGVSALEMLNILE------TKPGAQLNLHFKIEAQKLSVMDLRRYVTDPKFSQVPTEGLLSKAYAAERAKLIDPNRAKCDVTAGDPGKL--KNTVYLSVVDRDGNMVS. 354
54 0.000e+00UniRef50_A0A1H2H413 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=4 Tax=root TaxID=1 RepID=A0A1H2H413_9PSED  ali  31  1.MHKYVALPLLSLLVACSGSDPATDTPAMQSRAERE---ASRHMISAPHPLAAEAGREILRQGGSAADAAIAAKLVLGLVEAPETGIGGGGFILLHDANRGQSRFYDGRETAPRAATADRFRWPGLNK-PFILAMTSGDAVGVPGMLALMAKVHAEHGQLAWASLFVPAIELAEQGIPMPSRLQRQIKHDWSLRLFADTRQYFRRQGEPP----RLHNPKLAATLRQLAEEGPDSFYHGAIGEQFVQRVQDARGDMQLSDLHDYAAFERPPVCATYRQWTLCGPPPPSSGGLTVLQILGILEHFPMDELSADDPQSWHLIAEASRLAFADRDYYIGDPDFVQVPLAELLERDYLARRAHLIDPRQAMAEPLPGVPVPEPEYGTSHLSVVDSAGNLV.. 404
55 0.000e+00UniRef50_A0A2K1WX41 Uncharacterized protein n=5 Tax=eudicotyledons TaxID=71240 RepID=A0A2K1WX41_POPTR  ali  31  78.....................................VESEQGVVAADDARCSEIGASMLRQGGHAVDAAVSTALCVGVVNPVGSGIGGGAFMIVRSSSTSKTQAFDMRETAPGAASQNMYANNLNNKYS------GALSMGVPGEIAGLHEAWLQHGRLNWRTLFQPAIKLARDGFVVAPYLASSIAKSAKKINDPGLQQVFAPNGRLLQAGDKCSNLELAQSLEAVAEQGPQAFYNGTVGEKFVKDVRDAGGILTMEDLKNYKVDIMDALAANVMGYTIYGMPPPSSGTLGMSLVLNILNSYG-SSKAAEGNLGLHRLIEAMKHMFAVRM-NLGDPAFINTYMSEMLSQSYADKIQKMIVDNTTFPPEYY.......................... 407
56 0.000e+00UniRef50_A0A2M7YWN8 Gamma-glutamyltransferase n=1 Tax=bacterium CG_4_9_14_3_um_filter_65_15 TaxID=1975567 RepID=A0A2M7YWN8_9BACT  ali  29  9.TYRSKRAVAAVLMLLCLAGC---ADHGQRISSSDHTAVYHQRAVACDHAIASQAGDRMLAMGGNAVDAAVAASFCLSVVRPFSCGIGGGGFMVISLPPSPGAVALDYRETSPGAVGPDYY-----DGLPEDASERGAHAVAVPGTVAGLLYALEKYGTLDRATVLAPAIEAARKGFPVDAYLAANATMLEVWLRHPELRAIFLFHGGSLGPLDEVRNEAHARALELIARDGADAFYRGPIAEAIVQAVTAGGGVLTAEDLAAFTVRETPALTGDVGPWRIITMPPPSSGGVATQQVFGILERLGLKGLDMDSPTWRHMQIEAFKHAFADRARWLADDAFVPVPVAALTAPGYLDSLAARFDPLHTFGPEAYGTASPADDSGTSHISVLDQDGMAV.. 409
57 0.000e+00UniRef50_UPI000BA62FEE gamma-glutamyltransferase n=3 Tax=Staphylococcus aureus TaxID=1280 RepID=UPI000BA62FEE  ali  36  8..................................KQTKTSKEGLISVSHPLAAKIGKDVLDQGGNAMDAVIAIQLALNVVEPFASGIGGGGYLLYYEQSTGSITAFDARETAPEHVDKQFYLDDSGEYKSFFDMTTHGKTVAVPAIPKLFDYIHKRYAKLSLEDLINPAIELAIEGHAANWATEKYSRQQHARLKYHETAQVFTHENQYWREGDWIVQPELGKTFQILREQGFNAFYKGDIAKQLVNVVKACGGTIILEDLANYDIQIKAPISATFKDYDIYSMGPSSSGGITVIQILKLLEHVDLPSMGPRSVDYLHHLIQAMHLAYSDRAQYLADDNFHEVPVQSLIDDDYLKARSTLINSNKANIDIEHGVVSDENHTETTHFCVIDKEGNIAS. 379
58 0.000e+00UniRef50_UPI00067EF1DA gamma-glutamyltransferase n=1 Tax=Clostridium phoceensis TaxID=1650661 RepID=UPI00067EF1DA  ali  33  67...............GGIAAAEGSDIGTAATTLSTRDASGYNGAVTSGKQEASEVGIEVLKAGGNAIDACVATALAIGFFEPNASGLGGGGFMNIYLADEQKNVAISSQFPAPEDIPLDYFLNEDGTRNQELWSEFSGKAVSIMKALSTYQVALDNWGTMTLSEIIPYVTQAAEQGIRVTENLHNLIDSSYEKLMHEASRELWLKDGTVPEVGDVIYNPDLIDTLNLIAENGIEYFYEGPIAQEIVDIIQADGGVMNMNDLK--TAVIDDPVEVTYRGYKLYSMPLPSSGGVIVGEILNILENFDLASMGHNTPESIHVISEAMMRAYADRGAYLGDPSFGDIPITGLSSKDYAYSLYEQITDE-ATTELEAGDPMPYESASTTHMSVIDKDGNM... 455
59 0.000e+00UniRef50_A0A127FCP6 Gamma-glutamyltransferase n=44 Tax=root TaxID=1 RepID=A0A127FCP6_9GAMM  ali  33  58....................PILRDEAGPAGRPGIPARIPGKAAIASAHELATQAGLEILREGGNAFDAAVAVSAALAVVEPSSSGLGGGAFWLLHRAADGMQILIDAREVAPGAATRDMFLDERGEVASGR-STTTALAAGIPGEPAGFAYLAECYGRLGLAASLQPAIRLAHKGFALNARLRGGIEAKRTIFEAGAAAAVFLSDGEVPAEGAVIRQPDLERTLRTLAERGADGFYRGEVARRLVEGVQALGGLWTLADLAEYQVKERQPLYGDYHGARIVSAPPPSSGGVGLIDALNILSGYDLGKL--DGATRKHLIVEAMRRVHRDRAEYLADPDFVPVPTRQLIHPFYAAGQRASIRMDRATPDALPSINAAGLGRQTTHFSILDAEGNRV.. 431
60 0.000e+00UniRef50_A6T258 Gamma-glutamyltranspeptidase n=4 Tax=Proteobacteria TaxID=1224 RepID=A6T258_JANMA  ali  29  2...............................RTTRPVSYAEHGMVATAHYLATGAALDVLKEGGTAVDAAICAAATMSVVLPHMIGIGGDAFWMIHDAKSNTLSALNGSGTCGKDITLDTYRGMDAIPNRGPQS-----AITVPGAIDSWALAHERFGTMPLTRLLAPAIRYASEGVAVTQDISRWISDDEDFRKDPGSAGIFLKDGNAYQPGERLQQPALAKTLENIAQHGPRYFYE-ETAKSIVSYLKSQGGLLSVEDFQNYHAKWVKPISTNYRGFQAFQVPPP-SQGIAGLMILNFLNGIDLSGLDSNSPEYYNAMIQAIKWAFNKRDQYLTDPEFSDIPIEKLLDPALAAERAEWLADTRRTHENRPG------GSDTTFISIADKYGNAV.. 355
61 0.000e+00UniRef50_A0A2D5MRM2 Gamma-glutamyltransferase n=13 Tax=Bacteria TaxID=2 RepID=A0A2D5MRM2_9BACT  ali  31  48...........................................AVVTVHPLATKAAEKAFKEGGNAVDAAVASALTLGVVDGFNSGIGGGCFMLIRKPD-GEFIAIDGREAAPLKASRNMYLRDG--RAKPDLSQTGSLAIGVPGALAAYNLVISKYGKLVLSKHLMEAATIADEGFVLDASYLRRLDQVVDKLRFPDSANIFLDDNQPWPIGHRLKQADLARSYRNIASYSVDWFYKGEFALKTENWMAGNGGLIIQEDFTRYEVKQRKPVRTVYRNHEIIGYPPPSSGGVHVAQILNILENFDLFSMAPDSADFVHIVTEAMRLAFADRSYWLGDADFVSVP-KGLASKKYARILAKKINPKKVARVDAHSTPLDADGKHTTHFSAADSDGWWV.. 402
62 0.000e+00UniRef50_A0A1Z1WM18 Gamma-glutamyltransferase n=1 Tax=Streptomyces alboflavus TaxID=67267 RepID=A0A1Z1WM18_9ACTN  ali  34  2.....................................AVGHGGAVASVDQDASAAGIEVLKKGGNAVDAAVATAAALGVSEPYSAGIGGGGYFVYYDAKSRTVRSLDGRETAPRTAGSGLFL-ENGKPLPFADAVTSGLAVGTPGTPATWQEALDSWGSRSLGTVLKPAERLARHGFTVDETFRSQTASNQARFADPDTARLFLPGGKLPVVGSTFKNPDLARTYAELGDKGVDALYDGKLGRDLVRTVNARPGDLSMKDLRGYEVKRRTPTKTSYRGLDVYSMAPSSSGGTTVGEALNILERTDLSEATR--TRYLHRFIEASRIAFADRGRWVGDPAFEDVPKKELLSQKYADSRACLIKDDAVLKSPAPGDPTTYEGENTTHLTAADKWGNVV.. 384
63 0.000e+00UniRef50_A0A0H2WG08 Gamma-glutamyltransferase n=197 Tax=Bacteria TaxID=2 RepID=A0A0H2WG08_BURMA  ali  35  92.......................................................GQAMLKAGGTAVDAAIAAQMVLMLVEPQASGIGGGAFLLHENGKT--IEAYDGRETAPAAATDRLFLDANGKPLPR--AALGARTVGAPGALRMLELAHRAHGKLPWRRLFQPAIRLAEQGFPLGPRLAAALANEPSLARDPAARAYFYDNGAPKPAGTTLKNPQLAATLRLVAAHGANAFYTGAIARDIVATVRQNPGVLSMQDLAQYRAKTREPLCADYRKWTVCGMPPPSAGGLVVAQILGLLEAQDWRQIGAQTPFAAHLFSEAGRLAYADRAQYVADPDFVAPPWKRLVERRYVAERARLIGDASA-GEASAGSPSGAEPPSGSQITVVDRYGNAVS. 456
64 0.000e+00UniRef50_U5QI54 Gamma-glutamyltransferase n=3 Tax=Cyanobacteria TaxID=1117 RepID=U5QI54_9CYAN  ali  32  30..........................................GAVSTAHPLATAAGIEMLRKGGNAFDAAIAASLVLGVVEPQASGLGGGGFALFYTGRTHQARVLDFRETAPARASASMYLDAAGKVIP-RLSLDGYLAVAVPGQAAGLLRLQQTSGSLPLAEVAAPAIRLARDGFAVSPLLHERLEASASRLRDPEASRIFLVNNQAPAAGYLLKQPDLARTIEAWVQTRGASFYRGQTAQALARAMTAHGALVSTNDLGAYIPLWRDPLRGSYRGTEMLTMPPPGSGTV-LLEMLGIVENFDLPTQPL--PLRAHFTAQAMSRAYADRSRFLGDPAFVPVPVAALIARSYGIAQKATIDPARATPSITPGSFTSWEGPNTSHLSTIDSDGNAVS. 396
65 0.000e+00UniRef50_A0A1V1PUG0 Gamma-glutamyltranspeptidase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1V1PUG0_9PROT  ali  31  41..........................................AMVSAANPHAVEAALEILRDGGTAVDAAIAAELVLGLVEPQSSGIGGGGFLLFYNAENERIIGYDGRERAPAGATATMFLDPQGRPMSFIDAVASGRSTGTPSLVAMLKLAHDEHGRLPWARLFEAAIRLAESGFEVSPRLARAMAGQRGRLRDFAARAYFFDEGNAWPVGHLLRNPEYAATLRAIAEQGPQALTQGPIAEQIVRAVQRNGGTLSLADLQAYQPKRFEPVCGAYRAYRVCGAPAPSSGA-TVIEILGLYQRARPEPEGANNADDWAAFLWASRLAYADRDHYMADDEFAPMPTQELVAPAYLEQRAQLIDLAAAPPTLPPGAPAGEEDPGTTHLSVVDAWGNAV.. 411
66 0.000e+00UniRef50_N1JNP7 Gamma-glutamyltransferase n=7 Tax=Thermotogae TaxID=200918 RepID=N1JNP7_9BACT  ali  27  1MKKLVLLVTLITFVFTATFATVTA-----------PTVASSNGMVAAVDKYAAEVGARILEMGGNAVDAAIAVSFALGVVEPYASGLGGEGYAVITMADGSK-YAIDFRSTAPMAASYEALSELGLT---LSKANYTPKGACVPGVLAGIKEAWLLGATLPLADLIQPAIDLARNGFIVDETFAQTTSDKYELVLENGF--DFLNEGFVWEVGSTFTNPQLAETLERIKEEGIDTFYTGSLADEIEEFMIENGGFMRKSDLEMYRAIVREPLHGTYRGYDFYVPHPPVSGP-QMIAVLNTLENYNLQAMTWDDPLAVHIIQQALVLGDVDRRAYISDPEFYDLPYEAFMSKEYAKTRFMAIDLSQAFDPASYYDYQGEESPSTTHFSIVDKDGNAV.. 407
67 0.000e+00UniRef50_A0A2E7LFU5 Gamma-glutamyltransferase n=3 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7LFU5_9PLAN  ali  32  2............................STLSRTRPSVGGLNGAVASAHPLASQAGLETLRTGGNAIDAIVATAATLNVVEPYMSGIGGVGFLLFHPAG-GDTRVLNFSGYAPRAATADQLTPEDQD--------IGPKACLVPCNLGGWLEALQAHGTQPADQVFSRAIELAERGFPLHPVNARMIEATLPRLN-EAGRAIY---GQVPRIGSVLRQPALAETLRNLAAHGAEWLHGGPLGQKMADYIQSEGGLLTIEDLQDPKLEWQEPISISYRNLEIKTC-PPNCEGFQILQTLKLLEPYDLQTMGHNSAAYIHLLSETIKLATADRIKWSGDPRFHPLPLEELLSESYLAERRDQIDSQRASHSEDAHVSPGKVDGLTTHLTAVDAAGNAAS. 366
68 0.000e+00UniRef50_A0A1Y5PQQ0 Gamma-glutamyltransferase n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y5PQQ0_9SPHN  ali  30  26.......IRLGLGAQAGPGEVGRGDRYSGRVWATRSPVIARHGMAATAHPLATQIAIDILKQGGTAMDAAIAANAALGVMEPISCGIGGDLFAIVWDPKTRKLYGYNASGTAPKGRSLAQMTAATGRPYPARVPLYGSLSVSVPGAVDGWFALHGRFGKLPMKNVLAPAITYGREGVPVAQMIAQNWKRNFGLFDDDNARATFLIDGHTPAEGEIFRNPDLAATYEALAADGRDAFYKGAMAKVMDAYFKRIGGGLAYSDLAGFEGEWVTPQSVRYHGYDVFQL-PPNSQGFGVLQMLRLLEPYDLAKMGAGSIEAMTTVLEAKRLAYEDMAKFYGDPRFARIPAEALLSEAYAARRRKLMNPERPDPALGPGDP-QLRIGDTTYLTVADKDGMMVS. 428
69 0.000e+00UniRef50_A0A084BBL8 Uncharacterized protein n=9 Tax=leotiomyceta TaxID=716546 RepID=A0A084BBL8_STACB  ali  28  1.......MFTLTVVTLLALAGASLSVSLSYGSFIGSMYEAKRGAVASMDARCSKAGLEMLRRGGNAADAAIATEFCLGVIGMHLTGIGGGGVMLIRD-TNGRYELLDFRETAPAASTEDMFANN------VNASLFGGLASGVPGEVRGLEVLHKKYGSLPWPQLLEPAINFARNGFTIGRDLAGHIGRLSADFLEPSWAIDFAPNGTVLGLGDVLKRSRYADTLQIISDQGPAAFHSGHIAETIIQALRVKKGIMTLQDLSSYEVAERKPCTITYGEYRVHGSGAPF-GGVVALNIMNIMKGYENIGARSKLNLTTHRLDEAMRFGYGLRTK-LGDPDYDEGLEKRMLSEATASDIRSRISDE-TSQPLSAYNPEGLETPGTSHLSVADASGMAIS. 388
70 0.000e+00UniRef50_A0A2R7U0B0 Gamma-glutamyltransferase (Fragment) n=1 Tax=Pseudomonas sp. HMWF031 TaxID=2056865 RepID=A0A2R7U0B0_9PSED  ali  34  1...........................................................................VLTLVEPQSSGIGGGALIMLWDGKN--VRTYDGRETAPAGATERLFLQADGTPMPFTQAQIGGRSVGTPGVLRALELAHKKHGRLPWAQLFEPAIKLAEQGFVISPRLYQLIASDSSLRSSPDMVAYFLNDGRPKAVGTRLKNPALAAVLQRIANEGPDALYQGAVAQEIVDKVQANPGSLSLSDLKGYTAKERAPLCTDYKRWQVCGMPPPSSGGIAVAQILGTLQALDAPAGSEPSPQAVHLISEAERLAYADRAQYVADTDFVPVPVKGLVDPAYLASRAALIG-ERSMGTAEPGTPPGIQIASTSQVVAIDDEGGAVS. 349
71 0.000e+00UniRef50_A0A1V6A5K2 Gamma-glutamyltranspeptidase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V6A5K2_9FIRM  ali  34  25...........................SASMASYRPDVVARKGVVSSAHSLSSYAGMLILERGGNAIDAAVAVASSLNVVEPNLSGAGGNGMMMIYDAATGSVNGLAMSGAAPMGLDP----KKLSAEVMKSTYESGYTAGVVPGNFGGWIAALQKYGTMSLEEVLQPALEMAENGFPVSPGLSSGIANAKEEFKYPTTANVFLPDGEAPQPDELLVMKDLAKTFRKIAAEGADRFYKGDIADEFARFYQANGGFFTKQDFANYKPIWHTPVHTTYKGYDVYSPAENTRGGIEVIMQLNLIEAYDLKKLGHNSAEALHLIAECIKIAKADVYEYVADPAFTNVPWAGLSSKEYATERRKLIDLAKAIDYPVPGDPFKFQKGETTSFYVVDKFGNAV.. 428
72 0.000e+00UniRef50_B0UXV5 Gamma-glutamyltransferase 1a n=49 Tax=Chordata TaxID=7711 RepID=B0UXV5_DANRE  ali  28  39................................TVSSDHFYSKAAVAADAGKCSEVGRDILKRNGSAVDASIAALLCVGLFNAHSMGIGGGLFFTIFNASTGKVETIDARETAPKNASEDMFGNN------TQLSRKGGLSIAIPGEIRGYEMAHNRHGRLPWRELFLPSIKLARNGFPVGKALANAIAKNKEILSDMTLCEVFCDSDKILKENDIIRFTTLADTYEKIAEEGPDVFYSGSLAQNIVDDIQAAGGIITLEDLREYKPVLETPLKLTVGEYTINVPDAPSSGPVLAL-ILNIVDGFNFSDHSVSTAETYHRIVEAFRFAYAKRSK-LGDPRYLNITIHNMTSDYFADNIRSKITDDTTHPD-SYYDPEYPDNHGTAHLSVIAEDGSAV.. 404
73 0.000e+00UniRef50_A0A0P5AG99 Gamma-glutamyltranspeptidase 1 n=9 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5AG99_9CRUS  ali  28  143.............................TPASPSKLGKYKTAAISSDSTPCSEIGRDIMAEGGNAMDAAIAALFCNGVVNPQSAGIGGGFHMTVYDPVTQTAKCLDARETAPLAATEGMYSSNAF------LSQIGGLAVAVPGELAGYWDAHQTYGRLPWSRLVQPAIKLAENGVEVNSHLAMVLQLKAVSIKAEPSMWIFLNEGDVLQVGDTLKMHGLAKTLKEIAEHGVDIFYKGTIGIKVVEDIQRRGGIITKDDLLHYRTEWMEPVAVDLDNLTLYSIPSPGS-GVLVAYIMNMLDRLPLERDVPRSPLTYHRITEAFKHAFAQRTK-LGDPRFVPEVTETLASKRFADETFEKFNDSYTSNDPAFYGAVNPDSKGTSHISVLDRDGLAVS. 513
74 0.000e+00UniRef50_UPI000DEB90F4 gamma-glutamyltransferase n=1 Tax=Bacillus sp. P14.5 TaxID=1983400 RepID=UPI000DEB90F4  ali  42  21.....................................AVGDYGMAASATKESSDIGAEILRRGGNAADAIVAMQFALAVSEPFNTGVGASGFIVYHHKESGETKVFNGHSQAPQSAHPEVCKNEDGEVMPFVERTMNESFVGIPGIMKALDTIHKTYGLKELGELIDPAIDLAENGFTVNSLWDTALKLYGDRVGHT-AKEFFYPKGVPLVKGDLVKNKALAKTFRIFKEEGIDALYKGVIGEAIIDRLQSHNGHMEMRDLENYECQIQDPVVRNYRGFDVAVPPPPNGGGTNLLQILKIIERFDVSEYHASSWEKYFILSEAMRLVFSDKLAYMSDPDFHKVPVNGLLDPEYIAERAKFIDFKGRNPDIDFGNPWEYEGRETTHFTAVDQWGNVAS. 395
75 0.000e+00UniRef50_U9VXQ3 Gamma-glutamyltransferase n=2 Tax=Leptolyngbya TaxID=47251 RepID=U9VXQ3_9CYAN  ali  30  14.....................................ARSLHGMVVSPHTPASKAGHQVLQQGGNAVDAAIAVCAALSVTYPHMNGLGGDGLWLIYDASTQQVHGLNGSGRS---AT---YLDANTLLNGAELPQRGAVAATVPGAVDAWWQAHQRFGHIPWASLLQPAIALAETGYALSSSQFRWTRKDRDLLAQDGAAATFL---SAAQVGDSIQNPALAQVLKTLAVDGAEFFYRGAIAQTIIDYVAPLGSPLRLEDFAQHRSNWVEPLTTEYRGHTIYQL-PPNTQGLTVLQILNLIEPDDIASLTQ--VDYYHLIVEAIKLAFCDRDRWAGDPTFTDIPIELLISKAYAAQLRPQIDWQQARFQQGP-----AMGGDTIYAAVVDHQGNAVS. 358
76 0.000e+00UniRef50_A0A1Z9P070 Gamma-glutamyltransferase n=1 Tax=Saprospirales bacterium TMED214 TaxID=1986670 RepID=A0A1Z9P070_9BACT  ali  30  17.........LLGSCFVFLLSTLVQPHDLSADDRRVEVIRSDGGIVVSDSRIASQIGRDVLLDGGNAVDAAVATAFALAVSWPEAGNIGGGGFMLLRPANGKNPVCVDYRETAPNSMQKDSFTRSDTTFTQ--------KAVGVPGTVRGLALAHAKHGRLGWTRLVMPASQLASQGVPIDLPLAKSLNSVQSENKYSELRRVYKPDKSDWKAGDTLLLPDLANTLRIIAQEGPDSFYKGSIAKQLVEEMGQGDGEISLQDLDQYKAIVRPAMKGKFHGYTVLGAPPPSSGGTCIIEALNIIENFNMSKWDRYDPQCIHLIAETCRRVFADRARYLGDPKYTRIP-EFLTSKKYAREVAKSIDLNQATPSITPEINVISESPDTTHFSIVDKNGMAVS. 404
77 0.000e+00UniRef50_A0A1Z9FK76 Gamma-glutamyltransferase n=1 Tax=Gammaproteobacteria bacterium TMED134 TaxID=1986736 RepID=A0A1Z9FK76_9GAMM  ali  33  1MMTRVVLLVLTAFVISGKAHAGDWTHG---------------GMAVTANPHATDAAIEMLSQGGHAVDAAIAAHLVLGLVEPQSSGIGGGGFLLVFEREDQALVFHDGRETAPSAASPDMFLT-DGEVMPFMEAWQSGLSIGVPGAVALYKQAHDRHGRLPWPAVFEPAVRLAEEGFAVSPRLAGRIARFTRLDENPGASXYFYPQGEPLKVGEIRKNPEYAATLRALAKEGAEAFYQGELARAIVAAAQANPGRLSLVDLENYAPKTREAVCGEFRALSICSASPPSSGG---AQIM-IAQLYDHLLKDASDGDKVRAFVDAQRLAYADRDHYFADPDXVEVPLKALLGVDYLRQRAS----DRADPDAAPGSDTTEEAAGTTHLSIVDSDGNAVS. 389
78 0.000e+00UniRef50_UPI0009DD8DA9 gamma-glutamyltransferase n=1 Tax=Asaia platycodi TaxID=610243 RepID=UPI0009DD8DA9  ali  35  281.TRTAALSLLLAGISLPSLASAAPAVAAMPYDPPAKPVEGTRGMVVSAQHLASEAGRQILAAGGNAADAAVAVGYALAVVYPAAGNIGGGGFMTLRLPD-GKTTFIDFRERAPGAATPTMYQDAQGKVDP-KASIEGWRAVGVPGTVAGLEEIHHRWGKLSRAKVMAPAIVLAEKGFVLGRGDADLLHTSTEAFKDAHARDIFLRDGTPLQAGDRLVQKALAKTLRSIAQSGASEFYKGAIAHQVVAASEKSGGILTLADFAAYHPREFAPIHCSYRGYDIDTAPPPSGGGVALCEMLDILSGYDMKALGLRSVAGVQRQVEAMRHAYSDR-RDLGDPDFVKNPVAHLIDPAYAAEIRKGIPLDHALNSAQPAASDTHEKHETTQFSVADRSGFAIS. 698
79 0.000e+00UniRef50_A0A1W2W153 uncharacterized protein LOC100180342 n=7 Tax=Opisthokonta TaxID=33154 RepID=A0A1W2W153_CIOIN  ali  30  3...............................NSRRSVLNCLNGCVSSSQTLASQLGLDILKKGGNAADAAVTVAAALNLMEPYSTGIGGDMFCLYYDKSKNKVFGLNGSGRAPGKLTLE-YLNKLGFNEENKFEYRSPLSITVPGACAGFVDCIDKFGKLTLKEILSPVISMARTGFPVSPITSHGWNISSEKLFDP--KNVFGKDGRTPETGEVFRNPGLANVFESVANHGKDGFYKGWVADEIVDVVQNMGGVLTHQDLINHESTIVEPISIDYKGFRLWEI-PPNGQGIVALEALNILKNFDIGEMKHNSTEYLHLLVEAVRLSFADALQYCADPSFSDLPFKNMLNTKYGKLRANLIDLKKANKSCLPGDIRNFQS-DTVYFTTADKDGNVCS. 375
80 0.000e+00UniRef50_A0A142Y399 Gamma-glutamyltranspeptidase n=1 Tax=Pirellula sp. SH-Sr6A TaxID=1632865 RepID=A0A142Y399_9PLAN  ali  31  1MISRRYFLGNTAAVAALAPAWSLAQDKTAPSSALQRVDQGSN-VAATVHPIASLASAEMMRRGGNAIDAAVAAAVCLSVVDGHNSGIGGGCLMMIRLAD-GSLHAIDGREKAPASANRDMFLRNG--VADVKLSQDGALACGVPGMIAALHSAHRRFGKLPWGDLFEPAIRAARDGHPMSRSTHASIKNEESVLKRFAASALFKTDGSLYAVGETWVQADLANTLQQIAKKGVDYFYHGEFASRCASHLKEQGGALTEKDFANYRAVDRVPLKTSYRGYTVVGFPPPSSGGIHIQQMLQMLSHFPLKEWSKGGLPFYHVLAEAMKLAFADRAYYLGDSDFVELP-AFLTETSYTDELAKRIQLDRATAVPGHLPSKSKEKKHTTHMTMADALGNWV.. 399
81 0.000e+00UniRef50_A0A2C5YAS0 Uncharacterized protein n=2 Tax=Ophiocordyceps australis TaxID=1399860 RepID=A0A2C5YAS0_9HYPO  ali  28  1MARLTRLFLVVAAAGLCHASAQSPLMAVFGPHDPASGAGASLGAVASEASECTHIGRDLLARGGNAVDALVGTTFCVGVVAMYHSGIGGGGFALVRDHD-GTYEAVDFRETAPAAAHEEMYQGNVGG------SLVGGLAVAVPGEVRGLEYIHNKYGVLPWKTVLQGAIHVARDGFQVSSDLVRSLQRHSFVVRDPSFAQDFAPNGILLGQGDVMTRKRYANTLEAIANQGADAFYHGPLAHAMIETIQASNGTMTLQDLANYSIISRPVRRIRFRDVDIFTVGAPASGAVS-LSILKTLEQYSLDGSDTRDALTLHRFTEAMRFGYAARTD-LADPDFVRAAEERLLDDDYARLVRSLISDDHTLPVDAYGPRREFSSHGTSHIVAADRSGMAVS. 401
82 0.000e+00UniRef50_A0A2E6HE39 Gamma-glutamyltransferase n=14 Tax=Bacteria TaxID=2 RepID=A0A2E6HE39_9BACT  ali  32  36...........................................AAVTVHPLATNAAKKAFEKGGNAVDAAVASALTLGVVDGFNSGIGGGCFMLIRKPD-GNFVAIDGREIAPLKASRDMYL-RGGRARP-ELSQTGALAIGVPGALAAYELAVSEYGNLDLAEHLTRSAAIADEGFVLDNSYLRRLNQAAKKLRFSDSNRIFLNNGAPWSRGHRLRQIDLARSYRNIARHSTDWFYRGSFASKTENWMIANGGLIVEEDFLRYKVKSRKPVRTTYRDHDIVGFPPPSSGGVHVAQILNILEHFDLFSMKPDSPQFVHIVAEAMRLAFADRSYWLGDADFVSVP-KGLATKRYARMLAKKISRTKTAKISSHSMPLDFDGKHTTHFSTADSEGWWV.. 390
83 0.000e+00UniRef50_A0A174KUM6 Putative gamma-glutamyltranspeptidase n=17 Tax=Clostridiales TaxID=186802 RepID=A0A174KUM6_CLOSY  ali  29  13.............................PSHWEKPAAHGDYGAVSCNNSYAARAGLWILKNGGNAFDAAAAVSLALSVVEPHHSGIGGGCFSLLYCEKEGRIFALDGRGTAPVQAGPDLFLKNG--EVQDEWKDLGGQSVAIPGLLKTMEDMLKRFGTMTLKEISVPAIRYAKEGFGTSYTGALTMYDDRKMRISEGFRKLYLKNGEFYRFGDIQRNPELGVLLETIAENGTDVFYRGEIAQRIVSVINSRGGCFETADLENYAPKYREPVHTDYRGYEVVSFAPP-SGGCTLIEMLNILEQNDLRAMGHNTADSIHAIAEAMKLGFADRSIALGDPDFVSVDTERLTSKAYAAKRFRLIG-GHAGEYAPAEGIEAKEPGNTSHFSIMDRFGNAVSQ 382
84 0.000e+00UniRef50_A0A1F3B2C6 Gamma-glutamyltransferase n=3 Tax=unclassified Armatimonadetes TaxID=1042316 RepID=A0A1F3B2C6_9BACT  ali  31  4...........................SASFRTGRAPVFSRRGIVATGHPLASAAGLHVLMQGGNAVDAALAAAGVLGVVQPMMSGLGGDTFIVLWRAAEGKAYALNGSGAAPHAATREWFVSHGHAKMP----VRGMLSASVPGAVDAMETALGAWGRSTLAQLLEPAIDYAAHGFPVASKVAEWIHEAQDMLAFPSSARIYLRGGRAPRAGEVLANPDLARSLRAVAEGGAEEFYRGDLARRIVRYGRDHGGLLTEREFAEHASEVHDPIRTTYRGTTVCTAAPPSQGAI-LLEMLNILEGFSSDELRWGTTRAVHLIVEAKKLAVADRLAYLGDPRMVDIPLEVLLSKEYAARRQRAIDPDRALTQVPAGALPEAV-GDTTYLCAADREGNLVS. 370
85 0.000e+00UniRef50_A0A255Z0B2 Gamma-glutamyltransferase n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A255Z0B2_9PROT  ali  29  11...RRLIAGVLALCLMPSAALAQQAPEPASAARVKELVTARRHMVVAANPLAVQAGLDVLRQGGNAVDAAVAVQAVLGLAEPQSSGLAGGAFMLLAEPG-GKLTTYDGREVAGAAVTPTLFIGPDGKPIPFLETFPQGRAVGVPGVVAMLAQAHAAHGQLPWASLFKPAIDLADAGVPAWPRMVGILTEWQRMLGKSPLRDYYREGGRPPALGERIPMPEQAISLRLLAAAGPDAFYRGPIAKAIVERLEQAAGVLSLEDMATYRSVERDGICMPYRVWKVCGMAPPSAGGVAVLQILGMLSQHDLRAMGKDDPRAWHLLMEASRRAHADREAHIGDPDQVAVPTRGLIDAGYIASRAAGIDPARASGPVPPGEPPAPDIPSTTHFSIIDDAGRMVS. 422
86 0.000e+00UniRef50_P07314 Glutathione hydrolase 1 proenzyme n=404 Tax=Euteleostomi TaxID=117571 RepID=GGT1_RAT  ali  29  32..................................KPDHVYSRAAVATDAKRCSEIGRDMLQEGGSVVDAAIASLLCMGLINAHSMGIGGGLFFTIYNSTTRKAEVINAREMAPRLANTSMFNNS-------KDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARHGFPVGKGLARALDKKRDIIKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQEGARAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAEVIEPMSIGLGDSTLYVPSAPLSGPVLIL-ILNILKGYNFSATPEQKALTYHRIVEAFRFAYAKRTM-LGDPKFVDVSIRNMSSEFYATQLRARITDE-TTHPTAYYEPEFYDDGGTAHLSVVSEDGSAV.. 393
87 0.000e+00UniRef50_A0A2L0HFX4 Gamma-glutamyltranspeptidase 2 n=39 Tax=Proteobacteria TaxID=1224 RepID=A0A2L0HFX4_RHIFR  ali  27  5..............................QFPGRSVVMGRHGAAATSHALSTLAAIEILRRGGNAADAAIAACAVQCVVEPGSTGIGGDNFVLFAPASTGKVYGLNGSGCAPGGLTAEHLLRQGVKKI----ALTSVHAVTVPGAIDSWAKLNQRLGSMPLGALLQPAIRHAEEGFAVTERVATDWARNEDKLKDANSARMWLKGGRAPTAGEVFRQPEHAKVLREIAAKGRDGFYTGWVAEDMVAYLRSLGGTHSLEDFASQEAFWVEPISTSYRGIEILEI-PPNGVGITTLLMLNILSGFDLGKYDPVGVERFHIEAEATRLAFEARDMYVADPAFADVPVQKLLSANFADGLRGRIDLRRAMPAGGPLGTTTYR--DTVYISVVDGKGNACS. 375
88 0.000e+00UniRef50_V4BXA9 Uncharacterized protein n=4 Tax=Mollusca TaxID=6447 RepID=V4BXA9_LOTGI  ali  30  81.......................................YKHAAVAADVEQCSRIGKDILKKDGNAVDASIAALLCMGVADPQSMGIGGGFFMTVYEKAKDKVVVIDARETAPGKATEDMYVKHPGT------SSRGPLSIAVPGELKGYWQAHQEFGALPWKDLFKPAIKMCLDGFKIPGSLGRAIQKNQDIQEEPSLREVFVNTGEVYKTGEIMKREKLGKTLKTIAEEKMESFYTGSLSKLLLEDLKKINSIITAEDLKNYKAIRKEPLKIKLNGLSLYSPPPPASGAV-LSFILNILDGYDLTKRDVESNLTYHRMIEAFKFAYAKRTD-LADEDFVNVTVANLTSRDYADFIRSKIWDN-TTHDMMYYGPTFYDKTSTAHLSIVDQHGNAVS. 441
89 0.000e+00UniRef50_G4L0X3 Gamma-glutamyltranspeptidase n=3 Tax=Bacteria TaxID=2 RepID=G4L0X3_OSCVS  ali  31  70........................DEATGELNREGRDATGDNAVVSAGTPWAASAGLDILKKGGNAVDAAVAVAFALSVTEPQASGLGGGGFMTIRD-KAGEVKFINFREVAPQLAVENYWTSSDGTSVIGNENYTGGRAIGVPGEVAGMVWVLEHYGTMQLKDVMQPAIDLATNGFYIGPTTGSCLDDNLAKLKYSEFASIYLKDGTNYTTGDLFKNAQQARALQLVADHGKDGFYTGELQDAMITAANKYGGVFTPDDFTNFCAGELTPVEGTYRGYKIYSSPLPSSGGLCVIQLLNILENFDIKTMGHNTVETIHLMSEAMKMMYADRAKYLA-ADTEDAMVKSMMSKAYAKSLAAAISMTEVHKPTSH-DPMQYEHMDTTHFAIADKDGNMVS. 449
90 0.000e+00UniRef50_I4AMS2 Gamma-glutamyltranspeptidase n=1 Tax=Bernardetia litoralis (strain ATCC 23117 / DSM 6794 / NBRC 15988 / NCIMB 1366 / Sio-4) TaxID=880  ali  37  59.....................................VLGKNGMVVTAHPLASQIGLEILKKGGNAFDAAIAVKFALAVAYPRAGNIAGGGFAILRF-KNGESTALDFRETAPLSSTTTMYLDEDKKPLSH-LSQEGHLSVGVPASVAGMVELFEKQGSLSWEELIKPSIKLAQNGIILTENEANKLNDYQEEFRKWNDEKVFIYKGSKWTKGDTIIQKQLAETLTRIKNEKRAGFYKGKTAELLLKEINKGKGIITQKDLDDYKPVWRKPISQTISAYTILSMPPPSSGGIALAQLMQINQNRSPLNLKHNSATTLHILTELERRVYADRATYLGDPGFYDVPQKMLLDSSYNMERNSTISLFKKTPSIKEGKVNSIESMETTHFSITDKEGNAIS. 438
91 0.000e+00UniRef50_A0A1V1X1Q5 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium PC51MH44 TaxID=1869304 RepID=A0A1V1X1Q5_9DELT  ali  31  8........................SEYEQTRQSHRPSIKGRQQMVVSGHALATQAGMRILDRGGNAVDAVVAAGLCLCVLQSDMVSFAGVAPMMIYMADMTAPVTISGLGPWPKAASVEYFRTEHQGKIPEGVART-----VVPGSPDSWIKALAHYGTLTFEAVSCDAIDLAENGFPMHSFLRNSLHELKDKYARPSNAEIYLPQGRPPETGEIFCQKDLAITMKRLAEQGRDEFYKGKIAKTIVNFHQKSGGLMTLNDLASYESAIETPCATTFGDYIIYSCRPWC-QGPALLQMLNILENFNLTTMGHNSIEYIHTIIETMKLVFADRHRFYGDPDVVNVPIEGLLSKEYARERAKLVRMDAAWQEIPPSNPWKYQREDTSYVCTADQWGNCV.. 412
92 0.000e+00UniRef50_W8YN86 Putative gamma-glutamyltransferase YwrD n=10 Tax=Paenibacillus TaxID=44249 RepID=W8YN86_9BACL  ali  31  7......................................MGYQGMVAAPHYIASEVGRDMIRRGGSAADAAVAISASLGVVYPHMTGVGGDSFFMLYDAASGGLQGYNGSGRAGSGLHPGVYLDAGESAIPQRGVRS---SITVPGMVDAWWEVWRRSGRLPWEELLESAVQYAEKGFPVSPNLHRMLANGKELAACAPLAEIYLPHGILLGIGDRLIQTELARTLRELQAGGRDAFYSGSVMQRIVDGMRRDGGLLTEGDFASHQGEWVKPISVNYRGYDVHQM-PPNSQGFSALMMLNVLENTDLSAVPRESAEFYHLMAETVKKTFRDRDRYLTDPDFAHIPLERLLSKSYARHLYEEID--RSFPDPAP-HLSPAMGQDTAYAAVVDGEGNAVS. 359
93 0.000e+00UniRef50_A0A258GZ32 Uncharacterized protein n=2 Tax=unclassified Alphaproteobacteria (miscellaneous) TaxID=33807 RepID=A0A258GZ32_9PROT  ali  34  23..............................GPAQPPAAVTGEAMVAAADPLAVEAGLEILRAGGSAIDAAIAVEVTLGLVEPESSGIGGGGFLIHYRGRDEAIDAYDGREWAPAGATPDMFL-VDGKPLSFELAQASGKSIGAPGLIPMLKLAHEQHGKLPWAKLFEPAIRLAEEGFPVGPRLSRSFAQHKDLLADAQARAIYLDNGLPWPQGHVLKNPLYAQSLRAIAAEGPAALTSGAIAEAIVASAQREPGTLTVADLQAYQPRRLDPLCAPFRVYSVCTMPSPSS-ANAMLSILGLYERARPTPESPHNVQAWAAYVWASRLSYVDRDHYMADDRFVQAPTKELIAPSYLDARASLIDLGMGRATIPVGTPAGEEEHGTTHLSVVDHDGNAVS. 407
94 0.000e+00UniRef50_A0A2U0SNP1 Gamma-glutamyltransferase 2 n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2U0SNP1_9RHIZ  ali  27  6...............................FPGRSVVYGMRGAAATSNPLSTGVALQVMQNGGNAIDAALTACALQSVIEPYNTGIGGDCFALVWNAREKKLSAINGAGWAPTGLSAEGLLADGVTEIKETD----IQAVTVPGAIDAWDLLLRNHGTQSLADILAPTIDYAERGVVVGPRASVDWTRETELLRDPGARAFLLDDGNAPLPGSVVRFPRLATTLRRIADYGRDEFYQGQIAADLVASLKELGGTHEAADFADYRSAYVEPISTDYRGTRIMQL-PPSGQGLTVLVMLNILAGFDIAGMGPDSAERYHLEMEATRLAYDLRDAYVADPTFADVPVEELLSAEFADRLRRTIAMDRASPADR--LVPRLGQSDTVYVTVVDKAGNVCS. 366
95 0.000e+00UniRef50_A0A2E7TZJ7 Gamma-glutamyltransferase n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E7TZJ7_9BACT  ali  31  1.MRFMLSAFAISILWTPLHAQAPEEAPFW-----RPVVMGTFGMVAAEHPLESMAGWQVLEAGGNAFDAAAAVFYMTTVVEQHQAGMGGDLFMVAYLADEDRVVFINGTGGAPELATPEYFRELGG------IPSEGPDATDVPGAVGGIDLALTTFGSMSYAEVLAPAIRAAREGHPLDFWASGYHQSAVSKTSYPSSVSVLMPEGHPLDRGDVFVQADLAKSMEMIAEDGADVFYRGEIARRIDDFYEEMGGRLRYEDLDAYEAELSEPIMTRYGDLEVYQ-SAPNSQGIVMLMAXNILEGFDLQAMGHNSAXXVHVITEALKLSFADRNRWVADPRFVDVPTEELLSKEYASARRGLIRLDKALVAPPPGDPDAYEDAGTSSFSIADQYGNLVS. 410
96 0.000e+00UniRef50_A0A1X9MJ18 Putative gamma-glutamyltransferase YwrD n=128 Tax=root TaxID=1 RepID=A0A1X9MJ18_9BACI  ali  28  5.........................PTYHPYSSFQTPVFAKNGMVATSQPLASQAGLDILKQGGNAIDAAIATAACLTVLEPTSNGIGGDAFALVWVKD--QLYGLNGSGPSPQSISIEALKALGHERIP----QFGWTPVTVPGAPASWAALSERFGTLPLIDVLQPAIQYAEEGYPVSPVLSKYWEEAYESYKFHPWFDTFAPKGRAPKAGEIWRSPDHASTLRLIGETNAESFYLGELAAKIIAFSKLNNGFLDFVDLQTYKPEWVDPIKVNYRGYDVWEI-PPNGQGLIALMALNILDKFEIKE--KENLDTYHMQIEAMKLAFADGQQYITEHDKMPLSVDQLLSSAYAIERGRLITDKAQLPEC--GSPAY---SGTVYLATADDQGNMVS. 369
97 0.000e+00UniRef50_D1C1I6 Gamma-glutamyltransferase n=47 Tax=root TaxID=1 RepID=D1C1I6_SPHTD  ali  29  2........................ATMPVRRTSHRPPIQARHYVAASGHYLATTAALRILAQGGNAIDAGVAAGICLNVLLPDLTSFGGVAPIMVYHRATDELKVITGLGCWGRSASLEVFLEEEQGEIP-----VGVRRSVVPGAPDAWLTALARYGKLSFAEVVQPAIELCEGGFPVYPSLHRNIAKEADVIRWPSTAAIFLPGGEVPAVGDVLRQPDLARTFRRVAEAARDLFYRGDIGKEIAEFITREGGFVSEEDMAEFHVDVEDPVHTSYRGVDVFACGPWCQGPV-IPQTLNVLEGFDLRAMGHNSADYVHTVVSALDLAFSDREAYYGDPKFVDVPLDILLSKEYAARQRERIDPARAFGAPEPGTPEGADAPDTSYVCVVDEEGNAFS. 396
98 0.000e+00UniRef50_UPI00039C5CB6 gamma-glutamyltransferase n=1 Tax=Xanthomonas maliensis TaxID=1321368 RepID=UPI00039C5CB6  ali  31  40..............VPASAPQPRELDDARGYLPIHHPLRSTGGMVVSQSRPASEVGVQILRAGGNAIDAAVAVGLAEAVTLPRAGNLGGGGAMVIYLAKEHRTTAFDYYGSAPAATTPGLLLGADGKR--DREASRSWKSIAVPGTVAAFAAAQRRYGKLRWAQVVAPAIALAEQGVRLSDDEARVLDWAKPSLARPETRAQFFKDGSSYAAGALLKQPDLAWSLRQIAGDGADAFYKGEIAKRIVAASQQHGGILTAEDLANYQVRELAPVHSSYRGVPLALAPEPASGTI-LAELLNLIERVPLSPADAGSAKAYHLIAEATRLADADRKAYAGGTPQAVSRSAGLLDKAYAARRAALISLAHTLPAVDAGDPRPHESPDTTHYSVVDADGNAV.. 422
99 0.000e+00UniRef50_A0A2V3CWS1 Gamma-carboxygeranoyl-CoA hydratase n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2V3CWS1_9PSED  ali  35  267...................................................................DAAIAMQAVLTLVEPQSSGIGGGALIVLWDGKA--VRTYDGRETAPAGATEKLFLQADGKPMPFPQAQIGGRSVGTPGVLRALELAHKKHGRLPWAQLFEPAIRLADQGFPISPRLHSMIVADPYLAKSPDMAAYFLNDGTPKAVGTLLKNPQLAAVLERIAKEGPNALYQGPVAREIVAKVQANPGSLSLNDLQGYRAKEREPLCTDYKRWQVCGMPPPSSGGIAMAQILGTLQALELAGLEPA-PEAVHLIAEAERLAYADRALYVADSDFAPVPIAGLVAPQYLAQRAALIG-ERSMAKAEPGKPQGIQVASTSQVVAVDDQGGAVS. 623
100 0.000e+00UniRef50_A0A2E8L5S7 Gamma-glutamyltransferase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8L5S7_9GAMM  ali  30  36...............AANIVAAPGSRGQGWLAQGRSEVIARHGIVATSDPLASQAGLEILQQGGNAIDAAVAAAAVLDVTSQNDTGLAGDLFALVWSAEDQKLYALNSAGFAPAGWTPEFFKEELGL---NQIPGRGVNAATVPGAVSGYDALLDRFGTMGFEETFERAARIAEQGWGQSERRHDDLVSQQKLLQDADSAAVFLEDGEVPALYSIIRNPDLADALRLIQREGREAFYSGDIADALIAKIQSEDGVMTHEDLAAFQSEWIEPISTSYHGYDIFQLPPP-GQGWAALEMLNILENLNLTALGPSNPDYWHFMVEAKKLAYSDLQAYNADPLFSEVPLDRLLSKEHALGLCDRIDMDLASEPSVKGGL----DGGTIYLTTADRWGNMVS. 416
101 0.000e+00UniRef50_A3LTM0 Gamma-glutamyltransferase n=45 Tax=Saccharomycetales TaxID=4892 RepID=A3LTM0_PICST  ali  31  4........................PEAFIKFSSRRSTVYSTKGIVSSTQSLANAAGLRILSKGGNCVDAAIAVSAALCITEPTSTGIGGDCFALYYDPKSGKVLGLNGTGRAAKAVTPDVWNEHNHGKPMKRIPYTSVFAVTVPGAIAGWNDAYDKWGSVTFAEILEPAIELAEKGFPVAELASRSWRSASVKLKNQNADNAFLFDGEPPQEGDFVTNKRVAETLKIVAKEGKKGFYHGPVAEAIIRTTGARNGKLTLDDLSSHTSTFVDPIKLNFQGSNVWEI-PPNGHGLVALLALGIIQELDIYKLKHNSAEYLHLLVEVCKIAFYDSDEYVTDPQFKDLPIESLLSPEYLKKRAKLFDPSKIIDTMSHGVPDPKYKSDTVYLTVTDSNGEACS. 397
102 0.000e+00UniRef50_Q0VKT3 Gamma-glutamyltransferase n=134 Tax=root TaxID=1 RepID=Q0VKT3_ALCBS  ali  33  24...........................................AVASAHPLATQAGLNILEQGGNAFDAAVAVAATLAVVEPYSAGMGGGGFWLLHREQDGLQTFVDARETAPDAATAAMYQNKEGKVM-RDWAVNGPSAAGIPGQAAAFVHLADNYGKLPLTSTLAPAIALAEHGFHVEEHYRKLAGYRKDVLRFPEAAAIFLHNGKVPPNNHLIKQADLARVLRALAEKGNAGFYQGEVAKQLVDGVQQAGGIWTLDDLANYKVVERTPTVSQFRGGRVISAPPPSSGGIVMGEALNILSQLNDGNTAEITP---HLAIEAMRRAYQDRARYLGDPDFVDIPVDKLLSIGYAKQRASSITLDKATASSSLGEPVGVEEGHTTHFSVLDKDGNRV.. 374
103 0.000e+00UniRef50_UPI0009750B51 uncharacterized protein LOC105331781 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI0009750B51  ali  31  20........................................................VDILKAGGNAADAAVAMAATLNVTEPCSTGIGGDAFCLFYDAKRRKVECVNGSGRAPSKLTLDLLHQQGYSTYKPYPDQTHGHSVTVPGAPAAWVDTVERFGKLSMLEVLRPAIELAETGFPVQQIAASFWNKGSHLLSDPNNGKDMLLNGRAPRHGEVVRLPLLANTFKELGTHGKPGFYSGRVAKAIAEVVQQHGGVMTTEDLASHVTTFEDPISADYKGYRVWEV-PPNGQGITTLMALNILEGMDLKGMGHNSAEYLHSLSESFKLSFADTTWFCADMSQIEVPVSELLSKDYAAKRRSQIKPDSVLSDVQHGGISV--GSDTVYFTTADCDGNACS. 361
104 0.000e+00UniRef50_A0A0R2V5Q1 Uncharacterized protein (Fragment) n=1 Tax=Methylophilales bacterium BACL14 MAG-120920-bin58 TaxID=1655631 RepID=A0A0R2V5Q1_9PROT  ali  31  1..........................................GAVVTSNALATEAGEKILAEGGNAYDAATTISAMLSVVEPFASGLGGGAFWLIYDAKSKKYTMLDARETAPLQSYKNMYLDENENVIK-NMSTLGPLSAGIPGIPAVLSYVNDKYGSKKLSTLLAPAYKAAINGFPVNERLKGAKYKKKWLKKYKETEAIFLHKGEVPKKGWILKQTDLARTIKKLMKDGHRSFYTGSFAKKMVESVQNHGGIWSEEDLNRYKVLEREPVRSTYKGISIIAPGLPSSGGLVLSNALNILAGYELDKLSPTTQK--HLIIESLRRAYYERALKMGDPDFMDNTLEYLLTPSYAAKQRENLNINYATDNQTADPPYQGQGNDTTHFAVIDKFGNRV.. 355
105 0.000e+00UniRef50_Q1DCI3 Gamma-glutamyltransferase n=25 Tax=Cystobacterineae TaxID=80811 RepID=Q1DCI3_MYXXD  ali  32  27.......LLAAVMMVACVAQAARP---------------YRGGAVATAYPQASAAALEMLEKGGNATDXXXXXXXXXXXXGPYHSGVGGGGFALVHDAKSGDTKVLDFREVAPKAATRDMYV-KDGKVVPG-LSTDGALSVAVPGAVAGYLELLKAHGKLKPAVVLAPAIAAARKGMWVTPRYRTMAEGRLACLRDAEASRVFLVKNEPPPVGHVIRQPDLARTLSSIAKGGAKAFYAGPVAKAIATSVQAGGGILTQEDLAAYKTRSATPLEGTYRGHRILTMPPPSAGGVAVIQVLTAMEQLRPQGVTFRDAEALHLYAEAVRRAYVDRAKYLGDPAFVDVPLARLVSPGHVADLAGSIDPKKATPSASLLAPPEPEKKNTTHISVIDKDGNAV.. 421
106 0.000e+00UniRef50_A0A1Q7DRZ1 Gamma-glutamyltransferase n=24 Tax=Bacteria TaxID=2 RepID=A0A1Q7DRZ1_9BACT  ali  28  1MTIARHLTLLSFLCTMTRAADSQQPRPTS--LAHRSTVYAPHGMIATSQPLATAAGLAVLERGGNAVDAAVTAAAVLNVVEPPMTGIGGDLFAIVWSAKDHKLYGLNASGRSGSLMTSAALLAKGHTTMPQESVED----ITVPGALSGWDALLRRFGSITLAQALRPAIGYAEGGFPVTPIIAAEWATQVAKLRNDEGARYLVDDGRAPPAGAWFQNPDLARSLRLIAEQGIGALYGGELGRRIAERVRALGGYLTVDDLGKHRPEWVEPISATFKGYRVWEL-PPNGQGVAALEMLKILEPYDLKALGHNSAAYLHLLIEAKKLAYADIARYVGDPTAMTLPAANLLTDAYAASRRALLDPSRAADRPAPGKPLTA--SETIYLTVADSAGNMVS. 390
107 0.000e+00UniRef50_A0A2E7TGK4 Gamma-glutamyltransferase n=9 Tax=Bacteria TaxID=2 RepID=A0A2E7TGK4_9BACT  ali  33  1MKTKLSLVALFLL------SCSGTMPEVPXPFSEKRLSWNKGAMVSAANPHAVDAAVEILKMGGSAVDAAIAAHAVLGLVEPQSSGLGGGGFILNYDFKSGDLVFIDGRETAPSSAKIDMFMKE-GEVMSFREAWVSGKAVGSPGAVALYKTAHNQSGKVDWNKLFDHAINLAENGFKVSPRLAQALESFGXLSINPGSKEYFYPXGSPLKTGDILKNMEYANTLKRIAQEGPEAFYSGPIANEIVASATANPGTLSLDDLKNYKTVVRPVICGSFRDLKICTTSPPSSGG-AQIMIAGIYDHLIDKNLSKK--DRITAFVDAQRLSYADRDHYFGDPDEVEIPLDALLNPKYLKLRSKRFSPNETPTPGNPSKVLGYEDSGTTHISIIDFEGNAVS. 407
108 0.000e+00UniRef50_UPI0008322B21 gamma-glutamyltransferase family protein n=1 Tax=Croceicoccus sp. H4 TaxID=1783232 RepID=UPI0008322B21  ali  34  30........................................EKGMVSAADPRAAKAGVEMLRAGGNATDAALATMIALTVVEPQSSGIGGGGFLVLDPEGDGDPVSYDGRETAPAAATAQWFLDNDGKPLPFRTAVESGLSVGVPGSIALAAKAHGKHGALPWAKLFEPAIALARDGFDVTPRLRSSLDQWRSVGATPEARALFYTDGEPVPVGTHVRNPALAAFLEQVAQAGPHAFYSGQNATMIAGAVNAAEGVMTLDDIAGYQAKDRPSLCGKYRAYLVCGMGPPSSGATTVFAILKQLESQDMAAHGPDDPVAWHLIAESMRLAYADRGKWLGDSDFVSVPLPGLMDESYLVRRGQQIHADRTIAEAQPGLPPGYPENGTSHFVAVDGQGGIAS. 423
109 0.000e+00UniRef50_E8LMT0 Putative gamma-glutamyltransferase n=1 Tax=Succinatimonas hippei (strain DSM 22608 / JCM 16073 / KCTC 15190 / YIT 12066) TaxID=762983  ali  32  16MRKLS-LILSACFLAVCVNSAYAENANLVGYESHQQNPLALNGMVTSPHYLATQAGLDILRSGGTAVDAAIAAAATLTVVYPQMCTLGGDNFWLIYNAKDNKVVAINASGRAGEKATIKLYKGKGLDKIP----SRGYLAATVPGVVSGWDKAF-KYAKKKWADLFSTPIDLATNGFPVSSSLA-MWKEFHNLQRFSEFKKVFLPDGSPYTVGEILKQPDLGKSLALIAKNGADEFYRGSIAQKIVKDMKKNGGILTLNDFKNHTADLVEPISVKYRNYTAYNF-PPNTQGFASLEILNILNNFDLKAVGNGTADYYHLIIEATKQAFADRDKYLSDPEFVHIPLDYLLSKERGAYQAELIDMNKAAAKV............................ 399
110 0.000e+00UniRef50_A0A2W6B1J5 Gamma-glutamyltransferase n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6B1J5_9CHLR  ali  30  2.....................ALPIYAGSAASKPTAPTRSSGGMVVTPHWLASQAGLAMLHAGGSAVDAAVAANAVLTVVYPHMTSIGGDCFMLIHDADSGKLYGLNGCGRAPAAATIARLHRLGYGAMP----VSGPLAVTVPGTIDAWSTAHAAFGNLNWAQLLQPAIGYARDGFPVTSRLHLALGQSRGYIGDSYAAAVFYPGGYLPATGATLRNPNLARSLTAIAEGGRDAFYSGTVGQAIAADIQRRGGLLTLHDLEAHQSDWVDPISTTYRGYTIFEM-PPNTQGLMTLMELNIVSGFDMTALGAGSVQALHYQVEAKKLAFADRG-LIGDPAFVSVPVARMLSSDYAAARRAEINPQRANNAVQRGISA---GGDTIFLCVADSKGNRVS. 369
111 0.000e+00UniRef50_A0A0R0LNG7 Gamma-glutamyltranspeptidase n=2 Tax=Ferrovum TaxID=416212 RepID=A0A0R0LNG7_9PROT  ali  35  39..........................................GVVATSHPLATEAGLSILRAGGNAIDAAAAVQFALNVVEPQSSGMGGGAFILVYIAKTHQVYAVDAREVAPQLATPDQFMGH-----RFEENSSSGISVGVPGTVAGFNALLNQWGRMTLGQVLQPAMRLAQQGFAVTPYLAGALKDHRAKLLRESNSPFFNQDGTPLRVGQRLVQVELAHTFEILAKEGATSFYRGEIAHAIVAAQRAGWGRMSLTDLANYHVYIRKALAFDYQGYHLVGMPPPSSGASSLFEALGIVSPYTHDKTWQDRAYRDHLSLQALSMAFQDRENFFGDPEQMTLNPNAVLTPSFLDQRSKALLLGKLPNQLIP--LPKPSGTNTTHFSIVDKEGNVVS. 392
112 0.000e+00UniRef50_A0A1H4FI48 Gamma-glutamyltransferase 2. Threonine peptidase. MEROPS family T03 n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A1H4FI48_9BURK  ali  31  8.............................PYPTARIPLFARN-AVATSHPVAAQAGVQMLLRGGNAVDAAIAAAATLTIVEPVSCGLGGDAFAILWDGHS--MHGLSACGTAPAAWDVAYFQRKYGASRP----QRGWDTVTVPGAISAWAALHERFGKLPFEDLLEPAAELAERGYSVSPVVAHKWAAAIPTLQDPGFAETFMPGGRAPQVGERFVLADAARTLRLIGQTRGRAFYEGELAQRMAAHSAASGGSMTLADLAAYRPEWVTPISKRYRGYDVHEM-PPSGQGIAALIALGILDHFDLSSLKVDSADSQHLQIEAMKLAFADLYRYVADPRSMEVTPEEMLDDAYLAERAKKIDMRRATQF-GFGMPRA---GGTVYLSAADEHGMMVS. 364
113 0.000e+00UniRef50_A0A1V4R064 Gamma-glutamyltransferase n=1 Tax=Candidatus Latescibacteria bacterium 4484_107 TaxID=1956171 RepID=A0A1V4R064_9BACT  ali  33  27...................................QVAIGTKGMVASAKELASEAGAQILASGGNAVDAAVATAFVLSVVEPYASGLGGEGYMVLSLAD-GRDRAIDYRSWAPGHVTI----------KTNPKPRIGPDSTCIPGTVAGLTYALKEYGTMSLAQVLAPAIRLAKEGFPVDKTFVDLLAAYKNMLENPEAREIFLKDGLIPDVGTKMTNPQLAHALELLAAQGPDAFYRGEIAKAIV---KATGGWITSADLQRYQAVDRDPITSKYRGYEIVGT-PPNVAGIVVAEALNILNNFDLSKYGWDDPGAIHLMAEALLLASADRYPYVGDPDFYALPMEGLLSEEYARDRAQLIDPNKVIPPASAGDPYKYMSPSTTQISVVDKDGNAVS. 400
114 0.000e+00UniRef50_A0A2S4D8X4 Gamma-glutamyltransferase n=1 Tax=Candidatus Entotheonella serta TaxID=1652106 RepID=A0A2S4D8X4_9BACT  ali  31  2........................PVPGTTLSSLRPLIQGTNGAVVSSHPSSSMIGLDILQRGGNAIDAGVAVGIALNVVHAHECNFLGVAPTVLYRADRKEVVTIDGSGWWPKAASVEYFQQHHNGEMPA-----GILRSLTPGAADAWITALSRYGTMSFAEVAGPAIALAENGFPAHRFLVSAIQNAPEVYRFPGNQEVFMPGGRAPEVGDLFYQKDLAATLWEIALQAARDFYQGPLAEKIVAYNQELGGLMTMDDLAAYHVRCDPPVHVHYKGYDIYGTGPW-GQGPVFPQALKLLDDFDLTGMGHNSAEYLNTIIQALNLALADREQYIADPEFVDVPLDALLSDAYLHERRQLIDPQRATKMPPPGDPSNQESAGTSYFGVIDKDGNMFS. 406
115 0.000e+00UniRef50_A0A023C620 Gamma-glutamyltransferase n=2 Tax=Pseudomonas extremaustralis TaxID=359110 RepID=A0A023C620_9PSED  ali  34  23...............TTLAEQPAAPELGSGYRADLRPRHAERHMAAAANPLAAEAGREMLRQGGSAIDAAIAMQAVLTLVEPQSSGIGGGAFILLWDGK--QVHAYDGRETAPAGATPRLFLKADGQPMAFTAAQIGGRSVGTPGVLRALEMAHKQTGHLPWATLFAPAIRLSEQGFAISPRLHALIAADRHIPKSPDMAAYFLNDGTPKATGTLLKNPALANVFRRIAKEGADALYQGPIAEEIARKVQRNAGSLSVADLAGYTAKARTPLCNDYKQWTVCGMPPPSSGGIAIAQILGTLQALEIAPMTPPTPEAVHLIAEASRLAFADRGLYVADADFVPVPVAGLVAADYLATRAALIG-ERSLGVAKPGQPAGIQVASTSQVVAVDDRGGAVS. 431
116 0.000e+00UniRef50_A0A2D9XRH8 Gamma-glutamyltransferase n=3 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D9XRH8_9BACT  ali  32  1.MRIHYTILTITILLFTSCNQSSN----------------TQGGVSSTSSLASQIGIDILKQGGNAFDAIVATGFTLAVTSPSNGNLGGGGFLVAYT-EDGEAISLDFREKAPALSYETMFLDEN-QEYSRDLALNSHKSSGVPGTVNGLLKIFNDYGSFTLKEIMAPAIHYAENGHYINATDAKGFDSYKALLTDAGSTKIFFKNGDLWKPGDLLVQKDLADTLKRIAQYGKAGFYEGETAELIIEEMNANDGFITKEDLFNYDSVYRNPVVGTYRGNKVISMGPPSSGGALLIQMLNMIENFEIKSMERNSTEFVHLLTEVQRLAYADRAIHLGDPDFWPNPIPMLTSKEYAKERLALISMNSATRSIAAGKTLSKESIETTHYSVIDNQGNV... 409
117 0.000e+00UniRef50_A0A1Y2HNU6 Gamma-glutamyltranspeptidase n=1 Tax=Catenaria anguillulae PL171 TaxID=765915 RepID=A0A1Y2HNU6_9FUNG  ali  29  75........................PTSGGPGPQYKDPRIFKRAAVSSEVPVCSRIGKQLLEAGGSAVDAAIGTALCVGSINSFASGIGGGGFMLIRTA-SGPSEVVDFRETAPANISETLFKDDPLK------SQRGGLAVGVPGELRGYELAHRKHGKLPWARIIEPIVALNANGFRVSATLAGKLKTHESWIASPVWRSVFAPEGTLVTEGATVKRTAFAKTLQTVADNGAQAFYTGPIAEALVDAIRADGGVLSLLDLKEYKPIVRKPVETWYKGRKIISAGAPASGHV-LLYMLNILERFSFKEGP--TAVTYHRMIEAMRYGFARRSE-LGDPEFLNIDLNQILSKDEAAAARRNIS-DATSYPPEHYQPTNAPSHGTTHLSVVDESGMAV.. 439
118 0.000e+00UniRef50_A0A1N7SBM2 Gamma-glutamyltranspeptidase n=50 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1N7SBM2_9BURK  ali  28  1........MASTLCAAFAGSVVASAPALAKTPPPKPVLDAS--AVAAPDRYGADTAQQIFAAGGNAVDAAVAIAFTLAVTRPEAGNIGGGGFMTLFM--DGKPYFLDYRERAPQQATRDMYVDDKGNPVPG-MSAVGHRAVGVPGTVEGMWEAQQRFGKLKWKQVLAPAIRYATDGFPVEPWLQQRRDAAAKNFAGKTNFDAYFSN---LKAGATLRQPELAQTLSRIASDGGREFYEGRTADLIAQQMYGH-GFVTKQDLLQYKAVWRQPLAADWNGYRVIAAPPPSSGGIGLIQMLKM--KADLKGLELNSAPYIHLIAQIEDRVFADRQQYIGDPDSDTVPTDRLIADAYLAQRADEVKPDEV-PGASPVTPGLGDSHQTTHFSVVDKWGNAVS. 385
119 0.000e+00UniRef50_A0A1E7DRD0 Gamma-glutamyltransferase n=3 Tax=Domibacillus TaxID=1433999 RepID=A0A1E7DRD0_9BACI  ali  42  19.....................................AHGKKGMTASATEESSAIGADILSKGGNAMDALVAMQFALAVAEPFNTGLAASGFIMYYDAKKKKTFVVNGHSISPKKAHKNVFVDERQDVIPFLERSTPGTAVAVPGILKGMEKALTEFGTMPWADVMEPAVQLSEKGVRVNLTWNTGLERFSDRLGK-EAKKFFFPEGVPLTEGEIVVNKELTKTLKLLQEKGADVFYRGEIADKIIEIVQSFDGFMKKEDLLSYEATVSEAISGTYKDYTVAVPAPPNGGGFSLLYMLKLLEKLDIAQYDIHSWEKYYLFAEVMRIMTADKLAFMGDPAFYDIPLNGLLTEQYLDDRVKLINFEFRNEDITEGNPWEYDDPDTTHFIAVDEEGNI... 389
120 0.000e+00UniRef50_A0A2S7ADZ1 Gamma-glutamyltransferase n=7 Tax=Xanthomonas TaxID=338 RepID=A0A2S7ADZ1_9XANT  ali  31  14.RRAPWIALLLLVLPSAFADVPNTVPDARGYQPIHHPLHARGGVVVSQSRPASEVGARILREGGNAIDAAIAVGLAEAVTLPRAGNLGGGGALVIYVAKDRRTTAFDYYGSAPAATTAKLLLGRDGK--PERGASISWKGVAVPGTVAAFYAAHQKYGRLPWASLVQPAIELAEQGVRLSDDEAMILDWAKPTLRTPETRAQFFPDGSSYVAGELLRQPDLAWSLREIARDGADAFYRGEIAKRIVAASRKYGGILSAKDLTNYRVRELEPVRSTYRGVELALAPSPSS-GTTLAQLLNLIEPFPLQPADAGSAKAYHLIAEATRLAGADRSAFYGGPPQHNTPNERLLDKKYAYQRAALISPERTLPAIKAGELLQ-QSPDTTHYSVVDAEGNAVS. 415
121 0.000e+00UniRef50_K7FP85 Uncharacterized protein n=10 Tax=Chordata TaxID=7711 RepID=K7FP85_PELSI  ali  28  32...................................PTILYKNAAVATDAEQCSVIGRDILQQGGSAVDAAIAALLCVGLMNPHSMGIGGGLVFTIYSGKRGQAEVINAREVAPMKASVGMFGNN------TELSVLGGLSIAVPGEIRGYDMAHKRHGRLPWKSLFLPNIKLAREGFQVGKALADALKGKQKNISNPSLCEVFCKGGKILQKGNVIKMPKLADTYETLANEGADAFYTGTLAQQIVKDITEAGGIVSLEDLKNYTPILTEPLNITLGEFTMYTASAPLSGPVLAL-ILNILKGYNFSSDSVSTLETYHRIVEAFRFAYAKRT-LLGDPLFVDVVLKNMTSEFFADSLRRRITDN-TTHPVDYYEPYNPDNAGTSHLSVVADDGSAVS. 399
122 0.000e+00UniRef50_A0A2S6HN23 Gamma-glutamyltransferase 1 n=3 Tax=Bacteria TaxID=2 RepID=A0A2S6HN23_9BACE  ali  32  17..............................FASGDSGAIRNGGVVSSASEYSSQIGIDILKKGGNAVDAAVATIFTIGVVEPNLSSIGGSGIMTIYTKENDQCIVIEYMETVPSNMKAGWFNPQTDKNTAKNAAL--------PGQVYGILTALDKYGTMSREEVMAPAIQLARNGFIADKRLADSIKSNYDILQNPDFADIYLNNGKPIKEGDIIKNKLLADTLEKLAEQGIEGFYKGELAGEIVTGLQNGNNLITLDDMSKYRAIERVPIQTSYHGYNIIVPSMPSNGGEWLLESLNILENYDLKSMGVNSSEYLFTLNEALRLGMADAFTYLGDPAFFNIPTDTIVSKDYAKKRLASMPVNKAMINPPHGDLGGEDSKETSHISVMDKYGNLVS. 383
123 0.000e+00UniRef50_A0A2E6YD36 Gamma-glutamyltransferase n=8 Tax=Bacteria TaxID=2 RepID=A0A2E6YD36_9GAMM  ali  31  7.TRCCFTVVLFAFLFITTKSVNATQPVQP--------------AIASPHPLATQAGYRILEQGGNAFDAAVAVSATLSVVEPYSSGLGGGGFFLLHREQDKYQTFIDAREKAPNAATAEMYQDSNGMVIP-KATLVGPLASGIPGLPAGLVHLSKKYGTLPLEKSLAPAIELADKGFPVFERLMTALNVAQESRGSFSFLEVFTSNDDLLEVGQLIKQPELANTLRLIASQGYKGFYDSEFTKTMVEEANRDGSIWHIDDFKNYSVIERKPIKLNFMEYELTLAPPPSSGGTTIATILNIVSSYDYKNMPKDT--FVHLLIEAMRRAYKDRSEYLGDPDFVDVPVDMLISKNHASNHLASINLDKATPSMSNSEPYIAKGTETSHFSILDKEGNRV.. 390
124 0.000e+00UniRef50_UPI0001CBA0C6 gamma-glutamyltranspeptidase 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0001CBA0C6  ali  28  83.........................................HGAVSSGARQCTELGVETLKNGGHAVDAAITTILCLGLVNAQSSGIAGGGFMLVKEGESD-VAVLDFREVAPLDAH--MYRKK--IEQDADLAFTGALAVAVPSEIRGLELAWRRYGRLEWFDLFEPVIRLARNGFEVTGSTAKAVVKELDRMMYSELRNIYMPNGTRVKEGDTLKRPDLAAVLETIATEGADAMFNGRLSKEMIDTVLEAGGNLTAQDFLNYQPIWRTPLKTTYHAATVYTLGAPSGGPV-VLSILGILEGYDLTSGAMKDPLTYHRLIEAFKFAFAQKTR-LGDPDFVPNLTQIMTSKESAAELRAMINDSSTYPSEYYGPYLPKPGYGTSHACVIDNEGNMVS. 436
125 0.000e+00UniRef50_A0A2G8TH54 Gamma-glutamyltransferase n=1 Tax=Massilia eurypsychrophila TaxID=1485217 RepID=A0A2G8TH54_9BURK  ali  35  1MIFQPCSPTACFFTLAIVLAAPPS-------RAGPPVAIGTGGAVATVSEQASKAAMAILNKGGNAVDAAVAAAATLGVTDPFSCGIGGGGFMMIYLADGKRVITIDHRESAPAAFTPAVFL-QNGKEIDFDLAVASGAAVGVPGTVRGWHDALERYGTMSFRQVLAPAIDVADKGFRVSENFNHLVAMNVDKFTFPAISALYLKDGKALPAGTTLRNPGMAKAYRELAARGYKAFYDGPMARAMVDAVTRRGGRMTMADLANYESRIRQPLHTTYRGFDIYGMPPPSSGGSTVAAALNILEGYELKAMARADVE--HLYLEASRLSFADRNAYLGDPEYLDVPLAGLLSKEYAASRRTQISRQAMAAAAAPGDPYLFESAHTTHLTVSDRAGNVVS. 416
126 0.000e+00UniRef50_A0A1H9TXZ0 Gamma-glutamyltranspeptidase / glutathione hydrolase n=7 Tax=Bacillales TaxID=1385 RepID=A0A1H9TXZ0_9BACI  ali  43  10.........................QKTATEGSNEHTVSGNYGMVSSPIHEVSEIGEEVLKDGGNAIDAIIAMQFALGPAEGMNTGIGAGGFIMYYDSEKNETKVVNGHTQAPEAVKPDIFY-ENGELMSFDDRTMSPRSVGVPGSTKMLELAHERYGSMPLERLVDPAIKLAEEEFRVNSLWERTIDLFEHRLGD-EAKKIYMPNGTKLKEGDTIRQTDYARALKAIRKEGFKSVYEGEIANAIIETLQEEGGIMTKKDLESYEAAIDNPLWGSYKEFDFAFPSPPNGGGFAVSQLLKILEPLEISQYDIKSWKKYHLLAESMRLAIADQQTYMGDPNSVDIPMEGLFNDEYLEERRKLLNFDFRREEIKGGNPYKYQKGETTHFTAVDRWGNI... 392
127 0.000e+00UniRef50_UPI0002652B6A gamma-glutamyltranspeptidase 1 n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0002652B6A  ali  29  67......................................TYREAAVASDAPICSELGRNVLLNKGSAIDAAITALLCVGMYNMQSTGIGGGNFILYYDREQEKPYFIDARERAPAAAHRDMFENK-----SDDASIFGPLAIGVPGEIMGYWEAHQSFGKRPWKELLQPVIDLAVNGFEIGEPLHEAIHQYQNILNDTSLSEILTDGGNILRQGDTVYRPKLAKTLRMIADRGAEALYTGEIAQDIASEIQDRGGLITVEDLASYQVKRREPLTVDINDLRAFTGPPPCSGPVYAL-IMNILEGYGFNSSGEGEVLTYHRIIEAFKFGYGKRSA-LGDSSFVNLTVANMTAQSYADALRARIDDDRT-HNYTYYEPEFVEDSGTSHISIVDQYGNA... 425
128 0.000e+00UniRef50_A0A1A6AI43 Putative gamma-glutamyltransferase YwrD n=517 Tax=root TaxID=1 RepID=A0A1A6AI43_9CLOT  ali  30  9.............................PFSSARSTAYGKRGMVATSQPFAAEAGFEILKKGGNAVDAAIATAACLTVCEPTSNGIGGDAFATVWF--NGKLHGLNSSGPSPKGISIPILKKAGYNQIP----QFGWEPVNVPGIPAAWASLSEKFGKLPFEKLLEPAIRYAEEGFPVTPTVGKFWRRAYELYKFKYWFDTFAPEGRAPRIGEMFTLKDHAKTLKIIAETKSEAFYRGELAEKIDDFSRKTGGYIRKEDLEKYHAEWVKPISINYRGYDVCEI-PPNGQGITALIALNILKGFEFNE--KNSVDTYHKQMEAVKLAFEDTLRYVTDRNKMTIKIEDLLSDAYADEKRKRIKETAFMPE-----FSKNPKGGTVYLATADGYGNMVS. 369
129 0.000e+00UniRef50_K6YHE8 Gamma-glutamyltranspeptidase n=31 Tax=Proteobacteria TaxID=1224 RepID=K6YHE8_9ALTE  ali  33  1MKFHILAIGVLSASLLGCSSAENQTELKAELPK-------QQAMVVTANPHATAAGLEVLRAGGSAVDAAIAIEAVLSLVEPQSSGLAGGAFMVHYDNETKSLAVYDGRESAPSGATPDMFMLENGDSMPFIQAKTSGLSTGVPGVLAMLSMAHKEQGTLEWASLFSYARKLANDGFEISPRLHGMLARFGKYIPSTDAHQYFFDDGQPYPAGYTLKNPDYAKTLDIIAKD-PAEFYHGDIAKKIAAMVQQQPGSLTAEDIAAYQPVKRTALCQPYRDTQVCGAPPPSSW-VAVGMIMGILENGPPSAAGPDDPKNWALLAQAQQLAYADRDQFIADPNFVDMPLTGMLNKDYLAKRATLISDKATPLTYAVGDPWAYNDHGTTHFVIVDTKGDVVS. 413
130 0.000e+00UniRef50_A0A1R4FTI4 Gamma-glutamyltranspeptidase n=20 Tax=Bacteria TaxID=2 RepID=A0A1R4FTI4_BREDI  ali  32  6MKSATAVSAAALMLLAGPVLAQEAAAQVRPYGQIHSPVVGRGGMVVSQSDLATRVGVEILRQGGNAVDSAVAVAFAEAVTLPRAGNIGGSGYMVLHMAATAETIAINYYGTAPAATTPDLLLDDSGRFDRSKPS--GFINVSVPGTVMGMWEAHARFGSMPWADLVAPAVKLAEEGYVLSDGEADATAGRAQVLADPGAREAYLKDGTPYRAGEIFRQPLLAESLRKVARGGADEFYKGELARQIVAGVQAGGGVITMADMAAYRADVSEPIWGSYRDHRIAYMPPTAS-GVSVAQALNLLEHFDLRSMGWGSVDSLHLISEAMKITSSDR-RLIGGAPQWTTPAHGLASKEFAAERVRLISPDKTLADIPEGNPYPYESKDTTHYSVADAFGNAVS. 416
131 0.000e+00UniRef50_A0A1W9SGE2 Gamma-glutamyltransferase n=2 Tax=unclassified candidate division KSB1 TaxID=1046950 RepID=A0A1W9SGE2_9BACT  ali  32  1MKRKLILTFLPVMLTVFFINIFYSAAIFAETND----VIAEKAMVATAHPIASAVGIEILKEGGNAVDAAMAVAFALSIAEPNASGIGGGGFIVIKMANKKEAVMIDYRERAPERAVAEYYYDS--ESGFKSLTTVGPSAIGVPGLVAGAEISLKKYGTMTLAQILQPAIELCKNGIVVSEKLNEMILNNIEKINYPATAEVYLKDMFPLEEGDTLRNLDLASSLVKLSGQGGDIFYKGELAKLMANEIQQLGGVLSYSDLKTYEAKVRKPVRGKYRGYDIITSAPPSWGGTHLIELLNIMEGYNVKKMEHNSAKYIHVFTEAMKMIYADKAINAADPDFYKVPVKTFLKKRYAKKLRKRIEPNKARFDYKSKKRSSRESTSTSHLSIVDEHGNIV.. 391
132 0.000e+00UniRef50_UPI00077AA39F gamma-glutamyltranspeptidase 1-like isoform X1 n=2 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077AA39F  ali  30  82.........................................HAAVVSDVKECADVGLDLLRKGGSAVDAAIGTMLCVGVMNPESTGIGGGGFMLVVPQNDGEAKVIDFREVAPLAASKDMFHGND------SLASWGGLAVGVPGEIRGYELAHKKYGKLKWSELFAPAIKIAREGFSVTEHTERSLKNLKENVIGTELGKVVAPKGKLLKEGDKMSNPALANTLQKIADHGADAFYMGPIADSLVKAVRSAGGILTKKDLKIYNALEKEAINSTYKGYRVITTPLPSGGPV-LISMLNILDGFKFSKEDQDKSLTYHYVIEAMKFAFGQRS-LLEDSNNLTDIIQEMLSKKHANLLRAKISPNQTFPLSHYLMVDQAASHGTAHVSAIGPDG..... 428
133 0.000e+00UniRef50_E2CH20 Gamma-glutamyltransferase n=1 Tax=Roseibium sp. TrichSKD4 TaxID=744980 RepID=E2CH20_9RHOB  ali  40  4..RRAFSIRSLCLAGVISLALPLTSNAQTAIISGKHPVVAENGMVASQEAVATEVGVEILQKGGNAVDAAIATGFALAVTLPRAGNLGGGGFMMIHRSETGETDALDYREKAPAGAFRDMFLGDDGEP-DKAKSRFSGLAVGVPGTVAGFEAAFEKHGSLTWAELVDPAIKLAEDGIVVTQDLASLIARLERLSKDEATAKIFFKPGVPYQPGEILKQPDLANTLRKIAENGAAGFYAGEVAEKIAAKVQVTGGSMTVEDLASYDAVWRAPVFGDYRGHQIASMPPPSSGGAHIVQILNILEGYPIGEFGLNSADTTHYSV............................................................................. 328
134 0.000e+00UniRef50_F0WS57 Gammaglutamyltranspeptidase putative n=4 Tax=Stramenopiles TaxID=33634 RepID=F0WS57_9STRA  ali  34  1...........................................MVATSQPLSSEIGLSILKRGGNAVDAAIAIASALGVLEPCSTGIGGDCFLLYYDAIRRKVSGLNGSGRSASNITLKSVLKRKDGQIPFRIPIEHGHSVTLPGTIAGWIDAVERWGTLPLEELLSPSITLASEGFPVGPVTSKLWMACESTLARVNGSDLLCDDRKAPAPGSICYNRHLAQVLKEISTKGKEGFYKGWVAEAITNSVREAGGALTMEDLVSHRSDFVDPIKTTFEDLDIYEI-PPSGQGITALLALNIMQQFRHKEVDHNSAEYLHVLTEALRLAFTDAQWYACDPDASSIPLKHLLSAEYATERASRIDINRAIIDPKRGSPELF--CDTVSFQVVDLWGNAVS. 366
135 0.000e+00UniRef50_A0A1X7VBU0 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VBU0_AMPQE  ali  30  92................................PYRPPAPSSTGAVAADSATCSEMGGEILKAGGSAVDAAIVALLCVGVVHPESSGIGGGGFMTIYDPSSQSVKAINFREKAPAASTVDMYHGNG------NLSELGGLAVGVPGEIAGMKLAHDLYGKLPWSDLFYPVIDLARNGYPLNEHSFKSVKRVQDRTRFDEW--YYHENGTMKGINETVKRPYYADVLQKIASEGPSGFYKGDIATEIVNAVQRTGGIMTTDDMASYEALLEEPVFIRYNDFDVYSTPLP-SGGPQMLFILNVMEDIGLSQESEWRNLTYQHLVESFKYSFAFRSKF-GDPNCSDCEAEKLLSEKFAAEINRSISNNSTFPPSHYNASLFVNDSGTTHVSVIDSNGMAV.. 457
136 0.000e+00UniRef50_A0A2D5K2F8 Gamma-glutamyltranspeptidase (Fragment) n=1 Tax=Woeseiaceae bacterium TaxID=2026806 RepID=A0A2D5K2F8_9GAMM  ali  38  39........................................SYAAIATPDNFGTDVAQXILXKGGNAVDAAVATGLALAVTYIDAGNIGGGGFMTIKM--DDEIAFIDYREKAPKAAHKDMYLDQDGNVIEYST-LIGGQAAGVPGTVSGFWKAHQRFGKLPWKDLVEPAIKLAEEGFFPAKILVDDIQGMHDWFKNTNFEQYFLHIDTKKK----FKQPELAETLRRIAEFGAEDFYFGKTAELIVEQMKKSNGLITMEDLNAYEAVWRKPLRARWRDYEIISSPPPSSGGFAIIQLLKMLQHY-FENLDHNSAQYIHLVAEMEKRVFADRAEYLGDPDFFDIDMETLISEDYIAMRALEVNPD.................................. 358
137 0.000e+00UniRef50_A0A2E9ZAH7 Gamma-glutamyltransferase n=1 Tax=Coxiellaceae bacterium TaxID=2026727 RepID=A0A2E9ZAH7_9COXI  ali  29  1MEECMLRQIILCLCLGLMSS-SPALELLHDTPARSHVTHGLHGVVSAQEQRASQVGIQILQVGGNAVDAAVASAFALMVTLPRAGSLGGGGFMLALQADQYQPRFIDFREIAPGRASPAMMLNSQGE-IDSDLIRRSWLSVGVPGNVAGLCYLENHFGKLSLARVMRPAITMAQEGFVVKPYLANTLHHYRPMLQNKATQKMLSHDGREYQFGDIMRRPDLARSLQLIAEQGSDVFYKGQLAEALVASSDQGGGILCLEDLAHYQVIERRPIQGVVGHALIYAAPPPSSGGIALIQTLKILQLLNIGANGQNTALSFHTMAEVFNRVFLDRNRYIADPNFVNIPTGELLSPAYLHKLAKNLNAHQHVQSLTEKKPGFTEGKNTTHLSVVDHNGSMV.. 401
138 0.000e+00UniRef50_UPI000B911C10 gamma-glutamyltranspeptidase 1-like isoform X1 n=7 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B911C10  ali  30  140..................................................ECSEIGRDMLEKGGTAVDAAIAAFLCVGLYNYHSAGIGGGFFLLFYNAKTKTIEMLDAREKAPLAAFEKMYENET-----EDASTSGGLSIAVPGEIAGYWTAHQRYGVLPWSDLFQPSIKLAEEGILVSRELARVIKRESYMKNDPSLGEIFLNEGEILKEGDTLVDIKLAETYKKLAEGGENAFYKGDLADDIVADIADRGGIITKADLESYQVRRREPLMIELDGMKVYSPPPPGSGAVYAL-IMNILQGYGIGPDSIATTETTHRMVEAFKFGYAGRS-FLGDEDYVDVKVANMTSQSYADSLRAAIDDNMSHDPSYYTAYYNQPDGGTSHLSVVDTYGNAV.. 486
139 0.000e+00UniRef50_A0A2E6HME0 Gamma-glutamyltransferase n=5 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E6HME0_9GAMM  ali  31  1MKKNKQNYFFYIFLYILPAPIFANTTVQP--------------AVATAHHIATRTGLEILEKGGNAFDAAAAITASLAVVEPYGSGLGGGGFWLLHRSEDNKQVVIDGRETAPMRSHKDMYLDRNGNIIDG-LSLNGPMASGIPGIIAGIDHLVTHYGNLSLKEVLKPAIKQAKNGFVVTKRYRKLIRYREKIMRYVNTSSIFFPNNNIPKLGDLIVQRDLSKTLSMVAEKGRKGFYQGIFAQKMVDSVQKNGGIWETYDLANYKIIEREPISVKYKGITVTSVPPPSSGGIVLGQALNILEKFDLSQY--DSVTRKHIIIEAMRRAYRDRAAYLGDSDFVYIPIERLLDKNYAEGLALTIDINHATPSNELGSIVAANGENTTHFSVVDKKGNKVS. 383
140 0.000e+00UniRef50_A0A2T2W5F0 Gamma-glutamyltransferase n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2T2W5F0_9CYAN  ali  31  13..........................................AMVVCPHYLASTAGLNILSQGGSAVDAAIAVQAALAVVYPHMTGLGGDGFWLGYDAQAQQLYGLNGSGRAGAGCDRALFARLGLDTIPQRGPQA---AITVPGGVSAWGVAHQRFGRLSWADLLQPAIALAEGGYPVSPSQAHWTRNQADLIAYGGASTPFLPGGRAPHAGTQVVNLPLGKTLRRLATGGPQAFYQGDIAAELVAYLRNLGGLLSVDDFARHTTTWVEPIATTYRGYQVCQL-PPNTQGFTVLQMLNVLEGFNLHTVGHGTADYYHLLVEATKLAFADRDRWLSDPDFSDIPLTELLSKAYGDRRRARLSMAVAQNYS-----ASEVGGGTTYTAVVDGAGNAVS. 359
141 0.000e+00UniRef50_B7RZH2 Gamma-glutamyltransferase n=38 Tax=Bacteria TaxID=2 RepID=B7RZH2_9GAMM  ali  30  11...........................PIGENWSRSPVYGSNGMAATAQPLASQVALDILKEGGSAVDAAIAANAALGLMEPTGNGIGGDIFVIVWDPQSKQLYGYNGSGRSPKGARVEGMKARGELPADFDIPSHGPLPVSVPGTVDGWFAIHDRFGKLPMNQVLAPTIDYARNGFAVSPVIAYYLDRSWAFFERENIRDTWFREGRAPAVGEIFVNEDLADTLETIALDGRDAFYKGSLAKRMAAYFESMDGGLSYQDFSEHRGDWVSPGRVNYRGYDLYEL-PPNGQGFAALQMLSILKNVDLTQWSRGAAEVFHYMVEAKRLAFEDVARYYADPEFSQVPLTGLLSDEYGRERFALIDPVKASAAFGPGEPKLEAEGDTTYLTVADKNGMMVS. 395
142 0.000e+00UniRef50_A0A2E6Z3D5 Gamma-glutamyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A2E6Z3D5_9CHLR  ali  33  4...............................SSTRSNVIAKNGAVATSQPLAAQAGLEILKKGGNAVDAAVATAAVLNVVEPMSTGIGGDIFALVRNSKNKIIKSMNGSGRSGSYANSNFLKQKGYDFIPKSG-IEGIYSVSVPGTVHGWETLLNDEGNMNLKDVLEPAIKYAFEGFGVSEKIANSWKDSMNKISVNGFNE-FLPLGKAPKAGSLLKLHELGETLTKISEKGSKEFYQGDTANKIIKFVESLGGWITKEDLLNHTTDWVEPIHTKYRDVSIWEC-PPNGQGIAALIALNIIENFNISEFGFQTAKTFHHSIESMRLAFADSLQYVTDSETNYVPVNELISKGYAKSRSKLINPNQRFNDVSFGNPLNY--SDTVYISVIDGEGNACS. 364
143 0.000e+00UniRef50_A0A2E8KZF3 Gamma-glutamyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2E8KZF3_9BACT  ali  29  5.RVHYSLFFSLLLINSCAKVGFSFFAFEGIVGRNIEEAVGKNGVVSSVHPLASEVGINILKAGGNAVDAAIATGLALGVVDQANCGLGGGAFIVIRL-TDGTVHTLDGREMAPSRAHRDMYIKNG--KVDSKLSRRGPLAVGVPGVPAAYLKALELAGTMSLKEVIKPATAIARDGFILDEYIERYKGAVKNLKKDPGSAEVYFNDGSKLGVEQIFKQPLLADTYDKFGENGLDYFYKGDFAEQVGQFMQKNGGFITKEDMANYRVVERNPIHGTYKDYEVFGMGPPSSGGIHVVQILNMIEASGLDEKSEWDEESIFLVAKFMDKAFKDRAEHLGDADFHPVPIDRLISKDYAQ---ALVNEVKAVTSIEPRDSLAYGEGHTTNFAVIDKWGNAV.. 399
144 0.000e+00UniRef50_A0A1L3LWJ3 Gamma-glutamyltranspeptidase n=1 Tax=Sinorhizobium americanum TaxID=194963 RepID=A0A1L3LWJ3_9RHIZ  ali  28  5..............................QFPGRSVVMGRHGAAATSHALSTLAAIEILRRGGNAADAAIAACAVQCVVEPGSTGIGGDNFVLFAPASTGKVYGLNGSGRAPRGLTAERLLRQGVKEI----ALTSVHAVTVPGAIDSWAKLNQRFGSMPLGELLQPAIRHAEEGFAVTERVATDWARNEGKLKDANSARMWLKGGHAPTAGEVFRQPEHAKVLREIAAKGCDGFYTGWVAEDMVAYLRSLGGTHSLEDFASQEAFWVEPISTSYRGIDILEI-PPNGVGITTLLMLNILSGIDLGKYDPVGVERFHIEAEVTRLAFEVRDTYVADPAFADVPVQKLLSADFADELRGRIDLKRAMPARGPLGTTTYR--DTVYISVVDGKGNACS. 375
145 0.000e+00UniRef50_A0A2S6U2M1 Gamma-glutamyltranspeptidase (Fragment) n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6U2M1_9PROT  ali  29  2........................................KRGMITAPQPEAVEAGAIVLRRGGNAVDAAIVCALVQGVVDPQMCGLAGFGTMHLYLPKKNFHGFIDFHTRAPAAVREDMWRDGFGFFLKGRVNEVGYQSIMVPGSLKAYHEATEEHGTMDWKDICQPAIDQADAGFIVRPHVHQFWTRSADKIKFTAARRIYCANGEIAALGSLVRNPDMAETLRRIARGGADVFYSGDLAEEIAGDIQAHGGLLSLDDLKAYRTGRADPLWSSYRGYRVATNQPP-GGGVMVLEMLNILENFDLAAMGHNSPDYIGTVAEAMKYATIDKDTRVGDPRFVDVPLDELLAKPYAAGLAAAIERGEVAHVERIDKIE--ESRDTTHLCAIDADGNAVS. 373
146 0.000e+00UniRef50_A0A1I2E3M7 Gamma-glutamyltranspeptidase / glutathione hydrolase n=3 Tax=Nannocystis exedens TaxID=54 RepID=A0A1I2E3M7_9DELT  ali  42  1MRARPEMPLLMLTMLGALALASTDAAAAEFATAIGPIVGGEDGMVVSSNNEAARVGAEILASGGNAVDAAVAIQFALGVAEPGFSGIGGGGFMMIYDASADAVTVIDSRERAPASAKPKMFLKKNGEPIPFAKRRTLGVAVGVPGALAGAEYARAEFGTRTLADLIAPSIALAEDGVIVSRLMAASLREHQGVLANPAASALFLPGGQPLAIGDLLVQPELADTLRLIAEDGIDAFYDGPIGEAFVAEVKAAGGGMKMSDLAQYKLTIDEPVRGQYGDYEIVTTAPPSGGGLTVLQFLEILERLDPGQYAYDSSLRYHLVMKAMHLAFADRNAYLGDPEFVDIPP-GWLAPKYIKQRAALIDFDDNTCPVPPGPLAANPDPQTTHVNVADRWGNLV.. 407
147 0.000e+00UniRef50_A0A0H5CMU2 Gamma-glutamyltranspeptidase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A0H5CMU2_9PSEU  ali  34  5....................AAPTTASATPGLAKEPLATGYGGAVVSDTVEATKAGIDVLRRGGTATDAAVAVAATLGVTDPFMAGLGGGGFFVHYDARTGRVSTIDGRETTPAAGDAQMFIDATGSPYPFFKAVTSGLSVGTPGMLATWERALQRWGTISLKEALKPAIKVADKGFPLTPELRAEIVANQDRLKFTSSAELFLPGGAAPEVGALMRNRDLANTYREIAKHGTRSFYGGSIGRDIAAATQSPPGRMTVQDLRDYRTIDRAPTHVGYRGYDVYGMAPSSSGGITVGEALNILETFEVNGMTQ--TQALHHYLEASKLAFADRNRYIGDPAFVNVPQDRLLSDAYAAQRACLIDPTKVLPAPTAGTASAENEVHTNHFVVSDRRGNVVS. 401
148 0.000e+00UniRef50_I7BK21 Gamma-glutamyltransferase n=9 Tax=Natrialbaceae TaxID=1644061 RepID=I7BK21_NATSJ  ali  43  57.....................ARGVRCAHPQVTCGRQVTAADGMVSSVDPIASGVAAGVLREGGTAVDAAVALQYVLTVTQPHGSGIGGGGFMVIYDADADEVDVIDSRERAPRGATADMFLDEDGDPIPFADRIRLGEAVGVPGTVMGLETALDRHGTRPRQRLLTPAIDLAADGFPIDAVFATQIAENWEKFNDAAKAAYSDANGRPLTEGDTHVNTDLAETLAAIERDGAEAFYEGPIAADLAATVRDAGGSMTTDDLAAYDVTIDDPVRAEWNGVEIVGQPLPSSGPSTVAAILKLLAFLDIGQYDRRSPAMYHLISEATSLAWADRNEYMGAPEFVDVPIDGLLSDAYLEERAALVRTGESLADYEAGEPTRGPSPDTTHFSVVDADGNAVS. 448
149 0.000e+00UniRef50_A0A0L0D252 Gamma-glutamyltransferase n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D252_THETB  ali  30  45.....................................AESKLGMVAADQPTCSQMGAAVLDDGGSAADAAVTTALCLGAINAFASGIGGGGFATVRTA-NGSAEVFDFRETAPAKAFRDMFDS------SAEKAQVGGLAVAVPGELRGLELMWQRHGRLPWARLIEPVVALCNDGFEVTDELAKIVEYTQEYIKSPAFAAVYMIDGQLVKAGQTIRRPKLAATLEAVAAGGANAFYTGAIAHALIDAIQGSGGIMELGDLANYTAVIREPVSTYFLGMKVLSAPPPSSGAI-LNFMLNVLEEYNLPKIGAMTHDVVHKVVEAMKFAFALRT-HLGDPCCTDIVMADLTSKDYAAWVRTRIVPDATFNASYYGAAFDMEPPGTTHFSVVDSERNAV.. 398
150 0.000e+00UniRef50_A0A0A8WYA7 Gamma-glutamyltranspeptidase n=110 Tax=Bacteria TaxID=2 RepID=A0A0A8WYA7_9BACI  ali  26  7.............................PYSSQRMATVARNGMVATSQPLAAQAGLDILKKGGNAIDAAIATAACLTVVEPTSNGIGGDAFALVWVKD--KLYGLNASGPAPQSISIEKVKELGHEKMP----SHGWIPVTVPGAPSAWAELSKKFGRLPLTEVLQPAIDYARNGYPLTPILAKYWKGAFKAYKYEEWFRVFAPDGKVPEAGEMWKSEDHANTLQEIAETNGESFYRGALAEKIAEASEKAGAFLSKADLENYHPEWVEPISVSYRGHEVWEI-PPNGQGIVALMTLNILKGYEFT--HRDDVNGVHLQLEAMKQAFTDGKEYVTDPKTMQAKVADLLSEQYGEEARAKINREARMPE-----PGQLPKGGTVYLSTADGEGNMVS. 367
151 0.000e+00UniRef50_A0A0F4YDN3 Gamma-glutamyltransferase n=100 Tax=Eukaryota TaxID=2759 RepID=A0A0F4YDN3_TALEM  ali  29  41...ILWVAYCLYTLYRHLCTIFSHKHHDRQLQTNGAYAHGKLGAVASESAICSRHGIEMLKMGGNAADALVATVFCVGVVGMYHSGIGGGGFMLVRSP-NGSFEFVDFRETAPAAAFEDMYENN------TAGSVYGGLASAVPGEVRGLEYLHKHYGVLPWATVLQPAIHTARNGFPVTEDLVRYMEAAEDFLKDPTWALDFAPNGTRLGLGDTITRKRYADTLETIANQGADAFYSGPIAETMVRAVQSDNGTMTLEDLKNYTVAIRDVAEIDYRGYKITSTTAPSS-GIVGLNILKTVEGYHPFFSPETVNLSTHRLDEAMRFAYGKRTS-LGDPFFVDEYQRDMLNDSTIRDIRRRISDFRT-QNVSAYDPDGLESPGTSHIVASDHSGLAIS. 435
152 0.000e+00UniRef50_A0A257BEK0 Gamma-glutamyltransferase n=1 Tax=Armatimonadetes bacterium JP3_11 TaxID=2012635 RepID=A0A257BEK0_9BACT  ali  30  3.................................SRSAVFAQNGVVASSQPLAVSAGLHILRSGGSFVDAAIATSAVLCVVEPWASHLGGDAFAVLYDASKRQTLALNGSGAAPQVATPNRFAN--------GIPLRGITAATVPGLVDAWFRLHALYGKLPIPRLLEPAIEYAEQGYPISERKANLWRNAS---RSNELRPVLLGQERAPRAGEVVRCTNTARTLKAIATGGRDAFYKGEIARRIVAFCREQGGWFEPDDLARHESEILQPLRVRYRNYTVHG-QPPVSQGMILLEALALLDGFDLK--GIDTAQRTHLMVEAIKCAFADRWAYLGDPRFVKSHAESLLEPDYIRERRAA---LAADKAQAVYAPGAMRDTNTTYFCIADKDGNAIS. 352
153 0.000e+00UniRef50_UPI000AD399B2 gamma-glutamyltransferase family protein n=2 Tax=unclassified Bacteria TaxID=2323 RepID=UPI000AD399B2  ali  31  19...............SASYAIVPRMPEAHTGFSIHDVAHSKKAMVVTANPVATNVARTILIKGGSAVDAAIAAELVLNLVEPQASGIGGGGFMTIYDPKSRKVISIDGREVTPANFNINRWRDDSANWHEFEHLILSADGVGVPGELSMLYSAHKKFGRLPWAKLFEPAINMARMGYPVAHRLAVQLQKEDMLWHDPSASALYRPKGHVVSEGMVLRNPALAEVFEDLAKNGINNFYKGRWAKDIVAAVNNRAGIISMKDLSSYRAKEYASLCGRYRAWKICSTRLPSSGAPMILEWLGLLENSPFLKFPPHSVSAWHWFIETGRAAYIDRYAYAGDTNFDKDFTDVLLSKEYQISRLHQLSPDKASVDLKPGNISGVERPSTSQISVVDSYGQVVS. 410
154 0.000e+00UniRef50_A0A2E9QRZ3 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QRZ3_9DELT  ali  33  99.......................QAPPQKSLFARRSP----KQMVATAHPLATKSALRVLRMGGNAMDAAISAAFVLAVVEPYSSGLGGGGFLVAYDAKHDAVDTLDFRERAPFAAKRNLFSR--YGKRGKTLSEIGRLAAGTPGMVAGMAEVAHRYSNVPWKELLKDAHLYAKKGFRIHRLLSRYLRYYKWKLRFRESMRVLFPKGKRLRQGQRLKQPDLAWTLKRIQTIGPRDFYYGEIAKRLDKDMRRGKGIMRLKDLNKYKAYWQKPVIGSYRKFTIYSMGTPSSGGVHLLQILHILNGFSLPKMAPYSDQRLHLLGESMRLAFADRAKFQGDARFAKVPNKGLISRKYAAALRKKISMEKAAPSVKPGAPADFTKH-TSHISVIDQWGNAV.. 475
155 0.000e+00UniRef50_D2R0Y5 Gamma-glutamyltransferase n=1 Tax=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) TaxID=530564 RepID=D2R0Y5_PIRSD  ali  35  23................SLASPLIADDSNQPLPPF--AARGTAGAVATVHPIATAAGIDAAKQGGNAIDAAIAAAVMLGVVDSHNSGLGGGCFILARLA-SGKTVCIDGRETAPAKATRDMYL-RGGKADP-NLSQTGALAVATPGALRAYELLSREAGTRKFAELILPAAQVAEEGFAIDRVLAGRIAATRETIAFPATAEVFTASGKPLETGMTLRQRDLARTLRMIAEQGVDWFYEGELAERIGAWMREHGGLLSQDDFKNYQPARREPLSTSFRRNTILGFPPPSSGGVHVAQILKMLERFPLAEIHRSSPAALHLIAEAMKLAFADRAKWLGDPDFAKVP-RGLIDEKYLMARASLINPQETTAAV-AGEPPHPQSDHTTHITAADRAGNIV.. 402
156 0.000e+00UniRef50_E6TSJ9 Gamma-glutamyltransferase n=15 Tax=Bacteria TaxID=2 RepID=E6TSJ9_BACCJ  ali  29  7...............................TSYRPTTMSKNGMITTPHYLASQAGMAVLQNGGNAIEAAIAAASTISVVYPHMNSIGGDNFWLIYDAKKKKVLGLNSSGRSGENVSIPLYKVKGYEK---SIPIRGYLSATVPGAVAGWEEAHKLTGEFSWETLLQSAISYAREGYPVTPSQQYWTEVNMELQRFEEFRKVFLKEGKPYKTGEILKQPDLANTLEEISKKGASAFYSGSIAQKMIEDFERKGGLLTRKDFENHRSDWVNPISVNYRGFTAYNL-PPNTQGFASLSILNILNHFDFSNVKENSTEYFHLMIEATKRAFMDRDTWLCDPTFTSIPIDDLLSTKRGKELAGTIDFQSTCKRENALDP----KGDTVWFGVVDKEGNAVS. 376
157 0.000e+00UniRef50_A0A2N2H831 Gamma-glutamyltransferase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2N2H831_9DELT  ali  31  8..............................FRSRRSNVLARRGMVATSQPLAAQAGLEILMQGGNAADAAVATAAMLNVVEPISTGIGGDCFALYYDGRSRKITALNGSGRSPAGASIDTVRRLGYTRMP----VFTGISVSVPGTVAGWSDLLERHGRMTLGDVLKPAIWTAENGYPVSELIANAWKAQEKKLRDPDWHSELLLEGRAPRAGEIMRIPTLAATLRSISEEGNRYIYEGDFARKLSDHVQRYGGWITPSDMAAHTSTWDEPIFADYRGIRLYEC-PPNGQGLAAVIALNLAAGFELGSMPA--ADRVHIMIECMRLGFADARQWVCDPRVVDIPLEQLVSTAYADKRRHLIDPLRAMHRASHGTPV--QGSDTVYLCTADEEGNACS. 379
158 0.000e+00UniRef50_A0A2E0AVP0 Gamma-glutamyltransferase n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2E0AVP0_9PLAN  ali  32  1MKRWNAVVAAALVLTM---------HQDGMTQNHVRVADAGQGMVVSETSLASGIGQRMLARGGNAVDAAIATAFALAVTWPEAGNIGGGGFMMIRSPD-GEAVCIDYRETAPAAAREDTFQPGDGYLTRKV--------VGVPGTVRGLGLAHQRYAKLPWRGLVLPAAHLARDGFPVDRYLASSVNHVLSVVRFAELKRVYKPGGGNWQAGDVMRLPDLAKTLMRIAEHGPDAFYQGPLARSLVEEMERGQGIIREADLDAYRAVVRAPVRGTFRGYEVLGAPPPSSGGTCLIESLNIIEALEVNPAERFSAETIHLIAEASRRAFLDRARYLGDPGFVKIP-AKLLTKKYARKLAGEIERQQASSSAAPEIKLADESPDTTHFSVVDGEGMAVS. 385
159 0.000e+00UniRef50_D5DGN3 Gamma-glutamyltransferase n=181 Tax=root TaxID=1 RepID=D5DGN3_BACMD  ali  29  7...........................THPYASQRTCTFGKNGMVATSQPLAAQAGLEMLKKGGNAVDAAIASAACLTVVEPTSNGIGGDAFALVWINE--ELYGLNASGPAPASISIEALRAMGIKEMPAR----GFVPVTVPGAPSAWAELSKRFGRLSLKEVLQPAISYAQEGFPISPILGYNWERAFERFEYKHWFETFTNNGSAPKVGEVWRSPDHAATLLEIAETNGESFYRGDLADKIAAFSKKYGGFLTKEDLAAFRAEWVKPISTSYRGYDVWEI-PPNGQGLIALLALNTLKGFSFDA--KDSVDTYHKQIEAMKLAFADGQKFITDADKMTVAVEDLLNDSYANKRRGLIG-EKAL-VPEAGQPS---HSGTIYLATADGEGNMVS. 369
160 0.000e+00UniRef50_A0A2N2RBN5 Gamma-glutamyltransferase n=17 Tax=Bacteria TaxID=2 RepID=A0A2N2RBN5_9PROT  ali  29  4...............................TTGRPVTMGPNGMVTCPHALASQAGVEVLRAGGSAVDAAIATSAALAVLYPHMTGVGGDAFWLIHDAKTQAVRYLDGGGRAAASASIEWFAQRGHAEVPFR----GILPATTPGSVASWVEAHATYGRLPLARNLQTAIGYARDGFPVTERLAGWIEFARKDLEHAESMAIFMPDGKAPRPGTRLTNPNLAHTLSAIAEHGRAGFYEGPVAAELARFAGEKGGFFTASDLAVQTARWGQPLQGRYRDLTLYETPAPT-QGFTVLEMLNLLEPFELHQREYLGTDHAHLLVQAKQVAYHDRDRHLADPAFADVPMERLISKTYADERRKLMDPARALPVPSYGSLT----GDTVYIAVVDAEGNAVS. 366
161 0.000e+00UniRef50_T2MH65 Gamma-glutamyltranspeptidase 1 n=2 Tax=Cnidaria TaxID=6073 RepID=T2MH65_HYDVU  ali  30  65........................................QRAAVATDNTECSLVGKKILVKGGSAVDAAIAALLCLGVINSHSTGIGGGGFMMVYIRELKKATVIDFRETAPSKAHENLFGGDANNGI------RGGLAVAVPGELRGMQLAHEKFGKLPWKDLFEPAIKLAKEGFHITDSLQIALKWKKDVFDEPCLRKLFVRKGKLLSKGDRVKNVALAKTLEKIAAHGADVFYKGKLAKQFVKDVKKKGGIITEKDLHGYTPIIRTPLQSTLGNFSLLTAPPPASGPILAL-ILNILKGYNMTEFEKQQPEVYHRMIEAFKFAYARRTE-LADPDVMKI-VHNLLDESLAKKIRNQINDSRTYNISHYGGKYFQKTTGTTHLVVVGPNGDAV.. 420
162 0.000e+00UniRef50_A0A163JHH0 Uncharacterized protein n=5 Tax=Mucoromycota TaxID=1913637 RepID=A0A163JHH0_ABSGL  ali  28  63.....................................VMGTHGGVAVEAEECSNVGVQILKQGGNAVDSAIASALCIGVINNHATGIGGGGFMLIRSP-NGTFDVIDFREQAPAQAHEDMFTHDP------MLAQIGALAIATPGEIRGFELAHQRHGQLEWHQLFEPAIRIARDGFIATSFMESRLKLAEEWIASQTWMDVYAPNGTLAREGDLIRRPALATTLETIAKEGPDAFYKGPLAESMIRTIQENGGILTMDDLSAYKAIIRPTAHTYYHGRKITTATSPASGPV-LLAMLNILERYNLYAQG-ETTLNTHRMLEAFKYGYAFRTE-MGDPAYVQARMHELVSKDWASCVRQNLSDERTFPPPYYQPKYDHEAHGTMHLSVVDEADGAV.. 415
163 0.000e+00UniRef50_V2XZL1 Lincomycin-condensing protein lmba n=2 Tax=Moniliophthora roreri TaxID=221103 RepID=V2XZL1_MONRO  ali  31  22..............................FSSRRSVVYGTKGIVSSSQPLATEAGLEILRKGGNAADAAVATSAALNVTEPSCCGIGGDAFCLFYDAKTKQVKALNGSGHSPEKLTIDYIRRRGIK--GSQIPVTDLNAVTVPGAAAAWADTIEKFGSLSLAEVLDPAIRLAEEGVPVSEINSFSWQRSENLIKNPNGDEMLL-NGRAPLPGQIIKLTNLGKTFRELAAKGKDGFYKGRIAEAIVELIQSKGGVMELEDLAKHETKFVEPLKYTYAGYEVWTSPPYSSAGITALIALGILESAQLSEMEHNSTEYLHILVEALRLAFADSQWYVADPDVVDVPVKDLLNKEYLASRARLIDPTKTNPRAVHGNP--FNSSDTVYFSVTDRWGNACS. 429
164 0.000e+00UniRef50_A0A258AAU8 Gamma-glutamyltransferase n=2 Tax=Rhizobiales TaxID=356 RepID=A0A258AAU8_9BRAD  ali  35  27...................QPLAPAPEAATDKIAKATATAQRFMVAAANPLAAAAGRDILRAGGSAVDAAIAVQLVLNLVEPQSSGLGGGAFLVHWDEAARRVITLDGRETAPAAAKPDRFIGKDGKPMRFVEAVVGGRSVGVPGTPKLLEEAHRRWGKLPWPQVLAPAIKLAEDGFAISPRLNGLLSGERNLAKDARAAAYFYADGQAKAVGTILRNPAFATTLRALAERGAGAFYEGEIARDIVATVATNPGDMTAADLAGYRLEE---------------------------QMLGILETRDLARMGP-SADAAHWFSEAGRLAFADRNLYLADPAFVGVPLPGLIDRDYIRSRAGLISPERSMGRAKAGEPPNKRENGTSHIAVVDGQGNAVS. 390
165 0.000e+00UniRef50_B3S594 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3S594_TRIAD  ali  30  38...................................PPKYFSEGAVAADSPYCSVVGRNMLIKGGTAVDAAIATMICSGTVNLHSTGIGGGGFLVVYTKKTKMAKAYNFRETAPAMASENMFVGDN------SKSSLGGLSVGIPGEVRGMHAAWKMHGKLPWKALFEPSIRLAEDGFKVSTPISAAINSTQKAMQQDGLKELLQPNGTNLQIGDTMRRPALARTLRIIANEGAEAFYTGSLAPKIVNDIRSAGGIITAADLANYKVSVTDPIKLKIGNLTMYSLPPPSS-GIVLGQILSILEGYKFTNASEATVLTYHRIIEAFKFAYSSRS-YLGDPKFIDIKIAEMLNPTFNANLRRKINDNRSFLPSYYGGLSATKNAGTSHMSVLAPNGDAVS. 404
166 0.000e+00UniRef50_X6FH50 Gamma-glutamyltransferase n=1 Tax=Mesorhizobium sp. L48C026A00 TaxID=1287182 RepID=X6FH50_9RHIZ  ali  27  1...........................................MAATSHPLSTHAALEMLRAGGNAVDAAICASAVQAVVEPQSTGIGGDCFVLYCPDGTDKVIAFNGSGRAPGAASIERFRAMGMEEVP----TYGPHSVSVPGAIDAWDRLIRDHGRKTLAEVIAPAIHYAENGYVVHDRVAFDWREAKALLEQDHSAAIFLREGRALEACETHVQPALAATLRRVAELGRRGFYEGPVAEAIVARLQELGGLHSLDDFAAMRCDYVTPDSIDYRGYRVHQM-PPNNQGLTALLALNILAQDDLSSLEPHGARRFHLEVEAARLAYRERDSRLGELDRSSPVIEALLSKDHAAGLRRKISMERAMTDLPE---VELKRSDTVYISVVDEDRNAIS. 347
167 0.000e+00UniRef50_A0A2S6QK23 Gamma-glutamyltranspeptidase (Fragment) n=1 Tax=Alphaproteobacteria bacterium MarineAlpha9_Bin7 TaxID=2013102 RepID=A0A2S6QK23_9P  ali  34  16..YILCFTFSGIVGIGVASAVEREAPEPAGEHASQRLVKEGQDLIAVANGHAAVAGASVLRAGGSALDAAIAAQLVLNLVEPQSSGMGGGAFLLYFDSTSRELISYDGRETAPASAQPDMFLHSDGTAPTYLAALVGGNSVGAPGLLRMLSLAHKNHGRLSWARLFTPAIDIADSGFAISPRLHTLIAKVPTLNQFENTANYFFPDGFPKAVGTKLTNESFAQTLRELAVGGAEIFYRGPIAQDIAETVALAGGGLTALDIADYRPFVRPPVCLDYRGFLVCGMGPPSSGGIAVLQILGLLSNFDLGSMKPWSADAAHLFLEASRLAFADRSRYVADPDFVRVPVNGLLD................................................ 367
168 0.000e+00UniRef50_A0A1Z8SE77 Gamma-glutamyltransferase n=1 Tax=Flavobacteriaceae bacterium TMED48 TaxID=1986717 RepID=A0A1Z8SE77_9FLAO  ali  37  29.........................................KGAVVSAREEASKIGVEIMAQGGNAFDAMIATDLALTVCYPNAGNIAGGGFLVYRLADS-ETGSLDYREQAPMAANADMYLDEKGNVIPG-KSTLGGMAVGVPGTVAGLEAXXXKFGSLPWEDLVQPAIDLARKGYRVTKKQXSSFXGKXXEFIEVNGERTFYAQG--FKEGDLVKNTALAVTLERIAKYGSAGXYQGENAVALIERVQETGGXMTLXXLLAYXPIWRDPXHFSXKXLXIYTMGPPSSGGIXLGQIMKMVEPFDIGQXEQNSLETIQXVVEAEXRSYADRSLYLGDPDFITIPXDSLLNTDYLANRMASFDFXQATKDISPGTIVWXESEETTHYSILDAMGNXV.. 381
169 0.000e+00UniRef50_A0A1I3JBW6 Gamma-glutamyltranspeptidase / glutathione hydrolase n=1 Tax=Ruminococcaceae bacterium D5 TaxID=1520815 RepID=A0A1I3JBW6_9FIRM :_  ali  32  84.....................................AEGMNGMVASASPIASKVGVTILERGGNAVDAAVAVAYALGMVESNASGVGGDGYMLVYDANSGKSTFLDYKGEAPAAFTLE-FLNEHRGVKGYK--QTGYSAV-VPGFVAGMEKANELFGTMSMAELLQPTIDYAEKGVPVTPFMAHYVDYYKTLMKYPETEATFLNDGFPYNEGELFTNQNYANVLKRIAAEGKDAFYTGEIAQSIVDSLAEHDGVMTLQDLANFRVEVREPVSTTYRGYRVVSA-PPGAGGAAVIEALNMAEHFDVHSMGHNTPETLHMWAEILKLSAVDRYHYIGDPDYTDPSMYGITTKSYAADRVKLVNMERVLGKPKYGKVEEVEGAHTTHVSIIDQWGNMV.. 439
170 0.000e+00UniRef50_A1RAB3 Gamma-glutamyltransferase n=123 Tax=Actinobacteria TaxID=201174 RepID=A1RAB3_PAEAT  ali  36  21.................SGAMASPAFADPRETDKKATATGYGGAVSTVDPEASAAAIDVLRKGGNAADAAVAAAATLGVTEPYSAGIGGGGYFVFYDAKTQQVGTIDGRETAPAGITQDAFIDPEGKPYRFPELVTSGVSVGVPGTPATWERALERWGTMNLRETLKPAIKVADKGFVVDETFRQQTLDNEVRFAFTSTRDLFLPGGDAPAVGSVFKNPELADTYRQLAKEGTDAFYGGPLAEEIVKTVQAPPGSMTVQDLANYKVLDQAPTKVEYRGYDVYGMAPSSSGGTTVGESLNILENYDLKGMKP--VDALHHYIEASSLAFADRGAYVGDPAFVNVPTQTLLNPVFAKERSCEISPTAATKPVAPGDLKTFDGASTTNLTVADKWGNVV.. 431
171 0.000e+00UniRef50_A0A1V6BND6 Gamma-glutamyltranspeptidase n=1 Tax=Tenericutes bacterium ADurb.Bin140 TaxID=1852919 RepID=A0A1V6BND6_9BACT  ali  35  20..........AFTIVGCKKGGDDKGGDQEPDFTDLSVVISSNGVVSAASPYAAKAGLDVLKAGGNAFDAAVAVSFALGVVEPNASGIGGGGIMVAYEAKTGQFISYNFREFVPAAGEASAFPNRDADVDD------GIKASGVPTQVIGLLTVLENHGNLDRQTVMAPAIRYAKDGFPVTPELANAISENFNKRSKEETKNVFADMGTPLQEGDLLVQANYGKALEMIAQQGASAFYEGEIADAIVALQEEKGGLITHDDLNNY-PIMEQPIQGTYRGYDIATVTSPSSGGMILLEALNMLEVYEISGMKRDSAELLHVLAVAQQLAYGDKRKYIADTKFVDVPIAGLINKQYAAERWQKFDPARAQGDNDYGNPWPYEHYSTTTFSVVDKEGNIVS. 429
172 0.000e+00UniRef50_A0A1F4ZTS9 Gamma-glutamyltransferase n=3 Tax=root TaxID=1 RepID=A0A1F4ZTS9_9BACT  ali  33  15....................CSLRPEASLPQPADRHSPHGRRAMVVAAHPLAVQAGLEMLRQGGNAVDGAIAAAAALNSAEPFASGIGGGGFMVIHRAREKKTTVINFREKAPRLASPRMFKDKGEEEKEWRTS--SGLGVAVPGALAGWDLALRKYGTRTLAQALAGAIAIAEGGFDLSPTFSTINKDEYERLLKPEGSA-YLNEGLPYEPGDRFHNPDLAGTLRLIAARGIKEFYQGEIAAKIVAAVREKGGIMTAEDLASYSAVELEPLRGTYKDMTILTAPPPASGGLHLIEFLNIIEGWPVRKWGRNSAAYVHHLSEALRLVFADRERYVGDPDFVSIPVDRLISKEHAAALAARIRADGPLDRYVAGEHARGEKANTTHLCVLDEDGNIV.. 394
173 0.000e+00UniRef50_A0A2E4KRI2 Gamma-glutamyltransferase n=49 Tax=Acidobacteria TaxID=57723 RepID=A0A2E4KRI2_9BACT  ali  27  22........................SALAQSQRTMRPVIRGTEYAATSMKAPATAAAMRILDAGGNAFDAVVAGQAVLALVDPGGNGIGSDAVILIHDAKTGEVLSINAEGTAPQLATIEWYEEHNHGEIPVSD---GLLSASIPAVVDAWYVLLDRWGTMTFAEVLQPAIEVAEEGFPLSERLASSIARSEKIRKYPTTMNVYWPDGRAPEAGEVFKNLDAANTLKKLAGAGRDRFYKGDIARTMAAFFEEHGGLYRYEDFANYSVKVETPVSIDYRGYTVYKNPSAN-QGPTELFTLKMLEGYDLQALGHNSVEYIHTSAEALKLAMADREKYLGDMDFITIPYEGLLSEEYARERRTLIDPDRASFELRPGTPERFMGGDTSYIAVVDKDRNMVS. 425
174 0.000e+00UniRef50_A0A1X2HR61 Gamma-glutamyltransferase n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2HR61_SYNRA  ali  29  21...................................HLVTGSRAAVAVEVDVCSGTGVDVLKQGGNAVDAAIASALCIGVIDNFATGTGG--FMLIRSP-NGTFEFIDFRETAPAAAHRDMYNNDP------DLAKYGGLAVGVPGEIRGFQLAHERHGKLPWATLFEPAIRIARDGFLTTPLLEERIKASLPWLESPEWVEVYAPNGTLAKAGDLIRRPTLANTLETIAIEGPDTFYTGRIAEHLVNTTRAAGGILTMDDMRSYEALIRPTVSTYYHGRKVTTCSAPTSGP-MLISVLNILEQFNLRVEGLVGV-NLHRLIESLKYGFAFRTE-MGDPEFTKNRLDQLITKTWADRVRRNIS-DSTTHDPLYYQPDHVDSHGTMHLSVVDEDDGAV.. 373
175 0.000e+00UniRef50_A0A2E1KMS7 Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E1KMS7_9PLAN  ali  32  9..................LASSTRSYLMITWNRTRPTVGGLQGAVASAHPLASQAGLEILRTGGNAIDAIVATAATLNVVEPYMSGVGGVGFLLFH-PVGGETRVLNFSGYAPRAATLDQFTPQDQD--------LGPKSCLVPCNLGGWFEALQAHGSQSPEEVFARAIELAERGFPLHPVNARMLAATLPRLN-AAGRDIYGRDE--PRVGSVLRQTDLAETLRALATHGPSWFHGGDLGKKIADYIQSQGGLLTLEDLQDPQLEWQDPISIRYRNLEIKTC-PPNCEGFQILQTLKLLEPFELRELGHNSAQYIHLISEAIKLATADRITWAGDPRFHPLPLDRLLSAQYLDERRSLIDPQRASRSVSPGKVDGL----TTHLVAVDAEGNVAS. 383
176 0.000e+00UniRef50_A9FZ92 Gamma-glutamyltranferase n=20 Tax=Bacteria TaxID=2 RepID=A9FZ92_SORC5  ali  31  55......................SRFPAGWPYPEGAPPVRGPS-MVTSDAALATKVGAEVLAAGGNAVDAAVATAFALAVVHPTAGNLGGGGFMVARVGD--KEHALDFRETAPGKATHDMYRGKDGKATEG--ARVGHLAVGVPGSVAGLWEAYDKLGKKTWAELVAPAIRLAKEGFSVDENFATTVKAASGKLRFPASVALFLPGGAPIEIGATWKSPELAATLERIAEKGPAGFYEGKTAELFVAEMRRGKGIITAADLKGYKAKWREPIVFEYRGRRVASMPLPSSGGLALAMIAHQLEGLDVAKLGWHSPSHVHVVAEAMRRVFLARNEVLGDPDFVKNPVEELLSVAWAEKQRATIAADRATPTDEAVKDSGGRGPHTTHFSVVDAQGNAV.. 431
177 0.000e+00UniRef50_A0A2P6RR44 Putative aminoacyltransferase, Glutathione hydrolase n=36 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P6RR44_ROSCH  ali  30  31...................STTSLHAASGLTQNRREVIIARNGAVATDDGRCSKIGMTVLREGGHAVDASVAAALCLGVVSPASSGIGGGAFMLIRQG-NGKAQAFDMRETAPALASQNMYAANA------TLKSKGALSVAIPGELAGLHEAWKQHGRLPWERLVKPAERLARLGFKISPYLNMQMTTESGILADEGLRHIFTSKGRLLQTGVTCRNRKLAETLRQISKFGPVAFYNGSIGSKFIRDIRKAGGILTMNDLQSYKVKVTKPVSIDTLGHKILAMPPPSGGPLLIL-MLNILSKYNIS--GVSDPLWVHRQIESLKHVFAVRM-NLGDPDFVNVTLADMLSPKFAEELKKTILDNMTFDPSHYGGRWGINDHGTSHLSIIDHEQNAIS. 402
178 0.000e+00UniRef50_A4FBJ2 Putative gamma-glutamyltranspeptidase n=20 Tax=Terrabacteria group TaxID=1783272 RepID=A4FBJ2_SACEN  ali  34  1MLGRQVRLTVGVLATCALVAPVAQAAPGGPQAPPKQAAVGYGGAVSSVDPEATRAGIEVLRRGGTAADAAVAVAAALGVTEPYSAGVGGGGYFVHYDAQSGAVSTIDGRETAPASAREDMFV-EGDKPIPFDEAVTSGLGVGVPGTPLTWQEALDRWGRKDLGEVLRPAERLARRGFAVDETFRAQTESNQARFAFPATRDLFLPGGKLPEVGSTMRNPDLADTYSALAKDGVDALYGGEIGADVVRTVRARPGGMTDEDLRRYRTVEQAPSHVEYRGLDVYGMAPSSSGGTTVGEALNMLERTDLS--GVDKTEYLHRFLESSKIGFADRNRWVGDPAFNDVPTKELLSQEFADSRECLITPDAVLPPVAPGDPEPYEGPNTTHLTVADASGDVVS. 423
179 0.000e+00UniRef50_A0A2E9MZ19 Gamma-glutamyltransferase n=24 Tax=Bacteria TaxID=2 RepID=A0A2E9MZ19_9GAMM  ali  28  36................AAPVVTESLPTTLYAPQNRPDVRGQIGAVSAGHPLAAQAGMRVLQNGGNATDAVIAMAGVLAVVRPHMNGIGGDAFGIFYAGETGEVTALNASGRSGALATPEFFAAAGVDRVPG----VGPLSVSVPGAVAGWVDAHERYGSMDFADLLSTGIDYARNGFAVSTRLAQDFDEQGANLNQAGL-DLYLPNAAPPPVGSLLRNPELAGSLEIVASEGKTGFYQGSIAQQLSAFITEQGGYLRQEDFATHTSTWVEPLRGDYLDHSFVVM-PPNTQGITQLALFEMASSHDLAVMEQNSADYLHTLIELKKLAFADRDRWVADPEIASVPTQQLLDADYLQQRSQLIDMRVAAPEVAPGEPNGSRSGDTVYITAVDQWGNAVS. 419
180 0.000e+00UniRef50_A0A1R0H6W2 Gamma-glutamyltranspeptidase 1 n=13 Tax=Smittium TaxID=4888 RepID=A0A1R0H6W2_9FUNG  ali  30  147............VLSKAPAEGNPEIPDGQGVVINSKQALGKNGAVATDESRCSQIGIDALKDGGSAVDAAIASALCVGLLNSFSAGIGGGGFMLVRKP-NGDSDVIDFREVAPASSNKDMFIKN------ITLAQLGGLSIAVPGEIRGFELAHKRYGKLKWSRLFEPTIKLARDGYKIGKMLAIHLKSQQKSLASEGFRQIFFDNGNVLKEGDLAKRVNFSNTLQRISEEGSAAFYNSEITSSMVNTIRQNNGILTQKDFNLYSPILRKPLTITYNKRKVITCPPPTSGSI-LASILNVLEGYNLKG-DDNRPLNIHRIVESFKFGYAQRSS-LGDPAFVDVSVSNNMDKDFASEVREKITDDKTHGF-KYYEPEHDVDHGTTHLSVLDKDDMAVS. 526
181 0.000e+00UniRef50_A0A1Y1Z881 Gamma-glutamyltranspeptidase n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A1Y1Z881_9FUNG  ali  32  47..........................APQKSSQKAILIEAEHGAVAADDKTCSQIGVQILKDDGNAIDAAIAGALCIGVINSFSSTIYGGGFMVIRNGTGAEV--IDFREEAPSGAHRDMFNENPL------LAQVGGLAVGIPGELKGFELAHQRYGKLPWKRLFEPSIRLSRDGFRVTSELAKRIEIMKPYISKASFRAVFAPTGEFAKEGDILKRETLANTLEAVAKQGAKAFYSGPIAESMVKEIQRTGGIATVEDFLSYQALIREPLVGDYRGHKVITAPPPASGAI-LLSVLNILEGYPLDRDGL-TTLHAHQILESFKFGYAQRTE-LGDPTYVDIRVAEFVDKKYAAQVRQNLSDIRTFP-ISHYNPDVEESPGTTHLSVVDKN...... 413
182 0.000e+00UniRef50_UPI000C087BE0 gamma-glutamyltransferase family protein n=1 Tax=Bacillus sp. Marseille-P3800 TaxID=2014782 RepID=UPI000C087BE0  ali  27  4........................DPHNHPYPSKRMPAYAKNGMVATSQPLAAQAGRDILNQGGNAVDAAIATAACLTVVEPCSNGIGGDAFAIVWL--DGDLYGLNGSGPSPASMTIDAVKQRGYDTMP----TTGLIPVTVPGAPASWASLSKRFGKLPLLDVLQPAITLAEEGFAVTPTISRQWKTSYKRFQFSAWFETFSLNQRAPEPGEIWRSPNHAHTLRLIGETNAKAFYSGELADQIDAFFKKHHGFLRKEDLAAFEPEWVDPIHTNYKGYDVWEI-PPNGQGLIALMALNILENVEINE--KENVDTYHKQIEALKLAFTDGQAYITDENHMSVPTQSLLDKSYAAKRAQEIGETAQLPTV--GKPTA---SGTVYLCTADSEGNMVS. 369
183 0.000e+00UniRef50_A0A143Q7W7 Gamma-glutamyltranspeptidase n=134 Tax=Bacteria TaxID=2 RepID=A0A143Q7W7_9NOCA  ali  33  59............VIGAPGTGADGAPEIGTGYRTGMVAVTTPEYSVATANPLATEAACAVLRDGGTAADALVTAQTVLGLVEPQSSGIGGGAFLMYLDGETGELQAYDGRETAPASATGDYLRYVDDVPPPVPDARSSGRAVGVPGAVRLLERVHADHGRTDWRELFDPAVRLADDGFTIGERMASSIAGSAPQLADPPSAAYFLPDGSPKSAGTVLTNPAMAKTLGAIATDGADAFYTGSIAQSIVDAVARTAGRLTLDDLASYRVIDRDPVCGDYRDAVVCGMPGPSSGGIAVAQTLGILSAFDLDRYPPQDPRAAHLIAEAERLAYADRDKYVADPDYIPLPPDALLDPDYLRSRAVTIDPGRSMGTAVAGDFGPVPESGTSHIVVADRDGDVAS. 478
184 0.000e+00UniRef50_S7SSA9 Gamma-glutamyltranspeptidase n=8 Tax=Bacteria TaxID=2 RepID=S7SSA9_9BACI  ali  27  1MKTETVLFMTLYFSLNERKGIAAMDYLYHPYPSQRMTVFAKNGVVATSQPLAAQAGLDVLKKGGNAIDAAIAAAACLTVVEPTSNGIGGDAFALVWT--DGKLYGLNASGYAPKSISIEALKELGYTEMP----KYGFAPVTVPGAPAAWAALSKRFGRLPLVETLAPAIAYAENGYPVSPVLGKYWAAYKEALRGPEFAATFAPGGRAPKIGEVWASPDHAATLRSIAETEAESFYRGELAEKIAAFSKQYGGFLAADDLAEYEPEWVEPISVSYRGYEVWEI-PPNGQGLVALMALNIMNGFDVPSVP--DVETHHRQIEAMKLAFADGKAYIADRRYMNCSPDELLSESFAAMRRAQIGAEALTP--EPGTPPK---GGTVYLAAADGEGNMVS. 391
185 0.000e+00UniRef50_A0A1W9X972 Gamma-glutamyltransferase n=1 Tax=Desulfobacteraceae bacterium 4572_88 TaxID=1972444 RepID=A0A1W9X972_9DELT  ali  45  18..........................................GVVSVSYPQAAEAGAKVLENGGNAIDAAAAIQFALNVVEPQFSGIGGGGFMMIHLAETGETFILESREKAPAAATPDMFMS-DGEAISWAERTSSGIAVGVPGTLMGVATALEKWGTISLSDAMEDAIDLAETGFYVNEFLATAIARDETQY-QPETAAVFRHDGTPYQEGELLRQLDLANTFKLIAENGTDVFYHGEIGQAIVQAQTRAGGRMTVDDLAAYDVKIRQPIVGDYRGYTMMSMSPPSSGGLTVVQMLKMMERFPLGGFGFGATKTIHVMCEAMRLAFADRAVWMGDEDFVAVPKVGLLADAYVQKRSDLIQLDSRMDTPSHDDPWPYEGAHTTHFSVVDKWGNMVS. 399
186 0.000e+00UniRef50_K9XL69 Gamma-glutamyltransferase n=31 Tax=Bacteria TaxID=2 RepID=K9XL69_9CHRO  ali  30  9.............................PYAASRRVILGKNYAASTSQPLATLAAMEMFWAGGNAVDAALAMAIALTVVEPTSNGIGADAFALVWD---GKLHGLNASGKSPRYLKVDDIL---------QIPLAGWLTVTVPGAVSAWRSLWEGWGKLPFEQLFVPAIRYAEQGFPVSPETARAWQAASNLLAFQPFKQVFFPGDRAPRAGEIWGSIAHAQTLREIAETGGESFYRGNLALKIANFAADTGGMLTQEDLAQHQPDWVQPISTNYRDLTVWEI-PPNTQGIAALMALNILEGFDLSRYPRESVESYHLQIEAMKLAFADVHAHVGDPEFMQVTSDRLLDKTYAAQRRELISNHALFAQP------NLPKGGTVYLAAADRD-LMVS. 361
187 0.000e+00UniRef50_A0A102DEF4 Gamma-glutamyltransferase n=4 Tax=Novosphingobium TaxID=165696 RepID=A0A102DEF4_9SPHN  ali  30  28.................SFDAYRGDRSTGWLGQTRSEVMARNGMVATSQPLAAEAGIEVLHAGGNAFDAAVATAAAINVVEPEATGMGGDMFVIAWLAKEHRLVALDASGRAPQAATAEHYRKAFGANMPED----GIQSAVVPGAVDGWATLLGKYGRLGFREVLAPAIRLADQGFPVSQRIGTEWAMSTDLLKDPDTAAIYLDHGKAWGWGSIFRNPDLAKAFRLLGEGGRDAFYKGPIARAIVAKSQKSGGLFTMADFDRIHASWVEPISTTFNGYTIHEM-PPSTQGFAVLELMNLIEGLTPDRINPKSADFWHLMVEAKKVAYTDLRKYNGDPDFTKVPVAMLISKEYAAQQCSRISMAHA----AALDPSEEPLGGTAYITTADAEGNVVS. 405
188 0.000e+00UniRef50_A0A248TFL2 Gamma-glutamyltransferase n=1 Tax=Bacillus kochii TaxID=859143 RepID=A0A248TFL2_9BACI  ali  30  2...........................SSSKQSYRPTTMATNGMITTPHYLASQAGLKVLQAGGNAVEAAIAALSTIGVVYPHMNGVGGDNFWLVYDAKQKKLKALNSSGRSGEGATIPFYQQQGYSKIP----SRGALAATVPGAVAGWEKAYQNHGTVEWSELLQTSIHYAKDGFPVTPSQVYWTNEFRHLQRFTEFQKVFLANGLSYRAGDIMKQPDLARTLEGLAAEGGSLLYEGELAKLMTTDLQLHGGVLTIDDLRHHQSNWVEPISVRYRNHQVFNV-PPNSQGFASLSILNILNQFPLSDVEEGSADYYHLLAEATKRAFVDRDQYLTDPDFATIPLDEILSLRRGIQLAESIDFTSVRAFEKQLDP----KGDTIWLGVVDKEGNAVS. 377
189 0.000e+00UniRef50_A0A2C7ADT4 Gamma-glutamyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A2C7ADT4_9PROT  ali  34  6........................DRAGSPFAREKQPALASRGMVVTNHPVASAAGAEMLLGGGNAIDAAIAALFTLTVVEPMMVGPLGGGMAHIRLAD-GRHLVLDGISTAPAAARPGMYRTPDYQETEGLENKVGVLAMGVPGALAGWCKALAGHGTLPLDEVLRPAIRAAAEGFRVTPYLTGAIHDAADLARDPGLAATFLPDGAPPAPGTLLRQPALAESLRLIAEEGPSALYGGALGRALAAHMAASGGLITLADLEAYRVAEREPVVGHYRGHEVLSPPPPSSSGVHVTQMLNLLEAYDIAALGSGSAATIHLLAEALKMAFADRGAATADPAFIRVPVDLLTSKDYAATRRALLREDLA-QDWTAGIPPGAESANTTHVTVADAAGNIVAS 386
190 0.000e+00UniRef50_UPI00057139B5 gamma-glutamyltransferase n=1 Tax=Thermorudis peleae TaxID=1382356 RepID=UPI00057139B5  ali  32  5...........................SPAQRTGRPTTLAHTSMIATPHYLATLAGLHVLRDGGNAIDAAIAANAVLTVVYPHQCSLGGDLFCLLWEPYEQRLYALNGSGPAPRGATIDAVQAAGYATMP----QRGPWSVTVPGVVGAWEALRSRFGTQTFERLLAPALHFAEHGFPVSPLLHAAIAAHQTLLAHPPAAAQFLPGGRVPAIGDRLVQPAVAQTLRRISADGAQAFYTGAIAEAIAHTVQQAGGVLTADDLAQYRPEWVEPLRTTYRGVELVEM-PPNTHGVTAMQLLHILEGYDVATLGWGTPALLHRMLEAKKLAFADRDRYLGDPAYADIPLTRLLDKAYAATLRAQIEQQHAQPMAQRVEP----NGDTVYLCVVDREGRAVS. 366
191 0.000e+00UniRef50_A5UZN1 Gamma-glutamyltransferase n=8 Tax=Chloroflexi TaxID=200795 RepID=A5UZN1_ROSS1  ali  31  7.......................PPITGERFRSRRSVVMTSRGVVATSQPLAAQAGLRMLLAGGSAADAVIAAAAVLNVVEPMSTGIGGDAFALVYDAQTRTVRALNGSGRAPAALSRELFVERGLTSIP----LTGMLPVTVPGAVDAWVELLSAYGRLPLAQVLAPAIEYADYGFPVSEIIARSWTLAEPKLAHPDTARTYLPQGRAPRAGELFRQPGLARSLRLIAEGGRDAFYRGAIAAAIAATSARDGGVLTLEDLAAHHSTWDTPISVTYRGYTVYEC-PPNGQGITALMALNILEGFDLSAYTPASPEALHLQIEALRLAFADAAAYVADPAHAHVPTTWLLSGVYAAERRAQIDPQRALPHVHASTLPG--GHDTVYVTAVDADGNAVS. 374
192 0.000e+00UniRef50_A0A293NJE0 Gamma-glutamyltransferase n=3 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A293NJE0_9BACT  ali  31  1MNR---LLALWLLCTGCSAAGPTGNVVPAEH-------VYEQGAVAADHPLASEAGARMLRAGGNAMDAAVAASFCLSVVDPFSCGIGGGGFMVVWDPATQKAWALNYRETAPASMRPDTFSSLD----DPLASRYGALSVGVPGNVAGLLEALDRWGTLDRATVLAPAIEHARNGFPVNAAYLSAVDWVRSVRTRPVSQWVWLCGGGSLVLGDVVRQPGQADVLDRIARDGAAAFYEGPVAEAIVATIAAHGGDMTRSDLRAYAPATVPALRSPFDRYTLLSMPPPSSGGIAMQQMLRMIDRVDVPNPSLHDPRWVQLVTETMKHAFADRATHLADGTFQPVPVDRLLDGRYVVGRADAIDLDRTGVPTDYGSAPPPSDSGTSHLSVVDADGMAV.. 394
193 0.000e+00UniRef50_A0A2E5FIF9 Gamma-glutamyltransferase n=1 Tax=Solibacterales bacterium TaxID=2026791 RepID=A0A2E5FIF9_9BACT  ali  32  1MLRCKMIMFSKTVLIVCFLCINILGEAIIAG--TRPVVMATRGVVVTGHHRASDAGLEMLKKGGNAIDAGVAAVFAQTVVEFNRFGLGGEVPILIHLARQNKVVVINGQGFAPRRATIEWFQEHNIDYIPGD----GFLGAVVPSVVDTLLLALKEFGTLSLADVLAPAIELAENGFPIYGEFRGHILEQEQRFRTESSAKIFLPGGNVPELGDVFIQKDLAKTLKRLAEEGREVFYRGELAREIVASSDANGGLLEVEDFAQYRAVIEEPTKTTYRGIEIYKAGFWSQGPV-LLQTLNILEGYDLKKLGHNKPAYIHLLAEAMKLAYADREWYYADPDFVEIPQQGLLSKDYAAKRRKLIDLKNPSLIMRPGNPYMFQSDHMTH............. 405
194 0.000e+00UniRef50_A0A2U1QMM0 Gamma-glutamyl transpeptidase 4 n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1QMM0_ARTAN  ali  32  73................................QGSNAVESLEAVVAADDARCSEIGASVLRAGGHAVDAAVAVSLCLGVVNPMASGIGGGGFMVVRSAGTLQTTAIDFRETAPLAASENMYEDD------LDAKYKGALSMGVPGEIAGLYKAWSTYGRLPWKALFDPAIELAKDGFIVAPYLADKILSNADKIRDTGLRQVFAPNGVLLKAGDICYNPKLGWTLEVVANKGPKAFYDGVIGENLVKDVQEAGGILTMEDLRNYEVDVMDALAVKTMGYTILGMPAPSSGTLGLALVSNILESYENSNAAKGS-LGLHRFIEAVKHMFALRMD-LGDPDFVNVTVANMMSPTFAKIIQGRIFDNTTFPS-TYYMPSQLQDHGTSHFCIVDDDRNAVS. 445
195 0.000e+00UniRef50_A0A1H0F9I3 Gamma-glutamyltranspeptidase / glutathione hydrolase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1H0F9I3_9GAMM  ali  35  62.......................................................GYQVLKAGGNAIDAAIAVQMVLGLVEPQSSGLGGGAFLLYFDGSD--VRAYDGRETAPKAVDAELFL-EDGEPLEFMEAVASGRSVGVPGTVRLLEKAHMAHGRLPWEALFRPAITLAEDGFEVSQRLHSSLANDQALRDNPLARAFYYDEGQPVEVGETLKNPALAAVLKRIAEEGSRAFYQGDIAQDIVNSVRQHPGELALDDLETYEAIAREPICTPWQQWEVCGFPPPSSGHLTIMQILGMLDQQPLLEAPLDSSGWLHQFLEASRLAFADRNYYIADPDYVEAPWTTMLAPSYLAKRSALIGKQSLGSDVEHGEPGAIETSGTSHISIVDAEGHSV.. 420
196 0.000e+00UniRef50_A0A2E9K186 Gamma-glutamyltransferase n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2E9K186_9ALTE  ali  30  22.........SLFTTSAYAATTEIQTSENVVLQEIRPEMGGLHGAVVSEHPLASQVGYDVLKAGGNAVDAAVSMAAMLSVVRPHMNSVGGDTFALFYDAETGEITALNSSGKAAGLAEPGFFTSQGLERLPF----TGPLTVTVPGTVASWEASLKRYGTISLSDALQPAIEVARDGFMVSTTLAADLAKAGPRLN-EAGKAVFYPAGAPLEAGSILKNPDLAGSLSAIAKDGASVMYEGKLGQKMAAFLEAEGSPLRAPDFASFKPEWTTAVSMPFQGKNVHTVK-PNSQGIVLLQMLTMAGNMPLKEMGQNSAPLLHNLIETTKIAFADRDRWVADPAYADVPVDGLLDPAYLKNRAALIS-DKASADYLSGLSVPDEDGDTVFLMVVDEKGNAVS. 409
197 0.000e+00UniRef50_A0A258EF60 Gamma-glutamyltransferase (Fragment) n=1 Tax=Algoriphagus sp. 32-45-6 TaxID=1970314 RepID=A0A258EF60_9BACT  ali  32  1MRKINFNVIFALFLLVIGCQPKEPSKEI------KRGLIAENAMVVSAREEASKIGLQIIRKGGNAFDAMMATEMALAVTFPFAGNLGGGGFLVYRLAD-GSVGSLDYREKAPLGASKDMYLDQNGEFLS-ALSTKGALASGVPGTVAGIFEAQRKFGKLTPAEILQPVIELAQKGFVITPDQATRLSRNRESFIEVNGPGTFFA--REINQGDTLSIPVLAQTLERIAQNGRDEFYKGETAKILAKHIQSQGGIITEEDLAQYQAVWREPIVFNYRDLKVISMAPPSSGGITLGQILKMLEPHDLRKLGHHSPEYIQLLVEAERRAYADRNYFLGDPDFV......................................................... 331
198 0.000e+00UniRef50_H5TAZ3 Gamma-glutamyltranspeptidase n=20 Tax=Gammaproteobacteria TaxID=1236 RepID=H5TAZ3_9ALTE  ali  33  6...................................................AASVAMDVLNNGGNAVDAAIAAHFSLAVTLPEAGNIGGGGFMVIH--YEGANDFLDYREVAPQNAHRDMYLNKDGE-VNTNQSIYGVLASGVPGSVSGMWALHKKYGSMPWEQLLAPAVALAKDGFVMPKMLADSIAQYIEYLQEQNISVNFADYFASAKAGKLFVQPELAATLSRIQTLGEDGFYKGETALLIEQFMQQHGGLISRSDLVQYESKWRAPIISQWREYKVISAAPPSSGGIAVAQWLQMYDRVPNQTIAHNSPLYVHILAEAGKRVFADRAEYLGDPDFFEVPKTELLAPEYIAKRASSININ-AISDTSAIRPGLAQSEQTTHFSIVDKHGNAVS. 351
199 0.000e+00UniRef50_A0A2D7E6M9 Gamma-glutamyltransferase n=2 Tax=Planctomycetaceae TaxID=126 RepID=A0A2D7E6M9_9PLAN  ali  30  87.......LGLLASCMAFLLATISQPHDISAHDERVEVIRSDGGIVVSDSRIASQIGRDVLLDGGNAVDAAVATAFALAVSWPEAGNIGGGGFMLVRPANGKKTVCVDYRETAPISMQKNSFTRSDTTFTQ--------KAVGVPGTVKGLALAHAKYGRLKWARLVMPASELALQGVPIDPALAKSLNSVQSENTHSELRRVYKPDHTDWKAGDTLLLPDLAATLRLIAQQGPDSFYKGAIAKQLVEEMGRGNGEISLQDLEQYKAVIRPAMKGNFRGYTILGAPPPSSGGTCIIEALNIIENFNMSKWDRYNPQCIHLIAETCRRVFADRARYLGDPEYTRIP-EFLTSKKYAREVAMSIDLNKATPSITPEINVTSESPDTTHFSIVDKNGMAVS. 476
200 0.000e+00UniRef50_A0A2A5WBH7 Gamma-glutamyltransferase n=6 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A2A5WBH7_9GAMM  ali  28  36.................SLASLSAYPSTVYAAQNRPDVRGLTGAVSADHPLATQVGLRILQEGGNATDAVIAMAGVLAVVRPHMNGIGGDAFGIFYDGQSGEITALNASGRAGSVATPEFFTAAGVDRVPGS----GALSVSVPGAVAGWVDAHERYGSIDFAYLLKSAIEYARDGFAVSTRLAQDFEEQGGVLN-EDGRNLYLPNGAVPPVGSLLVNAELAVSLETIANEGKSGYYQGSIGKKLASYITELEGHLREEDFENHTSTWVEPLRGDYLNHTMVVM-PPNTQGITQLALMEMSKAHSVREMGHNTSEYLHTLIELKKLAFADRNRWVADMEMADIPIDALLDPDYLRKRAGLINHTRAAENVEAGDKNREDSGDTVYITAVDQWGNAVS. 418
201 0.000e+00UniRef50_A0A1C7NR15 Gamma-glutamyltranspeptidase 1 n=2 Tax=Mucorineae TaxID=1344963 RepID=A0A1C7NR15_9FUNG  ali  32  58...................................HLVKGLKGGVAVEVQQCSEVGVQVLKDGGNAVDSAIAANLCIGVINNFATG-----FMLIRSP-NGTFEYIDFRETAPAAATKDMFVDDPL------LAKTGGLSIGVPGEVRGLELAHRRHGKLPWEDLFQPAIKIAREGFKTPKLLEIRVKKEQGWIQNTEWSEVYMPEGKPVKEGDIVRRPTLANTLETIAKEGADAFYRGKIAKSLIKTIQSNGGIMTLDDLQSYRPMIRPTIHTYYNGRKVTTCSEPTSGTV-LLSVLNLIERFQFKVEGL-TGLNIHRLVEAFKFGYAFRTE-MGDPDFIDNRMQQLTNKDFAADIRQKITDD-TTHDPLYYNPDHIESHGTMHLSVVDENDGAV.. 432
202 0.000e+00UniRef50_A0A1Y1WEY0 Uncharacterized protein n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1WEY0_9FUNG  ali  30  105........................AASFGDSDTRSTLVTARNGAVATDEPRCSKIGSQVLIDGGNAVDAAIASTLCIGILQAHSSGIGGGGFMLIRPSDGSAPVLIDFREAAGSAAKADMFLHN------ITLAQVGGLAVGVPGEIAGLHSAHKRFGKLPWKRLFEPSISLARKGYALSSVVYGQLKREAHVLSSPGFNTTYTDGGHLLQPGDIVRRPELASTLEAIANHGPKAFYSGKLAQSMVNAIRENGGILTMEDFAAYAAVDRKPLETFYHGRRVITGSPPTSGSI-LLNMLNVVEGYPLAREG-QTALSYHRIVEAMKFGAAQRTV-LGDPSFVDVNVSKQASKYFASDIRHNISDTHTFGVAHYAEYDILNNHGTTHLSVLDSDGAAV.. 472
203 0.000e+00UniRef50_A0A1Z7YLM2 Gamma-glutamyltransferase n=1 Tax=Gammaproteobacteria bacterium 42_54_T18 TaxID=1856293 RepID=A0A1Z7YLM2_9GAMM  ali  28  4.RYTLVFVAVTLLFTSGCQQSQSTAQTSTQFPAQAS--------VASAHPLATQAGMDILAEGGNAFDAAIAVASVLGVVEPYSAGIGGGGFWLLHRAADGKEVMIDAREKAPLAATHDMYVNKKGK-VNRDLAVNGPLSAGIPGQPAAFAHITNAYGTLPLNRTLKHAIHHADQGFQVDRVYLQLAAYREKVLRFPESHSTLVTNN--LTTDTVITQKDLARTLNTLATKGKAGFYQGPLAQQLVNGVTEAGGIWQLDDLLQYNVIERQPITFTYNNVKIVSAPPPSSGGVALAEMFNMLEAMEYPSLDPLTQH--HVLVEVMRRAYRDRAEHLGDSDFYPVPVSQLIDPIYGQNLAKSINLSKATDSSSLGKSYGNHSGHTTHLSVIDKHGNYVS. 392
204 0.000e+00UniRef50_A0A2E4CCY1 Gamma-glutamyltransferase n=2 Tax=Rhodopirellula sp. TaxID=2024855 RepID=A0A2E4CCY1_9PLAN  ali  30  43.........LLVSCIVFLLATLAQPHDVSAQDERVEVLRSDGGIVVSDSRIASQIGRDVLLDGGNAVDAAVATAFALAVSWPEAGNIGGGGFMLVRPANGKKSVCVDYREMAPISMQKNSFTRSDTTFTQ--------KAVGVPGTVRGLALAHEKYGRLKWARLVMPACKLALQGVPIDPPLAKSLNSVQSEDKYSELKRVYKPDKSNWKAGDTLLLPDLASTLRLIAQQGPDSFYKGAIAKQLVEEMGRGDGEISLQDLDQYKAIIRPAMKGKFRGYTVLGAPPPSSGGTCIIEALNILENFNMTKLDRYDPQCIHLIAETCRRVFADRARYLGDPEHTRIP-EFLTSKKYAREVAKSIDLNKATPSITPEINVISESPDTTHFSIVDKNGMAVS. 430
205 0.000e+00UniRef50_A0A0A1NJB8 Putative Gamma-glutamyltransferase n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0A1NJB8_9FUNG  ali  31  54............................SENHTEPHLVVGHQGAVAVELKECSDAGLDILKDGGGAVDAAIASALCIGVVNSFATGIGGGGFMLIRSP-NGTFEFIDFRESAPAASHKDMFVHDP------MAAQRGGLAVGVPGEIRGFQLAHERYGKLPWKDLFASAIKVAEEGFEVTDLLYSKLLKSKTWIKEPGFAEVYAPTGVIAQPGDIIKRTKLAQTLKIIAEEGADVFYEGIIAQTIVNATQAAGGILTMEDMRNYKPLIRPTISTSYHGKKVVTCSAPTSGP-ALLSVLNIIEAYNFQKDGP-TALNIHRLIEALKFGYAFRTE-LGDPDFIHNRIEEIISKDWADYVRKNISDN.................................. 382
206 0.000e+00UniRef50_A0A1C6EJP0 Gamma-glutamyltranspeptidase n=36 Tax=root TaxID=1 RepID=A0A1C6EJP0_9CLOT  ali  33  72.........................DEDGHLTSGDRDATGKNGVVSAAKYEASQAGLEVLKAGGNAIDAAVAVAFALSVIEQNAT-------------EEGENVFIAFRGDAPSAASPDMWVVENGK-VANKANRQGGKAVTIPGEVAGLLYAFDNYGSLTLEQVMAPAINLAQNGFYVTPTLYKDMAADEKMSRFPEFYK-FLDNGELYQVGDLWKNEELADTLRIIAKNGRDGFYKGEVAEKIVEMTKKYGGILTMEDLANYQPKVSKPVEGTYRGYKILSSK---GGGTNIIEGLNILENFNMSDYDINSVERAHVLSEMFKQVYADREAYMADPFNTDVLIKGLTSKKYAKQLASKINMDY-SQDYVPGSPEDYEHEDTTHFSVADKAGNVV.. 440
207 0.000e+00UniRef50_A0A2V9JHF0 Gamma-glutamyltransferase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JHF0_9BACT  ali  33  1MMRRHLRIALLCLLVVCNAGL---------FGATRPVILGTHGVTASGHYLATLAGIRVMEQGGNAVDAGVAMVFAQNVLEPESCGFGGEVPILVYSAKDSKVHAISGQGVAPRAATIDWFKHNGFEKIPGD----GFLPAVVPAVMDALALALEHYGTMTLAQVMQPAIDLAEKGFPIGRSLQRGIGSVEDRFKSPSSARVFLSGGKAPEFGDLLVQKDIARTFQRIAKGGRDVFYKGDVARKIVRFQRETRGLLSEADLAGYQGRIEEPITVNYRGIDVYKVGPWAQSPVF-LQQLNLLEGFDLKAMHHNSADYIHTVVEASKLAFADREAYYGDPEFVSVPLRGLLSKEYAAERRRLIAPHKAS............................... 380
208 0.000e+00UniRef50_A0A2N2LX05 Gamma-glutamyltransferase n=44 Tax=cellular organisms TaxID=131567 RepID=A0A2N2LX05_9CHLR  ali  32  4.............................SFSSHRSPVYGSNGMVASSQPLATAAGLEILRTGGNAASAAVAVAAALNVTEPTSTGLGGDVFVLYYSAENKKVYALNGSGRAPLQLSLQKIKGDGLASLPP----THPYTITVPGACAAWVDFNYKFGNKNLNQVFEPAIDLAENGFPVSPITAYFWDSATRLLSKSLNGSQLLINGHAPTPGQIFKNKGLAKTLRLIAKNGKEEFYQGEISRAIISVITESGGCMESVDLTNHTSTWEEPIFIEYQGKRIWEC-PPNGQGLAALLALNILKNFDIQNMSILSAERFHLEIEAMRLAFADAWFYIADPATNPAPLDRLLSDEYARQRSSLINVHKTLDHFEHGKPPAT--SDTVYFCVVDKNGNACS. 365
209 0.000e+00UniRef50_A0A2H0Q3K1 Gamma-glutamyltransferase n=3 Tax=Bdellovibrionales TaxID=213481 RepID=A0A2H0Q3K1_9PROT  ali  35  1MKFVLALVLLTSCAQFS--NNIVTAPLAAGQTREGHEASGQKWAIATQGDAASQAGARMFALGGNAVDAAAAISFTISVERPQSTGIGGGGFLLLHGPSLEAPIAFDFREKAPLKSNSKMYLDKNGKEIKG-KSLDGIFAVGVPGLVAGVIEVHRRYGLLDLAEVLKPSIELARKGFSIYPELARAIKARSDVLSYKDSKKIFLHDGSPKIEGEVLVQEDLAKTLEVIAKKGHDGFYKGEVAQKIIQEHQRHGGLMTQKDLDIYNVKMRKPVYGSYNEFDIYSMSPPSSGGIHVIQILNTVEKDHLKTFGPQDYRSVHLISSAMQQAFADRATHLGDADFVKVPTEQLTSKHYAGKVRVKIPNDKALKEVQAGSFDFTEHDETTHFSVMDNEGLVVSS 399
210 0.000e+00UniRef50_C1B9Q4 Putative gamma-glutamyl transpeptidase n=1432 Tax=Bacteria TaxID=2 RepID=C1B9Q4_RHOOB  ali  32  64.....................ATNPEIATVYRSGMTPVSTASYAVSTANPVSTQAACEVLRDGGTAADALIVAQTVLGLVEPQSSGIGGGAFLLYYDAGQNSVEAYDGREVAPMAATENYWISDTDRTEPKPDARASGRSIGVPGVLRMLEMAHNDHGRDGWRELFDPAISLADQGLEISPRMAGQIAESAPDLADEASKAYFLPDGSPKPAGTKLTNPAMAKTLGAIAAGGADAFYTGAIAQGIVDATARTPGEMTLEDLANYQAKKRTPLCTPYRDHEICGMPNPSSGGTAVAATLGILENFDLSQYGPTTAEAVHLISEAERLAYADRDKYVADSDFVPLPLDTLLNEDYLKQRAGLIDPGRSMGTAQPGNFGPVPEHGTSHISIADKYGNVAS. 468
211 0.000e+00UniRef50_A0A151NAY9 Putative gamma-glutamyltransferase YwrD n=79 Tax=cellular organisms TaxID=131567 RepID=A0A151NAY9_ALLMI  ali  31  20.....................................VICTGGCVASNQTLATNIGLDILKKGGNAVDASVAVAAALNVTEPASTGIGGDCFCLYYDANTKQVHGLNGSGRSPRALTIEL-LKEQGFDETNPLPLLHAHNITVPGAAAGWCDAVSLYGKLSMGQILQPAIELAERGFPVAEITAYHWKHDVHVLQAPGNGKDLLIHGQAPLHGQVFCNPFLANTFKEIARCGKKGFYEGTIAAAVVETVQRHGGVMDLEDLKSHVTDEVKPIFTNYKGVNVWEI-PPNGQGITVLMALNILENFNVKEMGHNTADYLHVLIEALKLSFSDAFWFCADPQKVPVPTKESLSKTYAKGRSELIDLQRANKDYKPGNSLPA-GSDTVYFTVVDAQGSACS. 380
212 0.000e+00UniRef50_A0A2S6RFV6 Gamma-glutamyltranspeptidase n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6RFV6_9PROT  ali  33  1MMYCFKCIFILVPFCLCLITNSATPEGNVDSVGQSKISNGKKYMIVTADKRASIAAQNILDRGGSAIDAIIAAQMVLNVVEPQSSGIGGGGFLLYYDFKEKKITAFDGRERAPIKFNPNVFLKINGKKKEFIETLAGGLAVGAPSLVSMLEKAHKQYGILDWTQLFDESINYSNNGFVIGERLAKLIKKAPHLKNQSASKKYFNIENGGLIPGKKLVNKELADSLRIIRKKGSSGLLEGIIAKSILIAVNDSDGLLVNEDFSLVRPKAVHPVCADYRGWKICGMGPPSSGGITVLQILGILSNFNLNSGSIKNVEVWHLFLEASKIAYADRDYYIADDKFVKVPISEMLDKTYLKLRANQVNERAINQPVKPGNFNNSELNSTTHISIIDQFGNAAS. 421
213 0.000e+00UniRef50_A0A2A5G3P1 Gamma-glutamyltransferase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5G3P1_9GAMM  ali  28  1MNKFSYICFFIFSLFYSLQVYSQAPAENVASQAAVASA----------HPLATQAGIDILSQGGNAFDAAIAVTATLAVVEPYSSGIGGGGFYLLHQAKKNRYVMIDAREKAPLRAHKDLYLDAAGEVIPG-ASITGALSAGIPGIPAALVHLAEKYGRLKLSQSLAQAILHAREGFPVDEYYQRMAGRLKALQQNQSASEIFLQDEKVPEKDYLIVQSDLANTLELIANSGMAGFYEGELAMKMVKDVRKNGGIWTIKDLATYDIKERSPEVTVYKGMKLIAASLPSSGGLVLSEILRMLAELNIEEM--DEVQRIHHIVETMRRAYRDRAEYMGDPDFIEVPVDYLISDFHIKLLAASISRHKATSSLKAVVQPTGAGTDTTHFSILDKQGNKVS. 387
214 0.000e+00UniRef50_A0A1G4AYY5 Gamma-glutamyltranspeptidase n=2 Tax=Ascomycota TaxID=4890 RepID=A0A1G4AYY5_9PEZI  ali  29  1MKFSLTSAALAQLLLGITTQPALAAPHESTIP--------KLGAVASESAICSKVGTDLLELGGNAADATVGTVICVGVVSMYHSSIAGGGFMLVRS-RTGEYEFIDFREKAPRAAEEDMYKDDP------DASMYGGLASGVPGELRGLERLH-RYGKLDWSEVLKPAIKLARDGWPVNHDLIRYMNNNSFLTNDPSWAIDFAPHGTLLKLGDIITRKRYAETLQKIADNGADAFYNGPIAKATIDALTKSKGIMTLEDLRDYKVAIRDPAQISYRGYKLTACNAP-SGGIVALSALNIVEGYKGFGDPAERNTTVHRLDEAMRFAYGQRTK-LGDPFHVNDYTKNMISPETGAKIRSKISDSRTF-DVSYYNPEGVENHGTSQIAVADASGMAIS. 388
215 0.000e+00UniRef50_A0A2H6GKB1 Gamma-glutamyltranspeptidase n=20 Tax=cellular organisms TaxID=131567 RepID=A0A2H6GKB1_9BACT  ali  33  14........................APSRPEDFTTRPVIMGTHGMVTSGHYLASRIGIRILEDGGNAIDAGVAMGFALAVLEPYIYGIGGEVPILIYLAEEKRVLSLCGQGAAPMNATIEWFRKNGYDAVPGD----GLPAAVVPDAVSTWISALALFGTMRLSQVLEPSIELADRGFPMYGVLQAALRQNLQRFNDPTSAENFLPDGRVPTIGEVYRQPDIAGMFKTLGKSGRDVFYRGEIAERIVKFVQETAGLLTKEDLLRHTMRVEEPVSTTYREYEVFKCGPWTQGPVF-LQQLNLLEGYDLSSMGQNSPEYIHLLTEVAKLAFADREKYYGDPDFVHVPLNILLDKGYSAKRRKLIDPDHASMDLRPGNAASSRPGDTTHLDAVDQWGNMI.. 418
216 0.000e+00UniRef50_A0A1G3HTK1 Gamma-glutamyltransferase n=1 Tax=Rhodocyclales bacterium RIFCSPLOWO2_02_FULL_63_24 TaxID=1802018 RepID=A0A1G3HTK1_9RHOO  ali  36  19........................QPEAASGFVPRPAVVSREFMAVTANAYATAAAVEILQLGGNALDATIAAQWVLNLVEPQSSGIGGGGFMLHWDAKRRRVSAWDGRETAPRSASADFARRADGSLASFSEVLATGRAVGAPGLVAMLDAAHRRHGRLKWERLLRPAIRLAENGFAVSPRLHLLLRDDPWLRQDKAARALYYASGEARRPGEILRNPELAATLRAVAETGLRALQRGALAEPIANAVRARGGSLSVADMDDYQPRQRDAVCGLYRAWRICGMPPPSSGGIGVLQLLGVLERSGLPAGDPASPEAAHLFAEAGRLTYADRARYLADPDFVSVPQRALLQAEYLQRRASLIDPRHSMGDAPPGELPAPELPATTHISVVDAAGNAI.. 400
217 0.000e+00UniRef50_A0A2E8B8F4 Gamma-glutamyltransferase n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E8B8F4_9CHLR  ali  30  1.................MTTSNWRSRAGTTFQTEKRAASGSRGMVVSNHPLGSAAGSEMLLAGGNAIDAAIAALFALSVVEPMMVGIFGAGHMNLRLA-NGEQHVIDGYATAPAASTEDMYTGPDYLKSVDNASSMGYLSIGVPGNLKAWTEALETWGTLPLXXVMEPAIRFAARGFEASAYLHETIXQMQDXIRFPETAATYMPGGVALQPGELVDRSDYARTLQTIAVRGSDHLYNGPLGEIVCDYLGRNGGIITMQDLGDYKTVRRKPVKAEXRGYDLFAPPPPSAAGVHIAEMLNILEEFEVXKMGFGTADSIHLLLESMKKAFADRNRYTGXPDYVEVPVDRLIAKHHVEGFIDXLDMDKASPEIDPG---SNEPDHTTHITVADMDGNIV.. 381
218 0.000e+00UniRef50_A0A2A2II06 Gamma-glutamyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2A2II06_9BACI  ali  29  8...........................SSPYPVTRNATYAKKGMVATSQPLASQAGLDILKKGGNAIDAAIATAACLTVVEPTSNGIGGDAFALVWTKD--KLHGLNASGRSPKNISIEAVKKAGYEEIP----AHGWIPVTVPGAPGAWAELSKKFGKLPLTEVLEPAITYASEGFPVSPTLSKYWKKGYNSFKYENWFKTFAPNDRAPKAGEIWSSPDHAKTLQSIAETNGESFYRGELAEKIAAFSKENGGFLTAEDLAEHKTDWVDPISVNYRGYDVWEI-PPNGQGIVALQALNILKGFEFTE--KESVETYHKQIEAIKLAFADGQAHVTEEGNMKYRSDDILSDVYAETRRKLISEEALQP--EAGEPT---GSGTVYLATADSEGNMVS. 370
219 0.000e+00UniRef50_A0A1X2J1B2 Gamma-glutamyltransferase n=9 Tax=Mucorales TaxID=4827 RepID=A0A1X2J1B2_9FUNG  ali  30  36................SSNTARSTANASRQPSFQGHLVSGTHGAVAVETQECSDVGVEILRQGGNAVDSAIASALCIGV----MSNFATGGFMLIRSP-NGEYEFIDYRETAPQGSDKDMYRDDPL------LAQRGGLAIGVPGEIRGFELAHKRHGVLPWAKLFSPAIKIAREGFTANDYLYEKLMRAESLLEDDEFSKIYAPTGTLAKPGDIIKRPTLANTLEIIAQEGPDAFYTGHIAESIIETVQAAGGIMTLDDLRGYEPIIRPTISTYYHGKKITTCTAPTSGPI-LLSILNILEQYPLHALGRIGV-NVHRLVESMKFGFAFRTEF-GDPEFTEDRYQEITTKQWADKARANISDTET-HSPLYYQPDHIDAHGTMHLTVVDENDGVV.. 414
220 0.000e+00UniRef50_A0A154W518 Gamma-glutamyltransferase n=2 Tax=Oceanibaculum pacificum TaxID=580166 RepID=A0A154W518_9PROT  ali  31  5.......................RTRAGTDFACEKTPVTAARGMAVTNHPLASAAAVEMLAMGGNAIDASIAALFALTVVEPMMVGIYGGGTALIRLADGRETI-IDGLATAPAGAKPDSYTPPTYMETEGRRNRVGASAVPVPGNLKAWCEALERFGNLTLDQVMEPAIRHAARGFRVTPYLAACIAETAEDLADETIAAMFLPGGKPLPEGALLVQADYAETLRAIAQHGPGHLYGGALGEKVAGYLRSAGSYVSLDDLKHYSTVERTPVRTNYRGVDIVGVAPPCTGGVHIAQMLNLLEAFDVRAMGFGTAETMHLMLEALKIAAVDRRATTADPAFVDVPVERLISKTYADLRRPEIRPDRA--SAYEARILEVESANTTHVTIADGDGNIV.. 380
221 0.000e+00UniRef50_A0A2H5YDH4 Gamma-glutamyltranspeptidase n=1 Tax=bacterium HR23 TaxID=2035418 RepID=A0A2H5YDH4_9BACT  ali  27  2.........................................KGVVSAPQVEAVEVARHIFQEGGNAIDAAVAVAFAQGVVDPQMTSLGGWGVALVYHAPTGQHLALDFCGRAPLKATPDMWASRVKRRLRFDLNEVGYQAITVPGNLAGYWELHRRFGKLPWQQVVAPAIALAEEGFLIPGELAALWRRAEILTATPASARLFTKDGRPYEAGEHFRNPDYANTLREIAQHGPQVFYEGWIAQKITEDFARNGGLLTLEDFKAYRVKVLPPVESTYRGIRITGTPPPTSS-VQVMEILNILEGFDPRDIPFGSPTYAWAMALAQKASFVDRALYLGDPDFQRVPVDLFLSKEHAGQWREKVLRN--IPFEVPGGPVA-EPAHTTTVSAMDDEGNAV.. 369
222 0.000e+00UniRef50_UPI00077AD235 gamma-glutamyltranspeptidase 1-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077AD235  ali  32  66.......................................YRHAAVASDNAECSKVGRNILKKGGSAVDAAVATTLCVGVINMHSTGIGGGGFMMVYDSHKRSAEMIDFRETAPEKSDVD---SLDGDPMNG---IRGGLAVAVPGELKGLETAWKKYGKLPWKELFKPAINIAKKGFIIPETVEIAMNIWKDLLKDTTFRRVFTRNGKLLRKGDRLRRPHLAKTLQFIARAGAEPFYNGPMSEAIVKEVQAAGGMLTLDDLKNYEAVSRPALKSKLDDMTLLSSPAPTSGPV-LAMILNILDGFKMKDLEENPVRTYHRIIETFKFAYKYRS-LLGDPVYVNETVKEMMSTKLADELRHLITDNETHPHDYYGTPDVPIKTGTTHLSVLAANGDAVS. 424
223 0.000e+00UniRef50_D1CEM9 Gamma-glutamyltransferase n=2 Tax=Thermobaculum TaxID=262406 RepID=D1CEM9_THET1  ali  29  14........................PISDLPFHSFERISMGLRGVVCTSNPLASDAAMWALKDGGNAFDAALAAAAVLTVVEPQSSHLGGDVFLVAYVAKENKVYALNGSGRAPREIDISAFA--------GGIPERGPLAATIPGAVHGWCEVSRRWGKLPLKRVLQPAIEYARDGFPISVRLARSISTLASIISSPYARQQFLSID--PKPGNILRQPALARTLESIADRGVDGFYQGEIAKEMVRGIREQCGVFSEDDLREHDTIVVVPISTSYRGVKVLE-QPPVSQGHILLEELNIVENFDLKSMGLLSADTLHVLIEAKKLAFADKARYLGDPEFSKIPVEELVSKEWGRRRAEEINLSRANPQPEFGHL-GRSNTDTTYLAVADSEGNAVS. 375
224 0.000e+00UniRef50_A0A1U8MTW0 gamma-glutamyltranspeptidase 1-like n=24 Tax=Pentapetalae TaxID=1437201 RepID=A0A1U8MTW0_GOSHI  ali  29  14....LWITISLLFFLVSPATSTEVDGAIASTKQRREQIVARQGAVAADDGRCSTIGMNILWNGGHAVDAAVAASLCLGVVSPGSSGIGGGAFMLIREA-NGKAQVFDMRETAPMKASQNMYAGNA------SLKANGGLSIGVPGQLAGLHKAWKQHGKLPWKRLVKPAESLARKGFKVSPYLQMQMESSKAIMADKGLREVFTSNGELLKVGDICYNKKLARTLRKISVYGVQAFYNGSIGFNLVRDVQKAGGILTLTDLKKYEVKMREPITANVLGLKILSMPPPSSGGVSMTLILNILAQYAIPT-GLTGSLGTHRLIEALKHAFAVRM-NLGDPDFVNVSVADMLSPKFAQELKKTIHDNMTFGPKYYGGRWNIDDHGTSHVSIVDTNRNAV.. 400
225 0.000e+00UniRef50_E3HR37 Gamma-glutamyltransferase 2 n=2974 Tax=root TaxID=1 RepID=E3HR37_ACHXA  ali  31  9.............................PYPSVRIPLFARN-VVSTSHPLAAQAGLRMLLKGGNAVDAAIAAAATIVLVEPVSCGLGGDCFAIVWDGK--ELHGLNSSGVAPAAWSTEYFKRKHGVGADGLAPKRGWDAVTVPGVVAGWAALHEKLGKLPFEQLFEPAIEIAERGYAVPPVVAHKWAAAAEELKQPGYAQAFLPEGRAPKVGEHFRFPDAANTLRRIAAKGRD-FYEGELAERIAAFSQECGGAMTLEDLRNYRPEWVKPISKSYRGYELHEI-PPNGQGIAALIALGIVERFDMADIPVDSVQSQHIQIEAMKLAFADLYKYVADPRSMQVTPEQMLSDAYLDSRAKLIRLDRATHF-EAGRPHA---GGTIYLTAADENGMMIS. 371
226 0.000e+00UniRef50_F0SJ07 Gamma-glutamyltransferase n=4 Tax=Planctomycetaceae TaxID=126 RepID=F0SJ07_RUBBR  ali  33  36.............................PNRPRPDVAESANGMVVSQTPLASEVGRDILEAGGNAVDASIAVAFALAVTWPEAGNIAGGGFMMVAPVDSD-VVCIEYRETAPVAVNADSFV--------GWANRKHPRMAGVPGTVRGMQLAHIKFGSLPWKDLVSPSVKLARNGFVVDEQLAYSLNAALHKQAQTEFRRVFQPDG--WKAGEKLTQPDLAETLEQIATSGADAFYEGPIAEKLVASMKKHDGLITAADLEDYNATLRKPVRGNIAGYDFFGAPLPSSGGTTVLMQLTMLEALGLKRADEWTTEHLHLISEAMKRGFRERAKWLGDTDYVAIPV-RLQQQKFARSLASRINPERATPSEDPLTAGPYESMETTHFSVIDADGMGVS. 407
227 0.000e+00UniRef50_A0A1I5KSV4 Gamma-glutamyltransferase 1. Threonine peptidase. MEROPS family T03 n=1 Tax=Erythrobacter nanhaisediminis TaxID=604088 RepID=A0A1  ali  34  1MRNIFVTSLASLALAGCATYPAPAPQDTVATVPA--------GAVSAADPRAQEAGEAILAKGGSATDAAIAVMLALTVVEPQSSGIGGGGF-LVRGEADGDVTTFDGRETAPAAATPDWFLDDEGNVPPFMQSVRSGLSVGVPGNIALAAKAHAAHGKLAWSELFGPAIELAREGFQINPRMHDALGRSKDRAAHTEARALYYDTGEPLPVGTLVQNEALARTFESLASGGREAFYSGDTPK---------PGAMTYEDIAGYEAKERNAVCSSYRTYRICSMGPPTSGGVAVQQMLLQLERFDLASLGADNPVTWHLFLESQRLAYADREIYLADTDFVSVPVEGLLDRTYLAGRSALISPQESLAEAKAGTPPGPEEHGTSHFAVVDSENTMVS. 403
228 0.000e+00UniRef50_A0A0E0FGA3 Uncharacterized protein n=1 Tax=Oryza nivara TaxID=4536 RepID=A0A0E0FGA3_ORYNI  ali  29  72...................................HEVEAGVGAVATDDGRCSEVGAAALRAGGHAVDATVAATLCLGVVHPMSSGVGGGAFIVARDAASGDAVAFDARETAPAAATPDMYAGNPTSKYK------GALAMGIPGELAGLHAAWSRYGRLPWKDLFAPAIKLARDGFTVVPYLEIALKKERDVLADPGLRAVLAPEGRILAAGEVCRNPALADTLEAIASGGVEAFYGGAVGERFVADVRRAGGIATVDDLRAYKVEVSDAMRSDAMGYTFLGMPPPSSGGVGVALILNILSGY--KSLEFKGFLGLHRFIEAFKHMLAIRMD-LGDPDYVNITVSEMLSPAFADKLRQRIVDNTTFPPSYYFPKWSLDDHGTSHLCVVDGDRNAV.. 428
229 0.000e+00UniRef50_A0A257J9K8 Gamma-glutamyltransferase n=1 Tax=Alphaproteobacteria bacterium PA2 TaxID=2015570 RepID=A0A257J9K8_9PROT  ali  36  1...........................................MVAAANPLAVEAGLNVLRRGGSAVDAAVAVQAALGLVEPQSSGLGGGSFMTYYDAKTRKVVAFNGREKAPMGASSDMFMGPDGKPLPFVTAVVSGRATGVPGAVAMLHMAQSRYGKLPWSTLFVDSERMADQGFIVSPRLAMMASSPFPQANQPDAVAYFTPDGKKIQAGDLLRNPAYAATVRKIAAEGPRALLEGSIAEAIVKRTSEGPGTMTLADLKAYKPMMTEALCRPYRIYVVCTPPAP-SGGPAVLEGLGLLENTDIASHGPTTVEGWYLFSQASRLMYADRDRYFGDPDFVDVPVAGLLDPAYLKARAALINPDKAGAPPMAGNPKGAEPGGTTHFVIVDAAGNTVS. 365
230 0.000e+00UniRef50_A0A1X7G052 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=25 Tax=Bacteria TaxID=2 RepID=A0A1X7G052_9SPHN  ali  35  4.RILPAFAAAALMLGGCASPAVSEARPAATASA--------KGMVSAADPRAAAAGAEILRKGGSAADAAIATAIALTVVEPQSSGIGGGGFLVYHDARAGGLSTYDGRETAPAAATPQLFLDAAGKPMPFREAVPGGKSVGVPGNFRMFALAHEQHGRLPWAALFEPAIRLARDGFDVTPRMREMIASRTDHVGMTGGRDQLLDSGAAKAVGTRIRNPDLAALLESVAKRGPDYFYTGAPAEALVRTVAKNPSAMTMGDMASYDAKERDVLCGTYRGYRICGMGPPSSGATTVFAILKQLERFDLKALGKDSPEAWHLIAESMRLAYADREAYLGDPDFVRVPVAGLMDPAYLAGRSALISADKAMAEARAGTPAGAPEAGTSHLAAVDRDGNVAS. 405
231 0.000e+00UniRef50_A0A220WAT9 Gamma-glutamyltranspeptidase n=5 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A220WAT9_9SPHN  ali  32  25.MKISRLIVAAAAFLTASCAPTGQTEPAIVSAPAASAPQQEVPFVIAANPLAAKAGQDVLKRGGSAIDAAIAVQAMLSLVEPQSSGLGGGAFLTYLDGASGKLTIYDGRETAPAQASTSMFLGPDGKPLGYREAVTSGRATGVPGAVAMLAMVHEEHGALDWSSLFSAAERTAEQGFVISPRLGRFLGIPFPQLSTPDATAYFANDGERKTTGDRLKNPEYADFVRRLAANGPEALYGGSTAAKIVAKTRAAPGRMTMADLAGYKPVKREALCNPYRVYLVCVPPPPSS-GVALLQLLAMLENTDIAMRGPDDAQAWFLFAEASRLMYADRDQYVGDPAFASVPVKGLLEPAYVASRAALIGKSAASSPPEAGTPRGAEPAGTSHFIVRDAQGNVVS. 431
232 0.000e+00UniRef50_A0A2D7LZL1 Gamma-glutamyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2D7LZL1_9BACT  ali  32  13.........................................KGMVAAAEGEAARVGRDLLNAGGNAIDAAVGVGFALAVTYPAAGNLGGGGFLVARENSKRTSVALDFRERAPFAATETMYSDAD-DRGQKEASLTGHLAAGVPGSVDGLLQALQAWGSLPREQVIAPAIRLARDGFVMTDRTHRMLNSTKTRERYRASSELFYPEGSAFPAGTIFRQPELANTLELIAKKGRAGFYEGEVADHLLTEMKRGGGIIRPRDLEEYRSIERDPVKFKTKGYAI-TMPPPSSGGICLAQIQRLMRDFSIKTSEVGSPRHLHLMAECMRRSFADRNEYLGDPDFIDCQMDLLLSESHLEKMARSIDPLKATSSKSSDESLPKESEQTTHYSVVDRHGNGV.. 374
233 0.000e+00UniRef50_H3RKP5 Gamma-glutamyltranspeptidase n=1 Tax=Pantoea stewartii subsp. stewartii DC283 TaxID=660596 RepID=H3RKP5_PANSE  ali  34  1MLRNILFIFLLTSGVITAGQVEAASA---------PAIEARHGMVVSSQAIASQVGIDILKQGGNAIDAAVAVGYAQAVVNPCCGNIGGGGFMLIHLAD-GKDTFINFRETAPAAARADMYLDPQGK-VRSDASLHGYSAVAVPGTVMGLDYAQRHYGKLSRQQVMAPAIRLARQGFILTRADTDILDTTVNRFRDAQAARWFLPDGSPLQPGDNLKQPELAETLSHISQSGTDYFYKQPIPQRVEAAVAKGGAIITSADFVRYHVTESAPLRCHYRGYEFISSPPPSSGGVALCEMVNILSGYDIRALGFNSADSVHVMTEAMRIAYFDRNNSLGDPEFIHNPLDKLLSTSYA............................................ 345
234 0.000e+00UniRef50_A0A2D8QFW9 Gamma-glutamyltransferase (Fragment) n=1 Tax=Tistrella sp. TaxID=2024861 RepID=A0A2D8QFW9_9PROT  ali  34  32.............AGPSMTDGRAAPEAATGRAASRGPVATRQMMVVAAHPLAVDAGRAVLEDGGSAADAAITVQLMLGLLEPQSSGIGGGAFVLYHDAAAGRLTTLDARETAPAAAGPDLFLTPDGSPMGFRDAVPGGRSVGVPGVPALLFAMHERWGRLPLARLFQPAIALAEAGVPVSPRLAGLLADSASLRKDPRALAHFMPGGQPPAPGTLLPNPDYADTLRALLTDGAAAFYAGPIGADLVAARADNPGRIAEADLAAYRVVERPPVCVPYHAHDVCGMGPPSSGGLAIGQIMGLLDRHPLPKQGPLALTNIHLLAEASKLAFADRDRWVADPDHVPVPVAGLINPVYLDTRARTIEPGKALPVP............................ 395
235 0.000e+00UniRef50_A0A0U3NNA8 Gamma-glutamyltranspeptidase n=3 Tax=Lactobacillales TaxID=186826 RepID=A0A0U3NNA8_9LACT  ali  29  4........................DPNLFHYASRRNLVYGHKGMIGSASPLASQAGLEILKKGGNAIDAAIATSAALTVVEPSGNGIGGDAFVLVWF--EGQMYGLNASGAAPDLMTSESIVKKGYQEI----SKFGLDPVSVPGLPSGWVALSEKFGNLPLTEVLEPAAKIAEEGFPVASNVARLWKRYYKILKDYPWFDVFCPDDRPVEAGEMWSSEGHAKALREIANTNGESFYRGKIADEIDAFSREHGGYIRKEDLEKHQVEWVDPISTNYRGYDVWEL-PPNGIGVIVLMALNILENLELK--GKDDIETYHKQIEAIKLAFSDGLEHIADPKAMKVELEAMLSKEYAKERSELIGEEALTPA-----PGELDKSGTVYFATADKDGNMVS. 370
236 0.000e+00UniRef50_A0A2A5AT09 Gamma-glutamyltransferase n=2 Tax=SAR86 cluster bacterium TaxID=2030880 RepID=A0A2A5AT09_9GAMM  ali  32  53.......................GSRGQGWLGQGRSEVIARHGMVATSDPLAAQAGLEILRAGGNAIDAAVAAAAVLDVTSQNDTGIAGDLFALVWSAQDKKLYALNSAGWAPAGWTPEYFKQELGVE---RVPGTGVNAATVPGAISGYDALLNRFGTMGFRQTFARAVQLAEEGWGQAERRHRDLASVKDKLNDDDSRAVFLNDGEVPALYSIIRNPDLADALRLIQKQGRDAFYKGAIADAIVAKMQADGGVMTHEDLAEFESEWIEPITTNYHGYDIFQLPPP-GQGFAALEMLNILESVNLSALGPSNPDYWHFMVEAKKLAYSDLQAYNGDPLFSDIPVDTLLSKSYAATLCDRIDMDVASEPSVTGGL----NGGTIYLTTADRWGNMVS. 425
237 0.000e+00UniRef50_A0A259DFF0 Gamma-glutamyltranspeptidase (Fragment) n=1 Tax=Hydrogenophilales bacterium 17-62-8 TaxID=1970525 RepID=A0A259DFF0_9PROT  ali  42  24.MFVFHCARVLVLCLFSASALAASPD----------------GVVAVSHPAAAAAGARMLAQGGNAIDAAAAVQFALNVVEPQSSGIGGGGFMLVYLAKTGKTVVVDSRERAPANARADLF-APDGLPLPFAQASTSGIAVGVPGTLRGVDLALRRWGTKPLSATLAPAIELAGHGFRVNRFLAEDIVNDGGRTQQPETAAIFRPGGVPLAEGDWLVQADLARTLKRIATRGADAFYRGPLARAIVQAQHRGRGQMTLADLARYRPTVREPLIGHYRGWTLAGMPPPSSGGLTVLQMLGMLERFPLGGYGFGSPKTLHLMIEAMRLAFADRAVWIGDDDFVPVPRKGLLNPAYLA........................................... 373
238 0.000e+00UniRef50_A0A135VCI7 Uncharacterized protein n=1 Tax=Candidatus Thorarchaeota archaeon SMTZ1-45 TaxID=1706444 RepID=A0A135VCI7_9ARCH  ali  31  11...............................PTCRSDVIARDGVVASSQPLATQAGLEIIRKGGNAVDAAVAVAAVLDVVEPFSTGCGGDAFVLIHLSGSSRPLSYNGSGRSGSLVSLQELLDLGWTSIPAR----GGPPVTVPGALHLWCYVVEKHGALEMKDILAPAIHYARNGFPVSPIIAQDWRGIIRVLKNDSAREIYAPNGKVPIKGQVMNNPDLANTFERIIEDGPSAFYSGKIAESIVNTVQKHGGFLTMEDLAAHKTTLTKPISVSYRGIDVFE-HPPNSQGFAALSMLNIMETFDFSEFTPLSTERYHLMIEAKKLAYADLHQHNADPTFYDIPLKKLLSKSYARNRAKMIDANHAMTVYAPGLLL---GQDTAYFATADRAGNAVS. 368
239 0.000e+00UniRef50_I0HVQ2 Gamma-glutamyltranspeptidase Ggt n=14 Tax=Bacteria TaxID=2 RepID=I0HVQ2_RUBGI  ali  36  1MRFAPRAGVAALAVLLLSPPAFARDTSQPAPRAEAAKVQGKRGVVSTANPYAAEAGARVLGWGGNAVDAAVAIAYALNVVEPQSAGIGGGGFMMVHLVETGETFVLDSRETAPAGATPDMFVG-----VPNPSLQ--GVAVGVPGMVRGTAWALEHWGRLKLGQVMLPAIRLASQGFEATPRYVSASCNSRAR-NSPEAEAFFCPGGVPPAVGQLIRNEPLAETLRLIATRGPDCFYGCDIAKGIVEGQKSKGGSMSYADLQGYQPALRVPVEGRYRGWKLKSMPPPSSGGLTILQMLAMIERFPIGGWGFGEPKTVQTMVETMRVAFADRAVWAGDEDFVHVPAAGLLDPEYVAQRSALIVPGRAQPDPTAGDPRPYDGPGTTHFSVVDRWGNMVS. 431
240 0.000e+00UniRef50_A0A2E4WK73 Gamma-glutamyltransferase n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E4WK73_9BACT  ali  29  36.KRIQFLFFSTLALFHCAKDNIELYSYEKSMGENIEEAIGSNGVVSSVHPLASDIGINILKVGGNAIDAAIATGLALGVVDQSNCGLGGGAFIVMRLAD-GTVHTIDGREMAPEKADRNMYIQNG--TVNSEISKTGPLAVAVPGVPAAYVKALELAGTLTIKELAQPAINLAKTGFILDQAYLDRYKGAINELRDSASAAIYFHNNSELAVGDVFKQPLLAETYEKFAERGVAYFYKGDFADRLESFMVQNGGLITKKDMENYQAIERPPIIGNYKDYQIYGMGPPSSGGVHVVQILNMIEASGLQNKNKWDEESMYFVSQFMNRAFQDRANHLGDGDFYPVPVNRLISKSYAEILVDEITSKAVLAPPIEGFSLNYGQGHTTNFAVVDKWGNAVS. 431
241 0.000e+00UniRef50_C8PQX0 Putative gamma-glutamyltransferase n=1 Tax=Treponema vincentii ATCC 35580 TaxID=596324 RepID=C8PQX0_9SPIO  ali  39  61.....................................ATGKIGVVSTSKVEASRIGAEILRKGGNAIDAAVAAGFALGVVEPNSSGLGGGGFMLIRIAKTGETVFIDFRERAPQKSSPEMWTVGTDGKVVGNQKLEGGKAAAVPGEVAGLLYALENYGTMTREQVIRPAANLAKNGFYVTPTLSNDMKSQFDKLKYPESAKVFLKEGLPYEVDDIFTNPDMAKTLDIIIKNGKDGFYKGEVAEAIVKTLNKYDGLYTMEDLANYKPLVRQPVKGTYRGYEIISSPSPSSGGAIVIEILNILENFDVGSLKVNSPEYLHLFSEAYKLAYADRAKYMGDSDYTPVPMKGFVSKK.............................................. 377
242 0.000e+00UniRef50_A0A2W4KEC1 Gamma-glutamyltransferase (Fragment) n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4KEC1_9FIRM  ali  35  4...........................PALTSDPGRPVWARNGMVAAGQPLAAAVGLHVLARGGNAVDAALAMAAVTAVTMPEMCGLGGDAFALVYDARTRTVTAFNGSGPAPAAATVERYRAAGYREMPFE----GWWSVAVPGAVGVYLEMHARFGSLPLSELWEPAIRYAREGFPIDARLAANIAAGAEKLRDPEAAAIYLAAGPEPRPGTILRNPDLAASFEAILTDGADAFYRGQLARAIGDASQAAGGLLTPDDMAAFETEVYRPLVTTYRGYRVYETAPP-SQGLILLEMLNLLEGFDLTGRSPTDPEVVHLLVEIKKLAFADRNAYLGDPAFVRAPVAELLSKEYAARRRRDIDPNRANNAPVAGDP----HGDTTSFVAVDAEGNAVS. 365
243 0.000e+00UniRef50_A0A2G5BKI1 Gamma-glutamyltranspeptidase 1 n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5BKI1_COERN  ali  32  57.RRIPXXXXXXXXXXXXXXXXXXXXXXXXGAQDSSTLITAKHGAIATDEPRCSAIGADMLREGGNAIDAAVAGALCIGVLQAHSSGIGGGGFMLVRLPHGKRPVLIDFRETAGSAATTDMFINN------ITAARIGGLSVGIPGEIAGLYNAHSRFGKLPWHRLFEPSIKLARYGYALNADVYKYLSMKQHILDSPGFNTTFTDGGQLLEPGDTVRRPELADTLETIAHKGPLAFYRGSIAHSLVQTIQSHNGILTLDDFAGYEAVSREPIETYYHGRKVITGSAPTSGSI-LLNMLNVAEGFILGVDGP-TALNYHRMVETMKYGAAQRT-LLGDPSFVDIDTQILISKDFATEIRANISDIQTF-NVSHYDPEYLENHGTTHISVVDADEMAV.. 447
244 0.000e+00UniRef50_A0A2E2ZMM9 Gamma-glutamyltransferase n=7 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E2ZMM9_9CHLR  ali  31  5................................TRKQSLTSSQAMVTSNHPLASSVGLSILAAGGNAFDAASGTAFALSVVEPMMVGPFGGGFTNFYIPNQG-FFTIDGYASAPGKSSETMFNPSGLFEVEDKLNQNGYLAVATPGNLQVWSHLVEKFGKFSLKDVISPAIQIARNGFQVSDYLSNNIRDNTELLKHSESSSIYLPNGEIPQKGDIIKNPNFALVLEGIANNGSAYLYEGELGQHVEDEMLDNGGLISLDDLRRQKFFYRNPVIGTYQDLQIHSVGPVSSGGICLIQMLNILENFDLQKYSITDPQRIHILSEVFKIVFADRYEYIGDPEYVKIPVDGLISKKYALERSKEINLQRAQSYEFTHNFKLNDSENTTHFNVADSEGNIVS. 376
245 0.000e+00UniRef50_A0A2E1CYK7 Gamma-glutamyltransferase n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E1CYK7_9PROT  ali  32  12................LSISPLSAVFQIILFFLFSEPAYA--GAVVTANPXATKVGMDILKKGGNVVDAGVGIQYVLGLVEPQSSGLGGGSFAIFYHKKSDELYAIDGREKAPKRIPYNFFEQYRGSRQGFFRLVTNPASVGVPGTPLLLEEMHARFGQLGWSELHDEPITLAAEGFPXSPRLHXLVARDKFLKNNVDXKKYFFDNLIPKNVGIILKNPSYADVLTQFRDEGISTFYKGKIMSNILSDLKKTAGFLHPDDFENYSVXFRKPLCGSYRNFRVCSMGPPSSGAITILQILGILENYELAKFEKNSPELIHLISEATYLSFLDRNSYLGDPDFVNIPIAQMLDKNYLKQRARLISLFEKIEHASPGKFKNYTDHSTTHFVITDKWGNALS. 406
246 0.000e+00UniRef50_UPI000693662A gamma-glutamyltransferase n=1 Tax=Oceanobacillus jeddahense TaxID=1462527 RepID=UPI000693662A  ali  31  24................................TGRPVAEGRNGAVTSPHYLATQTGKRILDQGGHAVEAAIAVNAVLCVVIPHMAGLGGDLFALVWDEKEKEVKSLNGSGKSGNQVTREVYKQQELKEIPER----GPLAATIPGTVDGWWELHQQYGKLKWGALFEDAIHYAENGFPITDRVSSYIQEKADLLSYSTTKKIFFKNDRPILTGELLVQTDLAWAFKQLSKSGRDAFYDGEITDKIIAAMEKHGGLLVKEDFRNHTVEWDRPLSSSYRGYDIYQVK-PNTQGIAVLMMLNMLEKNDLVSIGDGTPDYYHLMAETAKLKFRFRDEWVTDLESIDLPYDKLLSKSLSEEVYGHFSWEEVNRLENLEELPEVDHGDTAYLSVVDKEGNSIS. 386
247 0.000e+00UniRef50_A0A2A2SF13 Gamma-glutamyltransferase n=1 Tax=Sphingomonas sp. 1PNM-20 TaxID=1141887 RepID=A0A2A2SF13_9SPHN  ali  37  24.............................................TSADPRASQAGQEILRAGGSAADAALAMMLALTVVEPQSSGIGGGGFILHHDAKARKLQTIDGRETAPAAATPQRFLGPDGKPMPYRQAVLSGRSVGVPGNVRLMAMAHRKWGKLAWPRLFEPAIRLADGGFQVTAPLARSAQLAPAWGDFPAIRAIYAPDGKPVAEGSTLRNPALAALLRRIAAEGPDAFYNGPNAQALVAAVNAAPGDMTAADFAAYRAKERPPVCGRYRMWRICGMGPPSSGATTVLGILGMLERFDLKALGPNNAQSWHLIAEAMQLAYADREKYLGDADFVAVPVRGLVDRGYLQRRSRLISPLRALGAYPAGNPPGAEPAGTTHFIAVDAAGNV... 386
248 0.000e+00UniRef50_A0A158M7G8 Gamma-glutamyltranspeptidase n=3 Tax=Bacteria TaxID=2 RepID=A0A158M7G8_9BORD  ali  29  8.............................PYASRKMPVLAAN-TVATSQPLAAQAGLRMMLAGGNAVDSAIATAIALTVVEPVMNGIGGDMFTLVWH--EGRLYGLNSSGRSPAAWTPEYFAGRD------TMPPSGWGTVTVPGQVAGWKALHERFGKLPFAQLFEPAIEYAERGFAVSPTIARQWATQAPKLAHPGFAQAFLPEGKTPQAGQWWRFPEQGRTLRDIAETGGESFYRGALAAKIAAFARETGGALTADDLAAHQPQWVEPISQGFRDYRLHEI-PPNGQGISALIALGLLEHFDLEGMGCDSADYYHVSIEAMKLAFADLHHHVADPEHMRMDAAALLDPAYLSERARLIRMDKAV-TPLAGAPKT---GGTVYLTAADAQGTMVS. 362
249 0.000e+00UniRef50_S3MX17 Gamma-glutamyltransferase n=1 Tax=Acinetobacter rudis CIP 110305 TaxID=421052 RepID=S3MX17_9GAMM  ali  34  67........................PEPASGYRAGLQPQYASRYMAVANSPLATQAGCEILAAGGSAIDAVIAVQAVLGLVEPQSSSIAGSAFMLYYDAKTKKVSSYDGRETAPAAATPYYLQADPHAAAPLPSARRSGRSIGVPGVMKMLEMAHDEHGQLPWRGLFNRAIFLSKKGFVVPNRLADAIVTNSKELQQNAVQTYFKPSGQPYRVGEIMTNRPYASSLTQIAKKGAQAMYSGAMAANIIAKAGQTPSLMTLNDLSNYKAIKREAICATYREYYVCTMPPPSSGGIAVLQTLGILENFDLKAYPPKHVMAVHLISEAERLAYADRDKYVADPDFVPLPGQGLLDKNYLKQRAGLINLDRSMGVAKAGEFKTAPERGTTQITVVDTYGN.... 474
250 0.000e+00UniRef50_A0A1S8VJV8 Gamma-glutamyltransferase n=5 Tax=Chytridiomycetes TaxID=451435 RepID=A0A1S8VJV8_9FUNG  ali  30  25....IVVSMLATTVVANFFMNLQTPITLLDIGRNSGLVSARHGVVSTEHPICSQIGVQVLRENGTAVDAAVASSLCIGVTNMYSSGIGGGGFMIVRS-TNGKSEFINFREKAPAAATTNMFADDPMK------AQTGGLAVAVPGELSGLFMAHQRHGRLPWRRLVQPAVDLARDGWVVNAILEQRMQVVRDLLTNPDFSKDFAPDGELLRTGQIIKRPNLARTLDAIATEGIDVFYRGWIAEALVKVTQETGGILTMADMAAYHPTVGSPMIGSFRGKRVITSPPPTSGPV-LLSVLNLLEGYDLSS---PSPLNAHLLVESWKYGYAQRS-YYGDPRNISEIANRNIDKATSDHIRQGIFPDRTFEPGHYAAAYDLNDHGTMHLSILTEQGEAVS. 412
251 0.000e+00UniRef50_A0A168RJV6 Uncharacterized protein n=4 Tax=Fungi TaxID=4751 RepID=A0A168RJV6_ABSGL  ali  30  2.....................TPPPESPLHFIARRSAVYGTHAMVSSSQPSATQAGIEVLKKGGNAADAAVAVAATLGVTEPSSTGIGGDAFCLFYDAKSKTVKGLNGSGRTPAALNLDLLRKEGIEGQGLPSA--SVHSVTVPGAAAAWVDCVDWFGKVDLETILKPAIDLAENGFAVAEVSSHLWKNHEQALIDPGQKLEYLIDGRAPEVGEVMTLPTLAKSYKVLASEGKAGFYQGSIGQSIVSAVNRRGGVLTMQDLANHSSQPVEPISIDYHDHTVWEI-PPNGQGITALMALGIIEALDFTQLDHNSAAYLHVVIEALRLAFADTRYYVGDPDVVHVPVQELLSKKYLAERAKLIDLRHRTSTIQKGYPENM--GDTVYFSVVDEEGNACS. 384
252 0.000e+00UniRef50_Q5P4M1 Gamma-glutamyltranspeptidase n=21 Tax=Proteobacteria TaxID=1224 RepID=Q5P4M1_AROAE  ali  41  35............SASATSIGVPQIDPAQATGSSAGNAA-SSRGVVSVSHPLAAAAGAQILEAGGNAIDAAAAIQFALNVVEPQFSGIGGGGFMMVHLAAENRTFIVDSREKAPAGASADMFLGQT-----FLAASTSGHSIGVPGTLKGIDYALRQWGSMTLAATLAPAIRLAEEGFRINRFLAADTYNVRTTL-QPETRAIFLPDGSPLPEGHLLVQPALAQTFRLIARDGVDPFYRGDIARAILD-VQAGAGRMTASDLAAYDVAVRQPVEGDYRGYTIKSMPPPSSGGLALLMMLELLEPFPLGSWRFGGRDALHAMIEAMRLTFADRSVWMGDPDFVPVPVKGLLSECFLATRRAFINSGSRMATPLPGDPRACDSPHTTHFSVVDAAGNFVS. 441
253 0.000e+00UniRef50_A7K601 Gamma-glutamyltransferase n=245 Tax=Gammaproteobacteria TaxID=1236 RepID=A7K601_VIBAE  ali  30  1MR---ILIFSLSVVASLSYAAKPTPFPITPDNN------GQDFMVSATNPYVSSTGYSILKEGGNAVDAMVAMQMVMSVVEPDMTGIGGGTFALFYQHGKQKFLALDGRDEAPSSAHPEMFI-ENGKALSRDE-ILGPRSVAVPGTLRLLYSTHEQYGKLPWSELVQPAIKLARDGYAMNSYTYDIVVREQTRLRDPEIKALYWQDDEVKPTGTLMKNPKMAETLEKIAQQGDRYLYGGALGQHIVDTVNSR--ILSLEDFKNYQVKSRDIIESDYRGNKIVSFGYPASGGVMVAQSLKLLEPYDISQMALTDVEPWRLMTEAMRLAKADRIAYAGDPDYVEAPVEQLLSKTYLDQRRDLIPDNGTSKENPYAQYQGFESKDTGHISIVDREGNAI.. 399
254 0.000e+00UniRef50_A0A0W8FW25 Gamma-glutamyltranspeptidase n=2 Tax=root TaxID=1 RepID=A0A0W8FW25_9ZZZZ  ali  32  1MTQRLTYSSIIFLILLFSSQLFASGE----------LVYSQNGMVVSASELASEVGVNILKQGGNAVDAAVAAGFALAVTYPAAGNIGGGGFMIIHL--NGHNTTIDFREVAPHAATEQMLLDEEGNY-DTKRSLHQWTSIGIPGSVAGLVYALEKYGTMNLSAVIQPAIDLAENGFVLDYWLVESINKFHSSFSIESSKNIFTDNGDSLKMNFLFVQKDLANTLKLIRDNGKDGFYKGIIADIFVEQSGKNNGLISYDDLENYEAIEREPILSNYKEYQIIGMPPPSAGGIGIAQTLAVLEKYNFTKEQWASSEYIHTISEILKYVFADRAVFIGDSDFHEVPIDYLLSENHFNDIYSKIG-ETATSSLEIHNIEYIPSGETTHYSVIDKDGNAVS. 386
255 0.000e+00UniRef50_A0A245ZVU4 Gamma-glutamyltranspeptidase n=5 Tax=Sphingomonas TaxID=13687 RepID=A0A245ZVU4_9SPHN  ali  37  19.........................................QGMVTSADPRATEAGREILRAGGSAADAAMAMMLALTVVEPQSSGIGGGGF-LVHQSAKGPLETIDGRERAPMAATPQRFLGPDGKPVPFVEAFPGGRSVGVPGNVRLAALANRKWGKLPWKALFAPAIRLAENGYSVTRPMAAASTNLTPMWRFPTIAGMYSRAGKPLAEGDRITNPTLAKLLRRIAAEGPDAFYRGQNAKALVAAVKVAPGDITEADLAKYQATERAPVCGTYRSYKVCGMGPPSSGATTVLQVLGMLERFDLAKLGKDSPVAWHLIGEAMQLAYADRDKYLGDADFVDVPVAGLIDRGYIAKRSGLISETRALGSYEPGTPPGAPPHGTTHFIAIDAAGDI... 406
256 0.000e+00UniRef50_A0A075H8P6 Gamma-glutamyltranspeptidase (Ggt) n=1 Tax=uncultured marine thaumarchaeote KM3_55_F05 TaxID=1456198 RepID=A0A075H8P6_9ARCH  ali  32  1...........................................................MMSGGNAFDATIATSAALTVLRPHMCSLGGDAFCLLHQAKDGKIQALNASGPAPRAASREFFLSRGHKFIPD----TGLFPSTVPGLVASWAEIHRSLGTKSLADLLAPAIDLALHGFPLYPGLVNHINDALKRNRNPSATRIFAPSGRSAIPGEILVQPDLAKTLQKIAKEGCETFYRGSIAESIAKFFAENEGLLDSQDLRDYRTPWRDPIRSTYQGFEIFE-QPPVSQGIILLEELNIIEGFDLTSMGHNSAEAIHLMVEAKKLAFSDRLAYLADPDFSSTPVETLSSKEHATKQRKRISLDRASNEKVAPGSINTKGGDTTYFTICDREGNA-SS 334
257 0.000e+00UniRef50_UPI000D3EDE1C gamma-glutamyltransferase n=1 Tax=Euzebya sp. DSW09 TaxID=2052804 RepID=UPI000D3EDE1C  ali  34  9.MSLKLSTILLCLLVGLAPTAASAAE----GSQFSPPVRGHGGVVSTESFAAGQVGRDVLDAGGTAVDAAIAAVFALNVARPQSCGIGGGGFAVVHQVD-GEVAALDFRETAPAAITPDTFGG-----VGLYQAFTGHTTVGVPGTVAGLWALHQRFGTTDWADLVAPAEALARDGVEVPESLSSAMAAAAPRLRFPAAAEQFLVGGAPYPPGSTLVQPDLADTLALIAADGPPAFYTGPIAEMIVADMVDNDGLMTAEDLASYEARFRTPLTADYRGHEVIAMPPPTSGGIAVIEMLNILENFDLTAAGQSSADHLHLVAEAQKIAWADRGAYVADSDFVDVPVDLLTSQAYADQRAAEIDLASAYEPADLGEPAPDDGADTTHLSVIDATGNVI.. 410
258 0.000e+00UniRef50_A0A0P7ZSV6 Gamma-glutamyltransferase n=199 Tax=Bacteria TaxID=2 RepID=A0A0P7ZSV6_9SPHN  ali  30  47...........................PVGAAWSRSPVIAEHGMAASAHPLATQVALDILKAGGTAVDAAIAANAALGLMEPTGNGIGGDLFAIVHDPATGKLHGINGSGRSPAGQTLADLTAKLGDA--DSLPPVGPLPVTIPGTVDAWFTMHERFGKLPMDEVLAPTIRYAREGHPIAPVIAMYLDRALAAFDFSNARKVWFADGSAPEAGEIFRNPDLANTLETIAREGRDAFYEGELARVMVDYLKAQGSAFTLEDFAAHDSEWVEPACAEYRGYELCEL-PPNSQGFAALQMVNILRNVDLSQWERGSPEVIHYITEAKRLAYADVARFYADPDFAAIP-AELLNEEYGKARFALIDPARATPEFAPGEPKLEGPGDTTYLTVVDGEGMMVS. 425
259 0.000e+00UniRef50_A0A2P2F4I4 Gamma-glutamyltransferase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A2P2F4I4_9FIRM  ali  32  17....LVLAMMLSLLAGCGQTTQPAASSTPPAASSEPAAIGTHGGVSSGSVYASQAGLEILQAGGNAVDAAVATAFAVGVCEPNLSGIGGCGMMNIYLADNHEYEILEYMETVPVAVEPGWYN-------PETDSAT-AKNAAVPGQVAGLLTALEKYGTMTPEEVMAPAIKLAREGFPIEERLANAIMDSFDMIANEEAAAIYTNDGLPYATGDLFKNEPLADTLEAIAKGGIEEFYTGELAQKMVDGLQANGSLMAMEDLATYTVAEREPIRTEYYGYEVVTVPPPSNGGDWLLEMLNIMEEKDISQYDPSTLEYQYIFNEACRIGLVDSYTYIGDPAFYDLPVEEMISDEFAAERAALIDMDQAMESVPLSDPTAEESQHTTHIAVIDQYGNIVS. 432
260 0.000e+00UniRef50_A0A142YHQ4 Gamma-glutamyltranspeptidase n=7 Tax=Planctomycetales TaxID=112 RepID=A0A142YHQ4_9PLAN  ali  34  32........................................TKYAVSAQESHAADVGRDALRAGGNAIDAAVATAFAMAVTLPEAGNLGGGGFIVAYLPASKRVVDLDFRETAPGSSTPRMYLDAEGNLLPRHRA--GAWAAGVPGTVRGLGTAHAKWGKLPWRDLVAPAVKLAREGFPISDELAVALNRVGDRMADPESVAAFKPDGQPWKGGDLLVQGDLASTLERIAAEGPDEFYTGRTADLIAAYMTENDGRISRKDLADYRAKERPPVRTTYRGHDVYSVGPASSGGVVLCQMLNILERYDLMADGPQSPRTLHRVTEAMRRAYYTRATRLGDPDFVDVPFADLASKAAADELARSIDDSRATPSAEPFPIVSTEPDHTTHFSVIDGEGGAV.. 402
261 0.000e+00UniRef50_L0R730 Gamma-glutamyltransferase n=12 Tax=Bacteria TaxID=2 RepID=L0R730_9DELT  ali  29  15.............................TFNSRRTPVYATKGMVATSQPLATEAGLEMLRAGGNAADAAIAVASALAVIEPCSTGLGGDAFALYYSQKNKKISALNGSGKSPQNLSLEKVAALG---ISGSLPKRHALTVNVPGALAMWCDLIERHGSLPLSTIFAPAIRYAEEGFPVSPVTAHMWKEDGDVLKTSPGGSALLLNGEAPRTGEIMTSKAMGDTLRKLAEGSPDDFYKGEIADKIVQIVQDNGGFLSKKDMAEHTSLWQDSIKTNYRGYEIHEC-PPNGQGLAALIALNTLSNIELDKIGPDSAERLHHLIEAMRMGFADARQHIADPDVYACPTDKLLSRKYGAERAACISPDKANPDSRSGVPVN--SSDTVYFCIVDKDGNGCS. 382
262 0.000e+00UniRef50_A0A2S6RTH6 Gamma-glutamyltranspeptidase n=8 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2S6RTH6_9PROT  ali  33  20.....................................AYANNFAISTSHPIATKVGKNILHNGGSAIDAVIGVQMVLNLVEPQSSGIGGGGFLLYFDKKNSKLSFYDGRETAPNNIKKEFFLNEFGDQKKFYEIAVGGQAIGVPGLLSMLEIAHKDHGLLQWEELFTPAIKLSENGFKISSRLHKLIKRDSYLYLFPESKKYMKDEIDPKKKNQILKNPKFGETLKIIAKKKSKGFYEGAIAKEMVNKIKKTKGVLELEDLKNYKAKKRSPLCGKYRKFRVCSAAPPSAGGFSILQILGIMEEFDLSK--KNINENIHLIIEASKYSYNDRYRYLGDPDFSNIKINNFLEKEYLKKISSKIKNDK-QVKYNIYKNSFFIPKSTTHFSIIDKYGNVAS. 393
263 0.000e+00UniRef50_A0A2G6S380 Gamma-glutamyltranspeptidase/glutathione hydrolase n=1 Tax=Rhodanobacter sp. TND4EH1 TaxID=1907399 RepID=A0A2G6S380_9GAMM  ali  31  61....................................................TEAGFEVLARGGNAVDAAIAVGSALSVVQPEASGMGGGFLAVIHDATTGKNTFIDAREMAPQAVSEKDYLKADGTP-DRDTSLNGPLAAGIPGFPAGLAYMAGKYGKLPLGVSLSPAIRLAEAGFHPSGSLVRSIGHKADVLRYPASSAKFMPGGKPPLETGLFRDPNQARTLKALAEKGADGFYKGAVAKELVKSVRAAGGTWTLTDLANYQAKERQPIELNYAGYKVITAPPPSSGGVAIAEMLNIIAPLDLKSM--DEAHRIHYLVEAMRRAFRDHNEYLGDPDFVKMPLDMLLSPYYADGLRQSILPEQATRSALPSVHAKDPGMHTTHYSILDKDGNMVS. 404
264 0.000e+00UniRef50_A0A1F2VLD7 Gamma-glutamyltransferase n=5 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2VLD7_9BACT  ali  37  1...........................................MIASGHALASEAGIRILKSGGNAIDAAVAAWAVQGLTEPEMTGLGGDMFMLIYLAKTGEVKFINGSGVAPMAATVDFYKGKGG------LPSDGILSVSVPGAVAGAELAAKTYGTKPLADLLAPAAELAERGFPISESLAGAIRGSTQKMS-PSAKKIWFNGATPLGFGDRVVQKDLAATLREIGTRGSAAFYQGPIAEMFAAYMKANGGLIDRQDLAAIRANEDTPIHINYKGVEVYEC-PPNSQGFVMLQALNILEGMNVRYMRHNSAPYLHAVTESLKLAFADRNKYVADPKFTDIPMRELLSKEYATVRRALIDPDKAIAEAPFGNPEGVEDGHTTYLSVVDKDRNMVS. 374
265 0.000e+00UniRef50_UPI0009C0EDB8 gamma-glutamyltransferase family protein n=1 Tax=Pseudomonas putida TaxID=303 RepID=UPI0009C0EDB8  ali  33  1MKFSTPLMSALCLVAASGWACAAPPELASGYRSGLQPVHASRHMAAAANPLASEAGRAILRAGGSAIDAAIAMQMVLTLVEPQSSGIGGGAFILYWDG--RRVQAFDGREAAPAAVTEKLFLQADGTPMPFRAAQIGGRSVGVPGVLRALKLAHDQHGKLPWRDLFAPAIALARNGFAVSERLHTLLAGDPYIGRSPAMARYFLDEGKPLAVGTTLRNPELAYTFERIAAEGPEAFYSGEIAEAIVAKVRANAGYLSLQDLQQYQAKEREPVCGPYKAWRICGMPPPSSGGVTVLQTLGMLEQRDLAALRPSSPARLEAMLEAVQRAAPQRDQYLADSDYVPVPVKALTDPAYLASRAALISMKRALPGRPQGALAPDRSPSTSHLSAVDDSGQA... 477
266 0.000e+00UniRef50_A0A246QEL2 Gamma-glutamyltransferase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A246QEL2_9BURK  ali  28  3........................................KNGMVVCPQPEAAESGIEILRAGGNAVDAAVACALAQTVVDPLMCGIAGFGTGTVYSPRTGRHEYVDFHAPAPGAARPDMWRDGFGFVLKGRVNDIGPQSIAVPGTLMGLKRMHERHGCLPWAEVVAPAIQWARDGYFVRPAMYTFWAGNLERLAYSEGRKLYCRDGRPKTIGTPIQNPDYADTLELIARDGIDSFYRGDLARRMVDDIRAQGGILSLEDLANYAPTFTQPLMGTYRDRKITTNQPP-GGGAMLIEMLNILENFDLRSLEHNGPAYIKTVCEAMKRATADKDTHIGDPAFVDVPLDRILAKEYAKACAERIRAGE-KASVPRLNPGGAQPKDTTHLSVVDKDGNCV.. 374
267 0.000e+00UniRef50_A0A2E5ULQ2 Gamma-glutamyltransferase n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E5ULQ2_9BACT  ali  29  1MKPTLLIIMLGCM--SLPITPLMSQEEPSDRPFWRPVVMGTHGMVAAEHPLEAMAGWKILEAGGNAFDAATAVFYMTTVVEQHQAGMGGDAFMLAYVKDLDKVVFINGTGTAPQLATKSYFQELG------SIPSSGPDATDVPGAVAGFDLAQKTFGTMEYSQVLEPAIRAAREGHPLDFWASTYHERAVEKISDPSSVAVLMPEGRPIVAGELFVQRDLASSMEKIVSGGADVFYRGELAMQFDKIYQEAGGRLRYEDLASYQAELLDPIKIQYEGLEVYQ-SAPNSQGIVMLMALNILEGYDLKAMGHNSADYIHVVTEAMNLTFADRNKWISDPRYVDIPVDELLSKDYAQSRRSLIRLDKAMTSPPPGDPINGEDGETSSFSISDQFGNLVS. 415
268 0.000e+00UniRef50_U2WTE1 Uncharacterized protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=U2WTE1_9PROT  ali  34  54.......................................................GIEILSNGGSATDAAIAIQAVLGLVEPQSSGIAGGGFILHYDALADELTSWDGRETAPSAITPEIFSNRAGTLEGFVKAMTSTDAVGVPGIPALLETVHKKYGRLNWASLFLPAIKLATDGFKITPRLHYLLSADPFIQNSPSARSIYFPGNKAKPIGTLLKNPEYAETLIKLAENGAKSFYAGENSKKIISDLADLNQKLRQKDFSNYQAKQRENLCLPYRAYKVCSMGPPSSGGIALLQILGVISHFDLSTHDIDDARVIHLITESTRLAFADREKYIGDPDFINVPVTSLLEASYIKSRSELINPDKSLENITPGVIKNPEQQSTTHFVVRDAEGNVVS. 420
269 0.000e+00UniRef50_A0A2D6R014 Gamma-glutamyltransferase n=10 Tax=cellular organisms TaxID=131567 RepID=A0A2D6R014_9BACT  ali  26  9...THAIALALVVVSLGASAAAQEDGSPFPFDTKRSAVIGHRGVVATSQPLASNAGLDILKQGGNAIDAAIATAAVLTVTEPHSTALGGDMFAMVYLEGEKKLLGLNGSGRSSYSMTLDALMGRLDE--QEMDRIGGIYSVSVPGAVDGWFTLLAEYGTMTMAEVLAPALHYAEHGFHVTERIGEVWAGSEEKLRRPSAAATWLVDGKAPRIGDLFVNPGLARTLKMIAEGGRDAFYRGPIAEAIVAYSDSKNGFFTMQDFEEHTSSWVEPLSTDYKAYTLYEL-PPNGQGIAALEMVNTLGNADLSALGHNSTAYLHHLIEAKKLAYADLDQWVGDPDANELPVDVLTSTGYGRSQFARIDPNRAQELTESGLP---ERGDTVYLTVMDKDHNAVS. 397
270 0.000e+00UniRef50_Q31EW6 Gamma-glutamyltransferase 1. Threonine peptidase. MEROPS family T03 n=14 Tax=Proteobacteria TaxID=1224 RepID=Q31EW6_HYDCU  ali  30  1MRTALHCLALLISFFFVSSSFATPLNST------------SQAAVAMPDSYSAEVARKVLLSGGNAVDASVAAAFVLAVTYPEAGNLGGGGFMTLYTSSQKQAYFLDYREKAPKAAFRDMYLNAKKAVIPY-KSLVGYQASGVPGTVMGLWAAHQRFGKLPWASLVQPAIVLAEKGFVVPKDLEKVARWYQKWIANKNFKRYF---GE-LKTGRLFKQPELAATLKRIAQTGPYDFYFGQTAQLIVKEMQSQDGLITLDDLAHYEVKWRQPVQADWKGHQVISAPPPSSGGVAIVQLLKILENLSMDKAGPPQATRAHFYAELSKRVYADRAQYLGDPDFIKVPTEKLISNAYLRKRAADVLMDEISETQTI-KPGLAESTDTTHFSVVDAQGNAVS. 398
271 0.000e+00UniRef50_D3SR22 Gamma-glutamyltransferase n=79 Tax=cellular organisms TaxID=131567 RepID=D3SR22_NATMM  ali  31  3..........................APNGPQTGRPPTRAENGMIATSHHLASQAGLTALEEGGSAVDAAIAANAVLSVVYPHMAGLGGDGFWLIHDPDESAVQALNASGPAGDEASREFYRERGQDSIPDRGPEA---ALTVPGAVDGWRETHDAYGELEWSSLFESAIGYARDGMPVSRSVADWIVEDVPVFEYPSTHDIFLPDGSPPAVGDRIKQPDLADSLEVIAEQGARAFYEGDIAERICEDLHDRGSPLRSDDFANFEAEWVDPITTTYRGYTVHEF-PPNTQGFAALQILNLIEEFDVASWGDGTVEYYHHLAEAVKVAFADRDEWLTDPDFVDIPVDELTAKKYADERRDLIESDSAMGAVDPGDRVDDQGGDTVYFCAVDEDGLAVS. 380
272 0.000e+00UniRef50_A0A149VQV1 Gamma-glutamyltranspeptidase n=1 Tax=Ferrovum sp. PN-J185 TaxID=1356306 RepID=A0A149VQV1_9PROT  ali  37  41..........................................GVVSTSHPLATQAGLSVLRSGGNAIDAAAAVQFALNVVEPQSSGIGGGAFILVYLAKTHQVYAIDARESAPLMATPDQFMGH-----SFAQNSTSGISVGVPGTLAGFNAIVSQWGKLSLGQVLQPAIHLAAEGFIVTPYLAGALKDSRATLSKEAKERFFNQDGTPLHVGQRLVQPELAHAFELIAKEGIDPFYKGEIAQAIVSTQRAGWGRMTLNDLDHYHVYFRKVLSFNYRDYHIVGMPPPSSGASTLFETLGLLESYATKNNWHDALYRDHMSLQALSLAFQDRADYFGDPQQMLIDPTQVLNRSFLAQRSRLLVEGQL--PVHTVLPPTPSGTNTTHFSIVDKEGNVVS. 394
273 0.000e+00UniRef50_A0A2E2TI85 Gamma-glutamyltransferase n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E2TI85_9GAMM  ali  28  28........................................SQYAVASANPYATKAGIQILTSGGNAFDAAITVASVLAVTEPYNSGIGGGGFWLFFDAKHQKYQFLDARETAPAKATQTMFDNN-------QSAINGSLAAGIPGEVAGLIYLHQHYAQLSLAKDLQPAITLAQAGFVVTPYYQKRAARLKSLRAFSQTSKIFLENNDIPAIGYLIKQPKLAKTLQLIASTEGDDFYRGKTAKDMVEAVQSTGGIWTLSDLDNYHVIIRKPIFIDYKNNQIITAPLPSAGGIALKTMLNLMNQTDFFSLSH--IMQVHYMIEFMRNIYYDRYKYLGDPAFNQIPLKDLLSSQHATQILQRISPNKATASDTISSLDNKEGMHTTHYSIIDAKGNIVSS 380
274 0.000e+00UniRef50_A0A1G0JE89 Gamma-glutamyltransferase n=1 Tax=Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_57_10 TaxID=1798299 RepID=A0A1G0JE89_9GAMM :_  ali  33  2..................................RPEVGGTHGAVVSEHPLASQIGYEVLRAGGNAVDAAVSMAGVLAVVRPHMNSVGGDALSLFYEADTGNVTALNASGAAGAVATPSFFTDQGMTRVP----SSGAGSITVPGAVSAWAVALEKYGTITLAEALEPAIKIAEEGFMVSSTLAEDLLTAATRLN-PAGQEIYRPNDQPLQAGDLLKNPKLAATLRKIAAEGPSAMYGGEVGAAIAAFVEAEGGHLRPSDFSAHVPEWVEPISTTFQGRQIHTM-PPNSQGIVMLQMMAMAETIPFAERSSNSPELLHELVEITKLAFADRDRWVADPRFADLPIEELLDREYLTERATLIGEEAASEREAASNARLNEGGDTVYLMVVDPAGNAVS. 366
275 0.000e+00UniRef50_UPI000B8EF6D4 uncharacterized protein LOC110846065 n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B8EF6D4  ali  32  5..............................WNSRRSPVYAKNGMVACSQPLAAEAGLGILKRSGNAADAAIAVAAALNVTQPTSTGLGGDAFLLYYDAQTKQVKGLNGSGRCPSGVSISTFEDRGFSEQNRPPSVN-PLFITVPGAAATWVDTIELFGSLTMAQILEPAIALAEDGYPVGQVTAYYWQRSEQLLRNPNGGEMLL-NGIAPKEGEIMRMPYLAETFRTLAANGKAGYYEGRIAQAIVDVVNELGGVMTLADLSSHFNTQDVPISVSYRGVDVYEM-PPSGQGITALLALNILEGFFLNGLTHNSAQHLHLVIESLRIAFADTRFYVADPEFVSVPVDGMLSKTYADQRRGLISPESAAVNIDHGFPPNV--SNTVYFCVVDGQGNAAS. 370
276 0.000e+00UniRef50_N1MR85 Gamma-glutamyltranspeptidase n=15 Tax=root TaxID=1 RepID=N1MR85_9SPHN  ali  29  1MISYAVIVSLMASATMGQAQLPVAPPQERGYSQIHGPVIGRKGMVASQSAPATDVGVEILRQGGNAVDATIAVAFAEAVTLPRAGNIGGGGYMVIHIAAKDKTITINYYGTAPRATTPGLLLGPDGKFDRSKSMTF--QNVAVPGTVAGMWEAHRMFGSLPWKKLVEPAIRLAAQGYRLSDGEAEATAGRREMMKDPGATKAFFKDGSAYKPGDIFKQPDLAWSLKQVAARGRDGFYKGPLAQKMVAGIRSGGGIVDEQDLADFKVEILEPIWGSYRGHDIAFMPPTSSGA-TLAEIMNLLEHFPMKDYGWGSVQGLHIMSEAMKVAGSDRRLIGGLPD-WKTPAKGIASKAYADERVKLISPTASLANLPDGNPYPHESPDTTHYSVADKYGNAVS. 408
277 0.000e+00UniRef50_A0A1Y0N633 Gamma-glutamyltranspeptidase n=24 Tax=Bacteria TaxID=2 RepID=A0A1Y0N633_9BURK  ali  33  36....................APPAQPEAATGNTAKPGWATRTYAVAAANPLATDAGRQVLAAGGSAVDAAIAVQMVLALVEPQSSGIGGGAFLLHFDGKT--TQAFDGRETAPAAATPALFLDDKGQPMKFTDAVVGGRSVGVPGAVAMLAQAHAQHGKLPWASLFQPAITLATQGFAVSPRMAALLAAEPHLKKDPVAAAYFYDAGKPWPAGHVLRNPELAAVLQGIADRGPSALLQGEVGQAIARKVQSNPGSLSTQDLAAYRPVVREPLCFDYREVRICGMPPPSSGAIAIGQILRMLDSTPASTLGLPTADWLHLYTEAARLAFADRAQYLGDPAFVQAPWTSLLNPAYLRNRAALIDMQMALPGQPAGTPLSYAPMGTSHISVVDAYGNAV.. 442
278 0.000e+00UniRef50_G2RI38 Uncharacterized protein n=3 Tax=sordariomyceta TaxID=715989 RepID=G2RI38_THITE  ali  29  1MRRPCLLPVACWLSLLSELAPASAFPISYQGVSNQSGSGGSRGAVASESSICSKIGIDTLAMGGSAADAMVATTLCVGTVGMYHSGIGGGGFMLVRD-RHGRYEAIDYRETAPAAASKDMYEHDQ------RASMVGGLAVAVPGELRGLEYVHRKYGVLPWKTLVMPAVRIARDGFPVTEDLVRYMKNNTFLVDDPIWAQDFAPNGTLLQLGDTITRKRYADSLEKIANHGVDVFYEGDLAKSMIDFIQKMNGTMTLDDLRNYAVEVTPPLTITYGDYRLFTTGAPSSGSI-MFSIIKTMEQYPPEDL-ADTNLTTHRFVEAMKFAYGARLK-LGDPDFVKNTTEELLSDNMAHEIRQRILDNRTQP-VEAYDPYNPESHGTSHIVTADASG..... 401
279 0.000e+00UniRef50_A0A2P2E7K6 Putative gamma-glutamyltransferase YwrD n=62 Tax=cellular organisms TaxID=131567 RepID=A0A2P2E7K6_9PROT  ali  31  38.................PVVTGPGDRIAGPSFATRSPAYGRNGAAATAHPLATQIAIDTLKQGGTAVDAAIAANAALGLLEPTGNGIGGDLFALIWDPKTQKLYGINGSGRAPMGMSLDDRAAREAKSAPGRRPSFGSVTVTVPGAVDAWFSMHARFGKLPMSQILAPTISYADAGAPVPPVIAYYMAANLKRLEFDNARKTYFANG-AVQTGQVFKNPDLARTLGLIAAGGRDAFYKGEIAQRIDAYMRRIGGPLRASDLAAHHSDWVEPISVTYRGYQVWQI-PPNSQGVTTLQMLGILNQFDMAKAGFASAESVHLQIEAKRLAFEDRAKFLADPTFAKVPTQGLISPNYLRARAGLIDPAKASVNVAAGDPAQFEKGDTTFLVTADSTGMMV.. 427
280 0.000e+00UniRef50_A0A0C9M4U8 DNA polymerase alpha catalytic subunit n=1 Tax=Mucor ambiguus TaxID=91626 RepID=A0A0C9M4U8_9FUNG  ali  28 2029.RRLGVVALVALVTIGMSCMITASRHPHQDDALESPVVKGSKGAVAVEAEECSHVGVQILKQGGNAVDAAIASTLCIGVIDSFATGIGGGGFMLIRSP-NGTFEFIDFRETAPEKATRDMFVENP------ELAKVGALSIAVPGEIRGLELAHKRHGRLPWSDLFAPAIHIARHGFKATELLAVRVATDSEWMQNTGWSDVYYRDGKPIQQGDLIKRPQLADTLETISTLGADAFYEGDIAKQLVATIQSAGGIVTLEDFKAYRPVIRRTLSTWYNGRKVTTCSEPTSGPV-ILSVLNLIERFQFKVEGF-TGLNLHRLVEAFKFGYAFRTE-LGDPDYIKNRIDEMIQKEYAADIRQKITDD-TTHDPLYYNPDHVESHGTMHLSVVDENDGAV.. 2423
281 0.000e+00UniRef50_F8D6M5 Gamma-glutamyltransferase n=9 Tax=Natrialbaceae TaxID=1644061 RepID=F8D6M5_HALXS  ali  41  66...................................QQVTAAGGMVSAEDPRASAAGARVLAEGGNAIDAAVAVQYVLNVVSPQASGIGGGGFMVVYDAESDSVHCINSRERAPRDAHPEMFLD-NGEPRDFDEAIQRSEAIGVPGTLDALETARERFGSRPRQRLIRPAIQLAAGGFTVDEYLSEVIAENRDKFND-AAREVFLDNGNVPQPGDTLTNEDLARTLELIRRDGRDAFYEGPIARDIAATVEGEGGPIDERDLAEYSVTIDEPVRKEAYDFEIVGQPVPTSGPTTIAMIMRMLEFLDIEEYDIRAPEKYHLIAEANRVAWADRDQYMGDPEFVDVPVEGLLDDDFLRQRASRIDLDGVIADYAAGESTADPVSSTAHFTTADRHGNVVS. 450
282 0.000e+00UniRef50_I1S273 Uncharacterized protein n=62 Tax=leotiomyceta TaxID=716546 RepID=I1S273_GIBZE  ali  27  1.MKIPILWLASSLHYGLLSASPIFEELL-------SPKAGTKGAVVSEAQECSYIGRDLLARGGNAVDAMIGTTFCVGVIGMYHSGIGGGGFMLVRD-KDGQYEAIDFRESAPAAAYEDMYQGN------VNGSIYGGLSVGVPGEVRGFEYAHKKYGSLPWKTILQGAIKVARDGFIVNADMAKFIEKTTKFTEDPSWAEDFAPNGRLIAEGETMTRKRYASTLQAIADHGADVFYTGPFAESMIKTIQDSNGTMTLDDLEDYQIISREVLHTDYKGYDVYGMSSPAGGAVS-LNILNTMNGYSHQDADQNT--TLHIYIEAMKFAYGARLK-LGDPDFVDGISEEMLNHTTAEKIREKIDP-WTTQDIEKYDPDGIEGHGTSHVVTADRDGMAVS. 388
283 0.000e+00UniRef50_A0A2M8HIE8 Gamma-glutamyltransferase n=1 Tax=Leptospira sp. TaxID=178 RepID=A0A2M8HIE8_9LEPT  ali  33  49..NFIFFHIILVICSFSFLTLCKA-------KDSSSYASGNTFAIATDHALASEAGKIVFQKGGNVFDAYVAASFAISVLRPQSTGLAGGGFALVKSAKSGSIEAYDFRERAPQLASENMYLDSKGEIIE-NQSLFGYKAVGVPGNVKGLLSIHKRYGYLSLEQVLEPALRLANEGFSVYEDLHIAIDKSKEEMND-AARSIFLRNGNALKTGSVLVQKDLGNTIQKIILNGEKEFYELETANSIVRSMQLNKGLISLKDLKDYKVIERKPLKITYKQYEIISFPPPSS-GVFLFEILKFLEHQNIQSLFTDDPAYYRLLIEAMKQGYEDRSIHGGDPDFSFVPVEALLSRDYLADRTIEVLRKSRADVKSSGEPKTLESYNTTHISVMDSMGNAVSS 436
284 0.000e+00UniRef50_W2QJI1 Gamma-glutamyltransferase n=24 Tax=Eukaryota TaxID=2759 RepID=W2QJI1_PHYPN  ali  34  6.................................TRSPVYGRHGMVSCSQPLASEIGLRILKQGGNAVDAAIAIAAALNVTEPCSTGVGGDCFLLFYDAKTKQVRGLNGSGRSPAALTAEQAIKDLGE-DATVIPSGHGHAVTVPGTVAGWVDAVEAWGTLSMAEILNPVIGLAREGFPVSPLTSASWERGKSLLRGPNAAELLNADGQAPKAGEIFTNENLAKCFEEVVKNGKKAFYEGRIARAIVDMVKEKGGVMTLEDLKNHKSTFVTPINTKFQGVDVHEI-PPNGQGITALLALNILTQLDGGLPPQGSAEFVHLQIEALRLAFADAKWFVSDMEHTSLPVKELLSENYAKKRATLVDRTKAAIDPKHGSPEL--SCDTVSFQVIDGQGNAVS. 370
285 0.000e+00UniRef50_A0A2E3UPP1 Gamma-glutamyltransferase n=8 Tax=Bacteria TaxID=2 RepID=A0A2E3UPP1_9GAMM  ali  30  1MKKLSRLIVTICALATVACGPESVPVESSPASQNRPDVRGLTGAVSAGHPLAAQAGLRILHEGGNATDAVIAMAGVLAVVRPHMNGVGGDAFGIFYDGETGDISSLNASGRAGSAATPEFFAAADLERMPGR----GALSVSVPGAVAGWIDAHERLGSKDFAYLLQPAIEYARGGFPVSTLLAKDFEEQGGALN-EAGKDLYLPGGSPPLVGSLLKNVALADTLEIIANEGKKGYYEGDIAKQLVAFITEQGGLLREQDFTNHTSTWVEPVRREYLGHTFLVM-PPNTQGITQLALMEMSKSHPVAAMGHNSTEYLHTLIELKKLSFADRDRWVADPTMAEVPVEALLDTDYLSKRASLVDAAQAAISVEPGNQQQEDSGDTVYITAVDQWGNAVS. 418
286 0.000e+00UniRef50_A0A1I3JBX1 Gamma-glutamyltranspeptidase / glutathione hydrolase n=2 Tax=Ruminococcaceae bacterium D5 TaxID=1520815 RepID=A0A1I3JBX1_9FIRM :_  ali  30  1MKRLLAWAAAALLISGCAAPAPPPSPAEVQTLSSGSAATGKNAAVSSANPAASAIGAQILQRGGNAVDAAVAVSFALGLLEPNASGVGGCGYA-VYVPAVGEPAFYDYRSAAPAAFDPGAFTALPAEEQKHSVAAAGVPG-----AVAGWLSLHEQYGRLPLDELLEPAIDLSENGFEVLPFLASLFTDNYNLLKDESCAALLLNDDFPYMEGEVMKNPGYAKTLRKIAAEGRDGFYQGEIAEAIVSASSARGGTMTLEDLASYEVRVGKPLEGNYRGFTILTSAPSSSGGIALIESLNLLERCDLPASGVNTPLTLHRMGEAFKIANADRYSYVGDPAFTDIPTEMLISKEYADERAALLSDERVLSDLE--VLPDNQSTSTTHLSIIDAEGNAVS. 403
287 0.000e+00UniRef50_A0A2D8LD35 Gamma-glutamyltransferase (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2D8LD35_9CHLR  ali  30  5................................TRKQSISASQGVVTSNHPVASSVGISILSSGGNAFDAAVGTAFALSVVEPMMVGPFGGGFTNFFRPNEG-FSTIDGYGSAPGAAHERMYNPAQYFDVEDQLNQNGYLSVGTPANLLAWTHLVEKYGNFNLNEVIQPSINIARNGFRVTNYLSDIIKDNINELNYKESTNIYLPNGKAPEAGEIIKNPNYALTLEGISKYGAAYLHEAELGKHIEDEMKKNGGLVTLDDLKHQKIFYREPIVGNYKGYKINSVGPVSSGGICLIQMLNILENFNIEKYNIFDPERIHIISEVFKIVFADRYKYIGDPEYVNIPINGLISKKYALERANEINLNKAQSYKFTNNFLDNDSNNTTHFNVADSEGNIVS. 374
288 0.000e+00UniRef50_I1BUA1 Gamma-glutamyltransferase n=5 Tax=Mucorales TaxID=4827 RepID=I1BUA1_RHIO9  ali  28  20.KRPTKLYMIGTAVFLLTFISVTFSFFNKESTSKPHLIVGSQGAAAVELKECSEAGVEILRNGGNAVDSAIASALCIGVVNSFATG----GFMLIRSP-NGTFEFIDFRETAPNGSHKDMFIHDP------MAAQRGGMAVAVPGEIRGFELAHKRHGKVPWQDLFHSAIRIAEEGFEVTELLSKLLKSKLWIEASPAFAAVYAPTGVIAQPGDIIKRPSLGQTLRKIAKEGADVFYEGVIAEAIVNATQAAGGILTLDDMRNYQALIRPTVSTSYHGKKVVTCSAPTSGPI-LLHVLNLIEPYDFHKTGP-TALNIHRLIESLKFGYAFRTE-LGDPDFVHNRLEEIISKEWADHVRRNISDDKTHSPLYYGKYQTKDPHGTMHLSIVDKEDGAVS. 405
289 0.000e+00UniRef50_A0A2G4JDK9 Gamma-glutamyltransferase n=11 Tax=Acidobacteria TaxID=57723 RepID=A0A2G4JDK9_9BACT  ali  29  1MRNLLFVLAFLIMTTSSAQQIQTGDRPSGNLRGTRSPAVGRHGMIATSQSLASAAGLKVLQDGGNAIDAAVTAAAVLAVVEPSMNGIGGDLLAIVYDAKTKKLYGLDSTGRSAYAATPEEFTKRGLKEMPGN----GPLTVDVPGVVEGWHQLLTRFGTISLAKAMAPAITHARDGFPVAELMANEWKGNEKLLRDPATAATFLPTGKPMAQGDIFANPRLARSLEVIAKEGRDAFYKGAIARAIVADMKTRNGLLDMKDFADHKADWVEPIGTNYRGYDVMEM-PPSTQGFVALEMLNIMEGFGIKAMGHNSADYLHVVTEAKRIAFADRGAYLADRDAMSKDIKTLLSKEYAAARRKEIDMTKAANSYPPGTPAGADLGDTIYLTAADSQGNVVS. 406
290 0.000e+00UniRef50_A0A2E8YCT9 Gamma-glutamyltransferase n=1 Tax=Thiotrichales bacterium TaxID=2026796 RepID=A0A2E8YCT9_9GAMM  ali  27  1......................................MSTGAMAATSQPMATSVALDVLRRGGNAMDAAVAASATLAVTEPQSTGIGGDCFLLYHEAKTGRLHGLNGSGRSPSGATLERYKEAGFTEVP----VDGLYAATVPGALHAWQTAIERFGTRSLGELLRPAIGYARNGYAVTPVVAENWARGRDKLKFEDSRRVYLRDGEALSAGDVHRHPELADTLELVAEQGVDVFYQGSVAERIVAFSDANGGLFTLDDFANHHTEWVEPISTDYRGYRLYEL-PPNGQGITPLMMLNIIENAEVSALAPFGADHVHLFAEAYKLALAERDKYCSDPDFGELPVDVLISKSFGESQWQRIDPEQALPPPVASGYRP--GTDTVYLSIVDADRNMVS. 353
291 0.000e+00UniRef50_A0A2V8GUC1 Gamma-glutamyltransferase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8GUC1_9BACT  ali  27  31.RRNAVRSGKESWLTTSPKASLSADRTEISRWQARSMTISTRGIVSAESPLAAQAGAVVLARGGHAAEAAIAANAVMGVVAPMMNGVGGDLFAIVHDAASGAVHGLNASGWSPAGMSIEFLSARGMKAMP----QAGIHSVTVPGAVAGWMALHGKFGRMPLETILSAAIAHAEEGYPVSEIMSLEWAGSVAALQNRNATATYLPDGRAPAAGDLFRKPALARTLRAIARDGADAVYRGDVAKLILNCSVEQGGAFDASDLAEYEAEWVSPLTTNYRGWEVYEM-PPNSQGIAALVMLNILENFPLGEYGCGTADTLHLMIEAKKLAFADMQRHIGDPRFSKMPVEAMLSKAYARQRAALIDPRHAKASVDAGQLPTH-GGDTTYLCAVDASGNICS. 423
292 0.000e+00UniRef50_A0A2P2F4J6 Gamma-glutamyltransferase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A2P2F4J6_9FIRM  ali  31  47............AASQSTQTPEQPALPELTTDTYGNAAVGYQAAVVSANEYTSRIGMDILEAGGNAVDAAVAMIFANSLTEPGATSLGGASFMTIYLKETGEYICIEAMETAPAAAGID--------TLDEINEKKGAMLVTVPGQVHGALTALEKYGTMTREEVLAPVIQLAEEGFDVHISFEERASASFDKLQNEEAAKIFTNEGLPYAVGDHFTNPDYADTLRKIAEGGIEEFYKGSIAQTIVDEVQRLGGLLTMEDMASYTSVEREPISTTYHGYEIVTQGPPSNGGAPMLEMFNILENYDLVSMGFNTPEYLFTFNEALRLSMADGITYFGDPDFYELPIDTLISKEYAKERVENPKDGKVNPTLVPGETATPESGSTTHVSVIDEFGNMVS. 434
293 0.000e+00UniRef50_A0A1G8EIN9 Gamma-glutamyltranspeptidase / glutathione hydrolase n=4 Tax=Bacteria TaxID=2 RepID=A0A1G8EIN9_9ACTN  ali  29  52....................AVPATRPAGYLDQTRSEVLARNGIAATSNPLATAAAERILLAGGNAVDAAVAASATLGTVEPMSTGLGGDLFAIVWSAKDKKLYSLASSGWAPKAWTVDYFKNTLGV---DEVPGRGINSAVIPGTVSGWDALLKRFGSMGFKEVLEPAASYAEDGFPIHEVMHGQWRSTVNSLRDPDSAKTWLPGGQAPQLYSVFQNPDLARALRLIQKDGRDAFYKGPIARAIVEKSQTAGGVIAADDLSEYRSEWVTPLSTEYHGYQVHQLPPP-GQGFAALEMLNILDGFDLAELGPREPRYWHLLIEAKKLAYSDLHRYNADPKFDPAPLDRLLSKEYAATLCDRIDPDRAT----PLDVNGADQGSTVYFATADRWGNMVS. 427
294 0.000e+00UniRef50_A0A2D8VJ93 Gamma-glutamyltransferase n=15 Tax=cellular organisms TaxID=131567 RepID=A0A2D8VJ93_9GAMM  ali  33  28...................................KTVQASDSMVVTRHFLATEVGNTILQNGGNAIDASVAISFALSVVLPQAAPIGGGGFMVIHEANTNQNFTIDYRETAPARATRDMXITDG--IVNRELALESYLSSGTPGTVYGLFIAHQKFGKLPWRQLIEPSITLAREGFVITETLGTTLSDYADKLAKTDGKKIFFNDDQIKSSGDLLIQTDLANTLERIARFGAAGFYKGKTAMLIASDMRKNNGLISSSDLRNYXAKYRXPISFNYKDLNIVTMGPPSSGGLLLAXMFNMLEEEDXNKXNPHDPNNILITSEIMQKAYALRTAXMGDPDFYDIPYSLFLSKDNARLLSAQLNREKSSQKADFDPYKXKFKENTTHYSVXDSEGNAVS. 388
295 0.000e+00UniRef50_A0A2V9KGW8 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9KGW8_9BACT  ali  37  30........................................RQAIVVSNEPLATDAGVEIMRAGGNAVDAAVAVGFALAVTDPKAGNIGGGGFMLIRMAD-GRATVVDYREEAPGDATRNMYLDARGEPIP-AASRVGPLAAGVPGTVAGLALAEEKYGKLGLPRVLAPAIRLAEEGFPVSYALAQSLQQSEEHLKFAESRRIFLRDGRPYEPGEIFRQPQLAQSLRLIAALGPDAFYHGPIAMDLVATMKSLNGLISLDDLAHYQAKLRQPLVGQFRGYTILTVPPP----------------LDLG--PPNSFQSMHLIAEAMRRAYADRAAYMGDTDFVPAPVAGLLSLKYAAKLREEILAAKGEVPVAAGNPAAFEAAETTH............. 355
296 0.000e+00UniRef50_A0A2D9HG32 Gamma-glutamyltransferase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2D9HG32_9DELT  ali  34  1MRLFRLLVLALGW-MACAHQPTPNLVLPAA------------GAVATANHHATKAALQVLREGGNAIDAAITAVLVLGVTEPYSAGLGGGGFALVHHQGSGTTRAIDFRERAPLRASRDMYLDPQGN--PTADSVTGWLAAGVPGTAAGLSHLHGLHSTMTWERLVAPAQQLAKNGFQVTPLLEARIQRRADLLVDPEMQRLFAPGGKPLKAGQTLIQTDLAKTLERMAKNGRREWIDGATTRRIVEAMKANEGLIQTNDFAAYQVKERTPIEGSFQGHRILSFPPPSSGGIHLVQMLLMLEASGLP--GTDSIDFRHRWIETMRRAYQDRARHLGDPDFYPVPQEGLLSPSHLKALRQSIKREGATPSQDLNNPQPQPHHETSHLSVLDRRGNAVS. 394
297 0.000e+00UniRef50_O05218 Glutathione hydrolase-like YwrD proenzyme n=410 Tax=Terrabacteria group TaxID=1783272 RepID=YWRD_BACSU  ali  29  3...................................KSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSAIPLRGIDS-----AITVPGMVDSWDAVLKEYGRLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASPYTADIFTRRGKAPVPGERFVQKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYRGYSVYQA-PPNSQGFTGLLTLNILENYDFTQIEHGSFEYYHVLVEALKKSFLDRDAVLTDPAFADIPLERLLDKRYAKQLAEEIGYLAIPAESRP------VGSDTAYAAVIDADGNAVS. 353
298 0.000e+00UniRef50_A0A1V5G2G8 Gamma-glutamyltranspeptidase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A1V5G2G8_9PROT  ali  31  4MMRAAMLVVACCATSALAADTVAPLRP----------------AIATSNAQATDAGMEVLAAGGNAFDAAVAVSAMLGLVEPESSGIGGGGFFLLHLASENRVVFVDARERAPLASSADMFLDKDRNPIPKG-SIDGPLAAAIPGLPAGLVHVSRKYGRLPLARSLAPAIRLAREGWTFSRKNAEMMAWRVQALNDPGSAGVFLPGGQVPKVGQKMFNPDYARTLELLAAHGEKGFYAGRYASQLVAGVRAGGGIWSETDLANYQVVEREPLRIQHRGFEIITAPPPSSGGIALAEVLNILDGYRYTDLQPF--QRTHLTIESMRRAYRDRAIYLGDPDFVEVPVAMLMSADYAAGLRASIHPHRATPDLLPGVGESIERDDTTHFSLLDTDGNLV.. 382
299 0.000e+00UniRef50_A0A2R6F0L3 Gamma-glutamyltransferase n=4 Tax=Halobacteria TaxID=183963 RepID=A0A2R6F0L3_9EURY  ali  47  42.......ATIGASAIPAAATGVAGEESSESGAERVDIARSSEGMVSTVHPQATEVGAEVLRDGGNAIDAAVATQFALNVVQPHSSGIGGGGFMVVYIAEEDELYTVDNRERAPLGANAEMFLDDEGEPIPFDERITLGEAVGVPGTLRATDVATKRYGTRYIDELIEPAIELAERRVTVDEYLAGAIEEEKGKFND-AARERFAPGGEALDAGDELVQEDLAETFRLIRDEGIGALYGGEIGEAVADVVQDNGGSMTVDDLARYNVTIDTPEYGEYENVAVRTQPLPSSGGLTIAQILKLIEAFDLGGYERESAETFHALIEAFHLAYADRGAFMGDKAFADAPWQGLLDEEYLEERRGRITFDEATANAEPGDPWAYQPGNTTHFTTADSEGNLVS. 467
300 0.000e+00UniRef50_A0A251V4U7 Putative gamma-glutamyltranspeptidase 1 n=153 Tax=Spermatophyta TaxID=58024 RepID=A0A251V4U7_HELAN  ali  28  75....................................AVESLEAVVAADDARCSEIGVSILRAGGHAVDAAVSVALCVGVVNPMASGIGGGGFMVVRSAATSRSQAFDFRETAPAAASQNMYQNNLDNKYN------GALAVGVPSEIAGLRKAWLEHGRLPWKTLFQPAIRLAKDGFIVAPYLASSISSYAATIKDPGLQKVYAPNGELLQAGETCYNHQLGLSLEAIAEGGLEAFYNGPIGEALVNDVRAGGGILTMDDLRNYEVKVTDALEVNTMGFNIFGMPAPSSGTLGLALVLNILNGYE-NTDDAKGMLGLHRFVEALKHMFGLRM-NLGDPDFVDITASEMLSPSFAKKIQGRIFDNTTFPS-EYYMPSQIQDHGTSHFCIVDADRNAIS. 431
301 0.000e+00UniRef50_A0A1F4DLG6 Gamma-glutamyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A1F4DLG6_9PROT  ali  26  3...................AQEQSDGSTTPSRTLRPVVRGTRYAVSSMKLQATEAAVRILEAGGNAFDAAVAGQAVLALVNPESNGFGADAVVLVYDAREKKVHSINAEGTAPRLATIDWYNKNNGGRIPNSD---GLLSASLPGVIDAWYIMLDRWGTMSFAQVLERAIDVAENGYPIGEGLSRAIAGSKKIQKYPTTMKVYFPNGRAPQPGELFRNPDSARMLRKLAATGRDRFYKGDIARTMGDFSEKNGGLYRYEDFAGYTAKVETPVSTTYRGYEVYKNT-SSSQGPAELFMLNILEGYDLKTMGHNSPGYIHASAEALKLAFADREQ-LGDTDFVRIPFEGLLSKTYAAERRKLIDSNKVSLEIRPGNPADYSEGDTSYIAVVDQDRNMVS. 410
302 0.000e+00UniRef50_UPI000DD3AE56 gamma-glutamyltransferase n=1 Tax=Piscinibacter caeni TaxID=1861917 RepID=UPI000DD3AE56  ali  38  49.....................LPPTDEAVPAPPAWDGVAFRGGVVAVSHPLAAQAGRDVLARGGNAVDAAAAIQFMLNVVEPQFSGIGGGGFMMIHLAHRHRTFAIDGREKAPAAATPTQFLTDVPAAQRFTIASTSGLAVGVPGTLAVVDHALKRYGTIRLAEALAPAIEVAEKGFRINRFLAANIAGDGGRTGFPETAALFRPGSVPLAEGALLVQPDLAKTFRLIARHGPKVFYQGEIGQALVAAQQRSRGRMTMQDLADYRVVERDPVKVDYRGWTVADMAPPSSGGLTVGQMLEMVERFPIGGFGFGSPTTLHVMTEAMRLAFADRAVWMGDEDFVPVPKTGLLNPEYVASRSAMINTSSRMATPAAGNPLPYDSSHTTHFSVVDKWGNVVS. 459
303 0.000e+00UniRef50_A0A0S4M339 Gamma-glutamyltranspeptidase n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A0S4M339_9BACT  ali  32  1MMRLLPFFLVLLCVFNEVHANIPRVPEVSSGFHLKKLAYSKRGMVVTANFLATRTAKEILKIGGSAVDAAIAAELVLNLVEPQSSGIGGGGFMTIYDPKTKKVTSINGREVAPSELDLKRWKDDKGRWYSFDHLILSADGVGVPGELAMLYRAHRKFGRLPWAKLFQPAISLARGGYPVAHRLALQLAEESMLWNDREASKLYRPGGKIVREGSILHNYALANVFEDVAKNGIVNFYQGRWAEDIVEAVNSRAGIISLNDLKNYRATESLALCGKYRDWKVCSSRLPSSGADVILAWLGLIEKSPFHHLPPNSPLAWHWFIESGRAAYVDRNSYAGDPKFDKDLTSVLLSTKYQDSRLKDIS-GKATVDLKPGRAVSLERPSTSHISVVDSSGQAVS. 408
304 0.000e+00UniRef50_T0RQS9 Gamma-glutamyltransferase n=5 Tax=Bacteriovoracales TaxID=2024979 RepID=T0RQS9_9PROT  ali  34  23...................TQVILADPGAGQTREAHEAKGQKYMITTQGVYSSKAAKKMFDMGGSIADAAAAASFVLAVERPQSTGIGGGGFLMYYDAKKNKPWAYDFREKAPINAKQDMFLDKDGKVM-AKKSIDGIYAAGVPGMVAGIVDFHHRFGKLPLNTVMAPAIELANKGFKVYPELAKALEFRAPILRFSASKKIFFKKGEYLKEGDLLIQKDLATTLSKIAKYGANGFYKGDVANKIIAENQRLGGLLTKEDLQKYNVVVRRPVSSTYKDYEVFSMSPPSSGGVHVVEILNIIEKDNLKEYGPHHPKTIHLVSSAMQASFVDRARYMGDADFVEVPVMGLTSKKYAKDVRYTIPESRALNKMWAGNLDPFEHDETTHFSIMDGEGNVVAS 414
305 0.000e+00UniRef50_A0A2D7BVZ8 Gamma-glutamyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2D7BVZ8_9GAMM  ali  32  16........................SQEYLEYSHPFHPTVSDKGMVVSQNYIASDIGAEILSKGGNAVDAAVAVGFALTATLPRAGNIGGGGFMLIYDAKNQTIVSLDFRSMSPELATPDVFRKDG--EHQSSLSRSGYKAIAVPGTVDGLFTAHELYGSMDMKDLIQPTIDLCIEGIPLTNDLYGAIQNTKTLTRDKESTRVYLDEN--LKVGGKIKLLDLAETLIKIRDEGKAGFYDGKIADKIEKAMIENGGLIRKSDLKRYKTNITQPISIEYRDKSIFAQGPPSGGGVVILTALQILKNFNYSDLKPNSAQYLHILAESLKHGHQNRSKFIGDPKFYSAPLEDMLSDDNGIRRAKEIDFKKTTSSTRSIESDYKESEDTTHYSIIDDSGNAVS. 390
306 0.000e+00UniRef50_A0A257CRN1 Gamma-glutamyltransferase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A257CRN1_9BURK  ali  32  8.RWRFLVALCVAGVSACAAERIAALDAPPTFLSPASASVAKTGAVAAANPLATEAGQQMLRAGGSAVDAAIAVQMVLALVEPQSSGLGGGAFLIHFDGK--QVQAFDGRETAPAGVTATELMGSNGQPMARMQAIVGGRTVGVPGTLRMLELAHRQHGRLPWAALFAPAIRLAQQGFAISPRMASLVADDKHLHKDPVAAAYFYDDGKPWPAGHVLRNPELADVLQAIAKQGADAFMQGEVAQAIANKVQTNPGKMTLKDLADYRAVVRAPLCFDYHTYRICGMPPPSSGTLAIGQILNLLGNTPTAQAGLPPADWLHLYTEASRLAFADRDHYVADPDFVQPPWQSLLQPGYLAQRAKLINTSPRMADPAPGKPGPSDEAGTSHISVIDAQGHGV.. 439
307 0.000e+00UniRef50_A0A2H5W426 Gamma-glutamyltranspeptidase n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W426_9BACT  ali  31  26.RYWLFCSWPLVLCSWLFVLC------PLPGEAAEKVAFARRGVVVCENPRAADIGADILRQGGNAVDAAVAVGFALAVLFPQAGNVGGGGFMIIYRPDS-EAYALDFREQAPSQATPDMYLDPAGNVIP-DLSTHGYLAVAVPGTPAGLFEAHRRFGRLPWPRLLRPAIELAARGFETDTSLYLALRRDRDRLKDPEFARIFFDGTEPKG---RIVQPELARTLRTLAAQGAQGFYTGWVAEAIEEAMRRHGGRVTREDLAEYRPLWREPVQFSVGDATVFSMPLPSAGGWMLKFMFTVLENLRTPDVGWHSALHVNLVVEAAKQAYAERAHHMGDPDRVPFPT--FLDPAYFRAMAQKIRPYRVQPAEPTLRPLYEESPETTHYSVLDAQGMAV.. 412
308 0.000e+00UniRef50_A0A2E9UED6 Gamma-glutamyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A2E9UED6_9CHLR  ali  33  5............................STWRPNKDEVISKNGVVASMHPYASEAGIEMLRKGGNAVDAAVATGFAISVLEPNNSSIAGVGFMHIYPA--GTNVVIEYGPRAPKAAKPDMYKGPGGGSVEGNHNTDGYQSIALPGTTAGLCKAHETFGELPLEQVMEPAIHYAKEGYDVYWLLALMIGTNMEQLKFHGSKEIFLPNGFPPKEAYKFKQKDLGNLLEKISKEGTDALYKGEIAAAIAEDMKKNDGLITMEDLAEFKAEIKIPLKTTFRDYEVYGPTAPC-GSWTTLETLNILENFDLKAMGHNSTKYLHTFVEGARHAFADRYHYLGDPDFVEVPLKGLLSKEYSKEISKKLNLNEALENSYTGDPWNYDSDCTTHFGTSDKYGNLVS. 424
309 0.000e+00UniRef50_UPI0009FA934B gamma-glutamyltransferase n=1 Tax=Mailhella massiliensis TaxID=1903261 RepID=UPI0009FA934B  ali  29  31.RRFMTMLLAGIGLTTVCFSPAAGFEYKSEKHLSKAAVFAKNGMVASAHPLASRVGVQILEQGGNAFDAAVATALTLSAVDMAMCGPGGASFWLLWNAKEGRLYALDADTQAPAAATPDKFADR-------SELLSGLKAMGIPGNMMAYCTVLEKFGTMPFGKVAEPAIRYLEEGFVLSQRQSHNTQAAQAPMMYPNLARVFAPEGEWPDAGTLMKNPELAATYRTIAKEGVDAFYKGSIADEMIRYMKENGGLWTREDLANYKVLWVEPLHMKYKDLDVYGMPPPSSS-VTWMEALKIAEGFDWSKIADNSLEYLHLMVEIERLAHADSYEFVADPKFVESQAKNLLSDNYAAAQRLRIDRTKAAPKVQPGKPAEWESGNTNHVVVVDKDGNCVS. 450
310 0.000e+00UniRef50_A0A2E6D5W1 Gamma-glutamyltransferase n=5 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E6D5W1_9BACT  ali  33  24...........LWAIGLLWVAACRTPDPLAQLSTSPLP--SRGAVVSEHPLATAVGLHFLERGGNAADVAVATALTLAVVLPQAGNLGGGGFAL-WVPAEGPAKSLDFREQAPAGYEAHLYLDEAGEVV-GERSLGTPLAVGIPGSPKGLFELHRLFGRFTFKELLAPAIRLAGEGFRVDPWLAGAWQRKGRLTRDPAASRLFFPDGEPLLAGEILKQPQLKLTLEELARGGPQVFYQGPVGTAMLNALRRMNGVMTPQDLMNYEVKDPEPLVGWFRGHQVIGMGPPSSGGLAILQVLGILEGFPLGAEQHLTPRALHWWIEAMRCAFADRAQHLGDPEFHSVPVKELLSPAWIAERRVSIG-ERARPDVQPLVVAGEESAETTHLSVVDRAGNAVS. 427
311 0.000e+00UniRef50_A0A1E7WI41 Gamma-glutamyltranspeptidase n=1904 Tax=Bacteria TaxID=2 RepID=A0A1E7WI41_9BURK  ali  34  39........................APEIATGYAEKAGKSSQKFMVAAANPLATQAGYQMLKQGGAAIDAAIATQLVLTLVEPQSSGIGGGSFLLYSDGK--RVQSYDGRETAPAAADEHLFQDKDGKPVSRETGVVGGRSVGAPGVLRMLELAHQQHGRLPWKALFAPAIKLADDGFAVSPRLNALLKWDKYLARDPVARAYFFDDGQPRPVGYILKNPELARTLREIADGGADAFYKGRIARDIVAKVSSNPGKLTAADIAGYQARERAPICSDYKAWTVCGAPPPSSGGIAIAQMLGILEVKDISPYGMLTAEGIHLFSEAGRLAYADRNRYVADTDFVPLPVSALLDKRYLAKRAALIG-DKSMGRANYGTPDAIDKPSTSHLVAVDAFG..... 425
312 0.000e+00UniRef50_A0A2I4GRN1 gamma-glutamyltranspeptidase 3-like isoform X1 n=41 Tax=Eukaryota TaxID=2759 RepID=A0A2I4GRN1_9ROSI  ali  30  67.....................................IESDQGVVAADDGRCSEIGAAMLRQGGHAVDAAVATALCLGVVYPMASGIGGGAFMIVRSSSTSKTQAFDMRETAPLAASQNMYENNPKSKVA------GALAMGVPGEIAGLHQAWLQHGRLAWRTLFQPAIKLAKDGFVISPYLRQHMTKVAKVINDPGLRQVFAPNGKLLQAGDACYNIELGRSLEAVAEQGPQVFYNGTVGEKLVKDVREAGGILTMEDLRSYKVDVTDAMAADVLGYTIVGMPPPSSGTVGLSLVLNILDSYGNSNAVRGS-LGLHRLVEALKHMFAVRM-NLGDPNFVDVYVSEMLSPSFAKEIQQKIFDNTTFPPEYYMSRWSLRDHGTSHFCIVDADRNAVS. 422
313 0.000e+00UniRef50_A0A0S4PPP6 Gamma-glutamyltranspeptidase n=1 Tax=Armatimonadetes bacterium GXS TaxID=1661582 RepID=A0A0S4PPP6_9BACT  ali  28  3.................................SRSAVAAARGIVASSQPLAVSAGLQMLQAGGSFVDAAIATSAVLCVVEPWASHLGGDAFVVLYDARQRKTVALNGSGAAPARANPDAF--------PNGIPLRGLSAATVPGLVDAWFRLHALYGRLPIAKLLEPAITYARDGYPISPRKAQIWRNAS---RDRVLRTVLLHQTRPPQAGEKVRCPDLARTLQAIASGGRDAFYKGEIAQKMVNFSKQNGGLFEREDFEAHQSELREPLRIGYRGYTVHG-QPPVSQGIILMEALGILDGVPLKEISP--ADRTHWMVEAIKCAFADRWRYLGDPRFVPDRTAELLSPEFLARRREAIQPTRAQEIPSPG---TLRETNTTYFCVADEEGNAIS. 352
314 0.000e+00UniRef50_A0A139AE70 Gamma-glutamyltranspeptidase n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AE70_GONPR  ali  30  1...........................................MTAAEIKACSDIGVDVMKDGGNAVDAAIATSLCVGTFNSFSTGIGGGGFMLIRTP-SGKAEVIDFRETAPGAATQDMYSKFPQN------ATRGGLAIGVPGELRGYEMAHKRHGRLPWKRLFEPSIKLAREGITVTDYMEHAFNYTSSLLNDPVWRSVFAPNNKLLKAGDVFTRPAFARTLEIVANKGADAFYRGELAESIVSTIRQNGGIITLGDFYNYTAVVREPVVGWYHGRKIITAGPPASGALLTA-ILNILEGYDLKA-ERKTDLNVHRLVEAFKFAYAFRSE-LGDPSYWPNSVKMWNDKAHAEEVRVGISDFHTFPPEHYGKFSAEETPGTMHVSLVDKEGYAV.. 348
315 0.000e+00UniRef50_A0A2H6B3J7 Gamma-glutamyltransferase YwrD n=218 Tax=root TaxID=1 RepID=A0A2H6B3J7_9BACT  ali  28  7................................PGRSTVYARGGMAATSHPFATLAALEILRRGGNAVDAAIAACAVQGVVEPQSTGIGGDCFALFAPASGG-VVALNGSGWAPAAASSERLSALGLERIEAE----SPHSVTVPGAVAAWELLQRQHGRLSFAEVLEPAIGYARDGFPVFPRVAFDWQRGEARLRRPAAADAYLPGGAAPAPGQIVRLPALARTLEILAQRGAEAFYRGELASRMVATLKGLGGLHEEADFAEFAPEFVKPIHASYRDILVYEC-PPNGQGLVTLLMLNILEQFDLGRLDPHGAERFHLEAEATRLAFRDRDAFLADPRHAPVPLEELLDKAYAAKLAKCIDPERAIGNLPP--PLLRDVGNTVYIAVVDEERNACS. 364
316 0.000e+00UniRef50_UPI000B784951 gamma-glutamyltranspeptidase 3-like n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B784951  ali  28  18..KFVFSFLALFVITGLAFGSTKTSLNGKPQVDVPEIVESGKGIVAADDRRCSEVGALMLRLGGHAVDAAVATALCVGVVNPMASGIGGGAFMVVRSASTSEALAFDMRETAPLAASENMYDND------LAAKLSGPLSMGVPGELAGLHEAWKYYGRLSWKTLFEPSIHFAENGFEVLPYLEKNILKHEKMIRDPGLSQVFAPNGKLLQTKDICYNVKLAESLKAIADQGPPAFYNGTVGKKLVKDVREAGGILTEEDLRNYKVKVTKALAADVMGYTILGMPPPSSGTLGMTLILNILNNYG-SPNAIEGPLGLHRLIEAMKHMFAVRM-NLGDPAYVNITMSDMTSTSFAKEIWRKIYDNTTFPPEYYLSRWSLQDNGTSHFCIVDAERNAVS. 416
317 0.000e+00UniRef50_A0A2D9SLQ1 Gamma-glutamyltransferase n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D9SLQ1_9GAMM  ali  31  4.KTFSYLTLFSLVIAHAGCGPAQEEQSPESSLINAQSLTSGVAAIAIPDKYAAQISQDILSAGGNAVDAAIAAGFSLAVTFIDAGNIGGGGFMTIKM--DDEVAFLDYREKAPMAAHRDMYLDPEGNVIEHST-LIGAQAAGVPGTVAGFWQAHQRFGSMPWKDLLLPAIRLAEDGFIPAPVLVDDIHSVNDWFGDTNFNRYFA----AIQHDRIFRQAELADTLKRIAELGADDFYRGETAKLIVAQMNKANGLISIDDLDNYQAVWREPLWAKWREYEVISAPPPSSGGFAVIQLLKMLSHL-FKDVEHNSAQYIHLVAEMEKRVFADRAEYLGDPDFVDIDINALITEDYIKRRAAQVS--ATTISELKGVSPGLESPNTTHYSIVDARGNAVS. 393
318 0.000e+00UniRef50_A0A0B7FPL8 Gamma-glutamyltranspeptidase n=6 Tax=Basidiomycota TaxID=5204 RepID=A0A0B7FPL8_THACB  ali  31  1....MLLSTITYLGLASLVSASPVYHLPPGLVERETSSYGKHGAVATEVKECSDLGVELLKKGGNAADAMIGAQLCVGTVAAYHSGIGGGGFMLIRSP-NGTYETIDFREFAPGAATELMYVNKTGSP-----SQVGGLAVAVPGELRGFEALHKRHGKLPWKKIFEPVIKL-SKGFQVSRELAKVLTGNLTYINDPLWAAVYAPNGTVAVAGQTIRRPTYAKSLQRIAKEGVDAFYTGSIAKNIISTAQTNGGIITLDDLKKYKVIIRKPVQIKYRNYTITSCPAPSS-GIIALSALGILENFDISN-SSSINTTTHLLDEAIKFAYGQRMS-IGDPAFVKN-VTDLLQKSTSKELADRISLSTTFPSY-YYNPENYRESGTSHLVTADASGLVVS. 389
319 0.000e+00UniRef50_A0A223EQ44 Gamma-glutamyltransferase n=2 Tax=Bacillales TaxID=1385 RepID=A0A223EQ44_9BACI  ali  29  3...................................KTIVGSKTMVVSPHYLASQAGNSILQKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTYSVKDQKVRAYNGSGRSGSKLTREVFKGKKSIPHRGVESI-----ITVPGMVDSWDAVLTEYGQLSLAEVLEPAIQYASIGFPFSKDQHENTVKNADLLRDPDTAAIFLPNERIPDLNERFVQTNLATTLKDLARYGREGFYKGELAARIISSLKEKGGMLTLEDFANHQGVWTDPLSTSYREYQIYQV-PPNSHGFVGLMALNILENFDLSLIPEGSYEYYHLLVESLKRSFQDRNAVLTDPDFHSIPLEQLLSKSYAKEIADSIDLHIARDIQT-----QSVGSDTAYAAIMDEEGNAVS. 354
320 0.000e+00UniRef50_A0A0K1J8L5 Ggt protein n=7 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0K1J8L5_9RHOO  ali  30  5MLRVSVCLLVCVIANVAPLPAAAHTPAITGGFDPKPAVQAPHAVAVTANRHATDAAIAILRQGGAAVDAAIAAALVLNVVEPQFSGIGGGGFLLHFDARTARVAAWDGRETAPMAVDERLFLKSDGEKMAFYDAVVGGRSVGVPGLLRLFEQVHARHGKLKWATLFAPAIRLAGEGFPVSPLLHGLMVRDRYLAQDPASRALFFNAAVPLAVGTTLHNPELAAILQQVAEEGVDAFYRGAIARDIVAAANANPGKLSLDDLAAYRAIERTPLCASYRAHRVCGMPPPSSGGATVLAMLGLLERFRLADIPSDSAFAAHLFSEAGRLAFADRDAWYGDPDAMMVRPERLLDRDYLGRRAEQIRLSGSIGRAAPGMPTPAELPATTHLSIVDAYGNAVS. 416
321 0.000e+00UniRef50_B9TF82 Gamma glutamyl transpeptidases, putative (Fragment) n=1 Tax=Ricinus communis TaxID=3988 RepID=B9TF82_RICCO  ali  37  27...................................PVATGTGGAVATISEPASQAAIAILNKGGNAVDAAVAAAATLGVTDPFSCGIGGGGFMVIYLAKDKRVITIDHRETAPASFTPTVFQ-KDGKELDFDTVVASGTSVGVPGTVRGWHEALDRYGSMSFKQVLAPAIDVATKGFTVSDNFSHLVQGNEAKFAFPATAALYLRNGKALPAGATLRNPDLAKAYRELAAGGVKAFYSGRMARAIVDAVNTAAGKMTLADLSNYEARLRQPVHSTYRGYDLYGMPLPSSGGVAVAEALNILEGYDLKAMPRAQAE--HLYLEASRLAFADRNAYLADPEFVDAPVAGLLSKEYAARRRELINPQQASAQAPAGDPYPFQ................... 377
322 0.000e+00UniRef50_A0A2V2S9F4 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2V2S9F4_9BACT  ali  32  4.RRCPAVALNRIVRSGLLLTVFLAAHAI---FAGSQSVRSRTGMVVSGSEVASRVGADVLREGGNAVDAAVATAFALAVTLPSAGNIGGGGFLLYRS-TNGQAGAYDFREMAPAAASQTMFMTNG--KYDPGLHHDSYLSVGVPGTVAGLYLAWSEQGSKSWARLVEPAIKLARDGFKVTDGLAHSLE--QELLKETTNQAAFTKAGRLYTAADTLKQPVLAATLGRIAKEGPAGFYEGATARAIDQEMRANGGLITLQDLKNYKARSVTNIRGTYRGYEILSMPPPSSGGVGLIEMLNILEGYDLAAMGWGSATNIHRIVEAMKRAYADRAHYLGDPPFTNMPPSRLVSKEYAASLRQTIRDDSSSPSAL-DFSWPNESHNTTHLSIVDEARNAV.. 400
323 0.000e+00UniRef50_A0A0X8HEB8 Gamma-glutamyltranspeptidase n=41 Tax=root TaxID=1 RepID=A0A0X8HEB8_9GAMM  ali  33  24......LPLVALADVTFEYSAPAIEPEQASGYTEKPGWATERFAVAAANPLATDAGYQVLRAGGSAVDAAIAVQMVLTLVEPQSSGIGGGAFLMHYDGSD--VTAFDGRETAPRAASESLFLNGDGEPLEFMDAAASGLSVGVPGTVRMLELAHDEHGKLPWAELFAPAITLAEEGFAVSHRLHTSLAG-EERLRDDAGAFYYTEDGEPLAEGHKLKNPALAAILREIAEHGSKAMHTGSIAEDLVHRVQGHPGAISLEDMATYVALQRDPLCTDWKAYRVCGFPPPSSGHLTIMQILGTMEHLPPVEEGQPSVEWWHRFLEASRLAFADRGKYIADPDFVDPPWSTMLEPDYLALRAESIEEQSMGPDARPGRPGKLETSGTSHISIIDEEGN.... 431
324 0.000e+00UniRef50_UPI000287DA02 gamma-glutamyltransferase n=6 Tax=Bacillales TaxID=1385 RepID=UPI000287DA02  ali  29  4....................QFNRGAHLGSLVTGRPPAIGRKGAVTSPHYLATLAGYDLMKKGGHAVDAAIAINAVLCVVYPHMAGIGGDLFALVWDNPRSAIRALNGSGAACGRATRRFYGENGHSSIPSRGPLS---AITVPGAVDAWHSLHAEYGKLPWKELFAPAIDYAQNGFPVTFKLSRFLHRFQDEISRHEAARMLLPGGTPAKPGDMMRLPDLGLSLQQIAEQGAEVFYQGELARTITGKLEQAGGLMRLDDFQAHRSTWEPTISTTYRGYEIHQTQ-PNTQGIAALMILNYLERFDLSEVGDQSAEYYHLMAEAAKLAFTYRDRWVTDPKHLDIPIKELLSKDYVEEVLKHLDMNKAGDREKHREPHIGVNRDTVYMAAVDDEGNAVS. 379
325 0.000e+00UniRef50_D1C3G5 Gamma-glutamyltransferase n=3 Tax=Chloroflexi TaxID=200795 RepID=D1C3G5_SPHTD  ali  32  6.................................GRPTTLAVEGMVATPHYLASVAGLRALQSGGNAVDAAVAANAVLTVVYPHMCALGGDAFFLIWEPGEGRLHALNGSGRSPAAASIDALTAAGHTTMP----QRGALAVTVPGTVHAWETVLDRFGTFGLSDLLQPAIAYAERGFPVSPGLHAAIAQARPLLQQDAAARQFLPGGKVPAVGDVLRQPDLAASLRLIAGRGADAFYKGAIAQSIVDSLREHGGLMTLDDMAVHRSDWVEPLRTTYRGVELVEL-PPNTQGVTALQMANIVEGFDVAGLGYGSAELIHRCVEAKKLAFVDRDRYITDPERVPIPIERLIAKEYAAELRQRIDPDRAWTP----EADSPGGGDTVYLCVVDRNGMAVS. 361
326 0.000e+00UniRef50_G7G726 Gamma-glutamyltranspeptidase n=156 Tax=root TaxID=1 RepID=G7G726_9GAMM  ali  35  34...........................................AVAMPDSFSADAAKSILEQGGNAVDAAITAQFVLAVTLPEAGNIGGGGFMLI--QKDGKGDFIDYRETAPTAAHRDMYLDDQGNVI-ANKSIYGIHASGVPGSVAGMWLAHQKHGTLKWETLVQPAVTLAEQGFVVPPKLAHYIAHLKEQKINVNFEKYFAD----VKANKVFKQPELAVTLKRIRDNGQDGFYKGETANIIAKFMHQHGGIINQDDLKNYTAKSRTPIKASWNGYEVLTSPPPSSGGIAILQWLKMYEQKPDAGLAHNSTQYVHLLSEIGKRVFADRAEYLGDPDFFDVPVSALTNINYLKERSNGISLTATTESIKPG---LKESEQTTHFSIVDKMGNAV.. 383
327 0.000e+00UniRef50_A0A2H5WUJ1 Gamma-glutamyltransferase YwrD n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5WUJ1_9BACT  ali  30  3.................................SRSVVVAEQGIVASSQPLAVSAGLHILRIGGSFIDAAIATSAVLCVVEPWASQLGGDAFAVLYDAERGQTLALNGSGAAPAAAKPDRF--------PNGIPLRGITAATVPGLVDAWGRLHALYGKLPLARVLEPAMEYAREGYPISPRKESIWRNAA---RNRDLRPVLLHLNQPPRAGERVRCPDLARTLQLIGEQGRDAFYKGEIARRIVEFSRQQGGWFEPEDLARHSSEVREPLQVNYRGYTIH-AQPPVSQGIILAEALAILNGVNLREL--NPVDRIHWMVESIKCAFADRWRYLGDPRMVSDHSSSLLSPEFIASRREAIQPMRAQEIPAPG---ALRETNTTYFCVADREGNAVS. 352
328 0.000e+00UniRef50_A0A2A8CXC5 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2A8CXC5_9BACT  ali  32  41.................................ARSPVVAPNGIAATSQPLASQVAVDVMKQGGNAVDAAIAANAVLGLVEPTGNGIGGDLYAIVYDPETDEVYGLNASGRSPQNLSYDELKDELGDR--DEIPLVGTLPVSVPGTVSGWDKLHERFGERSMADNLAPAIQYARDGFPLSQVIAYYWASNQGTLMDDNWRDTYLIEGRAPKEGEMFRNPDLASTLEMIAENGADAFYEGEIAQTIDAYMERIGGHLTAQDLADHTADWVEPESVTYRGVEVFEL-PPNGQGIAALQMLQILEAYDLEDMGHNSTDYLHVQTEAKKLVFEDRARFYADPDFADIPIDELLSEEYAAERRSMIKMDGVLSEPGHGEPRALEEGDTIYMTVADKNGMMVS. 420
329 0.000e+00UniRef50_A0A1G5SHW5 Putative gamma-glutamyltransferase YwrD n=1 Tax=Nitrosomonas mobilis TaxID=51642 RepID=A0A1G5SHW5_9PROT  ali  32  4...........................ANGPRTGRPPTLASNAMVTSPHYLASASGLQALRAGGSAVDASIAINATLCVVYPHMSGIGGDAFWLIAGAGVQGVEALDASGPSAQAATIDYYQQRGHT---DSIPSRGALAATTPGVVDGWRVAHERHGLLPWADLFQDAITMAREGMPVTRSLADWLAADEHLLKYSTTADIYLPGGKVVREGARLVQSDLANTLEIIAKHGADGFYEGEIAKNLCKALQEAGSPLRQSDFSEYQAKWVTPISTFYRGHQIYQM-PPSTQGFANLQIMNLLEGFDVASWGEGTADYYHHIVEAIKIAFADRDEWLTDPSFVDIPLDQLLSKDYADKRRALISSKRAAQDLKPG......................... 350
330 0.000e+00UniRef50_D1Y4L9 Gamma-glutamyltransferase n=24 Tax=Bacteria TaxID=2 RepID=D1Y4L9_9BACT  ali  40  28.....................................VYAEHGMVAAAHELAAKAGVEILQKGGNAIDAAVATALALNVVEFNASGIGGGGFMTFYSEKTKDVICLDYREQAPASATKDMFASEQAKKEKW--SAYGGKSVGVPGWLKGMTYALENYGTMTFAQVAEPAIRLAEEGFVTDPAQKGFIQDHFETLNQPGTLPFFDEVGLPIEGGTLLKQPALAKTFRLIAEKGIDVFYKGEIGEAICRAVERTGGKMTMEDLASYRMYVRKPVVGTYRGYRIYSVPPASSGGTHVVQLLNIMENYDVKNLGFKSAKKVHVFGEATKMMFADRSKYMADTAYAKVPLAGLQSKEYAKEEAGRIT-DAIVDKPEAGDPWKYDTAETSSFSVADQFGNVV.. 400
331 0.000e+00UniRef50_Q01SQ9 Gamma-glutamyltransferase n=30 Tax=Bacteria TaxID=2 RepID=Q01SQ9_SOLUE  ali  29  1MYHFGIMRLLVIFLLASLGSAQDRSQA-------RSMVLSDRGIAATSQTLASQAGAQVLARGGSAIDAAIAANATLGVVEPERGGIGGDLFVIYWEAKTGKLTGINASGWAPKGLTIDALKAMGNTSMP----QTGIHAVTVPGCVDGWAKLHQKFGKLPWKDLFAPAIYYAKNGFPVTEIIHETWEESAKLAADVNGRRVYMKNGETPKLGEIARNPELAAAYELIAAQGAAAFYKGAIAKAIVKTSERLGGKMSAADLSEFASEWVTPVSTEYRGWKVYEL-PPNSQGIGPLEMLNIMSAFPMGSYAPRGVEELHAQIEAQKLTFADLHRYLADPRVSKVPVEGLIAPAFGRERAKLIDANRARCEETPGAPDTV-AGNTVYLSVVDREGNIAS. 385
332 0.000e+00UniRef50_A0A2R6EMZ9 Gamma-glutamyltransferase n=1 Tax=Halobacteriales archaeon QS_1_67_19 TaxID=1919167 RepID=A0A2R6EMZ9_9EURY  ali  49  1...........................................MVSSVHPEATRAGRRVLENGGNAVDAAATVQLVLNVVQPHSSGIGGGGFMLVYDAHEDVTYAVDNRERAPSGADPEMFLGEDGEPIPFDQRHMSGQAVGVPGTLRAIDVALKRFGSKSLSELIQPAVELAAPGYRVDRYLADTIAEDVDNFND-AAREVFAPDGEPLQTGDSLVQPDLAKTLRLIRDEGVSAFYQGEIAEAIAETVQQNGGTMTTNDLAAYNATMDHPDHVEFEDVVVRTMSLPSSGGLTVGQILTIIEEFDLEQFGPRSVERYHTLIETFHRAYADRGEYMGDKQFVDAPWQGLLDEDYTDQRRSEIPLSRASPPWEPGDPWAFQPGE................ 342
333 0.000e+00UniRef50_UPI000BA23224 gamma-glutamyltransferase n=1 Tax=Altererythrobacter mangrovi TaxID=1982042 RepID=UPI000BA23224  ali  31  1MFKRFVTSLAIPLTLGACATAPYPEIRAVQTTNATP---YTRGIVSAADPRAAAAGVEMLRKGGSATDAAIAIMLSLTVVEPQSSGLGGGGFYVHTDP-NGNLDTIDGREKAPAAATPNRFLKPDGEPMDFRTAVESGLSIGVPGSLRVAEEAMRKHGKLPWATVLEPAIRLARDGFQITPRLYSTLLESKSTARTPEGLALFYADGTPKPIGTLVRNPALAETLQQIALHGADWLYTGQNAEDLARTIANSDGKMTAADIESYKVADRPAVCGTYRAYRVCGMAPPSSGATTVLAILGELEPFDLAKLGPKSPTFWHLFAEAQRLAYADRERFLADPDFVPVPVKELTDHAYLLKRGALISPTSTMTDVEPGLPLGPAEHGTSHFVVVDKWGDAVS. 404
334 0.000e+00UniRef50_A0A132BZB9 Gamma-glutamyltranspeptidase n=904 Tax=root TaxID=1 RepID=A0A132BZB9_9RHOB  ali  33  61...................................RPVAAENWMVAAANPLAVEAGADVLRKGGTAADAMIAVQTVLGLVEPQSSGLGGGAFLVYYDARTGQLTTLDGRETAPLAATPRLFQDDAGEPLGFFDAVVGGRSVGTPGTPALLEMAHRKWGRANWGGLFNAAIALAETGFAVSPRMADSIANDADRLRFPDTAAYFLPEGTPLKAGQVISNQPYADVLRAIAADGAAAFYTGPIAADIVRTVQGNPGVLSAVDLALYQVKERPAVCASYRAFEACGMGPPSSGALTVGQILGMLGQYDLAELGADNPDSWRLIGDASRLAFADRGRYMADSDFVPMPTKGLVDGDYLADRARLLAGETALEVVEPGTPESLEFPSTSHISIVDQYGNVLS. 437
335 0.000e+00UniRef50_A0A1Y5RYK0 Putative gamma-glutamyltransferase YwrD n=11 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Y5RYK0_9PROT  ali  27  5..............................FRPGRSVVHCINGAAASSHPLSSLAAVEVLRQGGNAIDAAVTACAVQCVVEPMSTGIGGDCFVLYSPGGSRDVVALNGSGRAPAGLDAAQLQAQGLSSIP----TESPHAVTIPGAIDAWSRLLADHGTWDLARVLAPAITYAEEGFAVTPRVAWDWSRSGSRFSNPETARFYLKDGVAPVAGERWASPELAATLRRIARDGRDGFYKGPVAEDIVGFLNGLGGRHSLDDFASHTSEYVTPISSRYRDHEVLQI-PPNGQGITTLILLNILQGYELSGLDPNGALRLHLEAEATRLAFDARNQHVGDPAHGAVPVERLLSADFAAEQRATIDPERAGRPLDSAGLAAYR--DTVYLTVVDKDRNAVS. 365
336 0.000e+00UniRef50_A0A1Y4NK62 Gamma-glutamyltransferase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4NK62_CLOSC  ali  32  19..................................KPHVSGTCGAVSANNPYAAQAGLEIMKKGGNAFDAAAAVALVLGVVEPYHSGIGGGCFHVFYDSKTGMCHTVDARGTAPANASQDMFLDAKGE-VDLELTEFSGRSVAVPAFYRAMDQLLKTYGTMTWEQVSEPAIRLCREGFYAYARVSNTPEAEHNSREYEGFKELFLNNGKPRQFGELVKNEALADTMEAVARFGVDWFYSGPVADEIVSQVNRYKGVLTKADLEQCRPKEREPVRGSYRGYEIISMPPPSSGGSHLIQMLNILENFDLKEMGFHSADSIHVIAETMKMMFADRSVAMGDPDYVKINLEKILSKDYAKELAAKIDIEKACEYAPSEGIEAKERGCTSNFTVMDREGNVISQ 385
337 0.000e+00UniRef50_A0A265E6P5 Gamma-glutamyltransferase n=15 Tax=Bacillales TaxID=1385 RepID=A0A265E6P5_9STAP  ali  44  25......................................TGRYGMVASAIKEATHAGNQMLDQGGNAFDALIAVQLSLAVVEGMNTGIGAGGFIVCHEEEKNETKVINAHSRAPAELEPECFVYDNGEVIPFDKRSTHGSSVGVPGIMKGLKHLHENYATLPLETLIAPAIELAESDFRVNSLWERTLDLFDHRLG-EEARKKFMPDGKPLREGDTIVQPELAKTLKIIRDEGFDSVYEGEIADAIVEAVQDQGGVMTHQDLINYHVKIEEPLWSRYRGYDIATPAPPSGGGIAVAQQLKILEKLDISQYNPHSVEKYHLLAQTMQLALADKNTHIGDADFHELPMDGLMDEEYITERIQLISEENNARTYEAGDPWKYEGMETTHFTAVDQWGNVAS. 398
338 0.000e+00UniRef50_A0A2V8B9W8 Gamma-glutamyltransferase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8B9W8_9BACT  ali  32  35.................VAIPHGTDQWFAGFPAGRSVVRASQAMVATSQPLASQVGIDVLKRGGNAVDAAIAVAAVLNVTEPHMTGIGGDVFVMIYSSKNKRLEGLNASGRAPRGLSLDYFISRKITEMP----LAGMEAITVPGAFDGWISLLDKYGTMKLADLMAPAIGYAENGFPVMEKTAADWEPEVPKLRRTAAAATFLIDGAAPHPGAMFTQKNLARTLRALAQGGRDAFYRGEIAGAIVEYCRAHGGFLSMQDFASHKSEWVEPISTTYRGHTLFEL-PPNGQGLTALLLLNMLEGIDLRAMRSQPGLYYHTMIEATKIAFADRNRYIADPAFATIPVHELLSKEYAARRRALIDPNTAIDAPASGNIRV--GHDTTYFTIVDRDRNAVS. 408
339 0.000e+00UniRef50_A0A2G4FQU1 Gamma-glutamyltransferase n=3 Tax=Planctomycetales TaxID=112 RepID=A0A2G4FQU1_9PLAN  ali  31  1MKLTICISTLVALFLSCTFSQGAES--------------FNKGVVVSVSQPGSDAGLRVLKSGGNAVDAAIATAFTLAVTHPAAGNIGGGGFMVVHPPQKGEPTVFEYREMAPKSAFETVFNKNDG--------MFTHKVSGVPGTVRGLALAHQRFGSKPWGQLLIPAIELAEKGFPISKQLANSLNGLLATSKFEELQRVFKPTNSLWQTNDILIQKDLGNTLTRIAKFGPDEFYLGTTADLISNEMKIGKGLISKDDLALYQARERNPIKLEYKGYSIYGSPPPCSGTITLGLMLNMIEPVDIKKMGRWSPETFHLLIETMKRAFCERARHLGDQGFIDIP-ASLLDKEFAKKLAAGINPQKATPSADLAKDFNIESDNTTHFSIVDAQGMAVS. 380
340 0.000e+00UniRef50_A0A2G6PYJ7 Gamma-glutamyltransferase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2G6PYJ7_9BACT  ali  36  11.......SVTLYILLFCAWVPVYPEYVIRLGEGDTS---AREGMIASAHPLATQAGLDILKQGGNAVDAAVATAFALSVVEPNASGLGGGGFMIVKMVG-KSPIVIDYREVAPRKAHKKFYYNQEKTF--RELAILGSTAVAVPGMPLGMETALVECGSKTLSEVLQPAIKLAKEGFVVNSKMSDMIFNFMDAISSDDTAAVFFDDGLPLEPGSVLKRPDLQKTFELFCREGVQPFYNGVLAQAITKTLRDQGGLLTLEDLKNYRVFKREPVRGMFRGYEIISMPPPSSGGMHLIQLLNILEQFDLKKMGHNSAAYIHCFVEAAKQVYADRAAYAADPEFYPVPVDNIIDIRYAKSISQHIKPDHVNRDVKAGAFL-RSGSDTTHLSVVDKSGNLV.. 394
341 0.000e+00UniRef50_A0A2W5BXP2 Gamma-glutamyltransferase (Fragment) n=1 Tax=Sphingomonas hengshuiensis TaxID=1609977 RepID=A0A2W5BXP2_9SPHN  ali  35  1MKKLILALSATLFITASATDARVKAPSAKA---------SAKGIVSAADPRAAEAGREILRAGGSAADAQMAMMLALTVVEPQSSGIGGGGFFVYQLAG-GKLITIDGREAAPSAATPQRFVGADGKPIPFFQAVPGGKSVGVPGNIRLMAMVHKRFGKLPWKALFAPAIRLAEQGYTVTRPMAAGMGFVSQVWSFPAIRAQYTRDGKPLSEGALVKNPDLARTLRLIADGGADAFYTGETGQAIVTAAERNPSDITLADLAAYRAKERPPVCGTYRGYKICGMGPPSSGAVTVLQVLGMVERFDMKKLGAASPVAWHLIGEAMLLAYADREKYLADSDFVRVPVTGMIDKAYLRSRSMLISPDKSLGTYEAGTPP...................... 370
342 0.000e+00UniRef50_A0A2E6J8W0 Gamma-glutamyltransferase n=3 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6J8W0_9CHLR  ali  33  7...............................NSTRPPVICTNGMVSSAHPLASNAGVKILMNGGNAFDAAVGVAFALGVVEPYMSGPGGIGLALITKAGANTPEVLNFSGMAPKLATLENFKDENSVYINGVPNNVGIKSGMVPGNLAGWFELHNKYGSLDLEVLMDPAIHYAEEGFPVSKFAHDTIKLSVPILSKYPSANIYMKSGIIPKIGSVIKLPQFAKSLKAIQKYGKDVFYRGYLAEKMVQGSEELGGLLSLEDLESYEPYWQTPIKIKYKDYEIYTT-PPNSSGFQLLQIMKMIETYSEGQMDLGSADTLHLMIEISKLCVADRVEYAGDPKFVTAPLKQLLSNQYANRQKSRLDLNQALHSLSPGDVFVKEGGLTTHFSVADKDRNVIS. 386
343 0.000e+00UniRef50_UPI00082C8574 gamma-glutamyltransferase n=1 Tax=Neptuniibacter marinus TaxID=1806670 RepID=UPI00082C8574  ali  33  5..HIHRIVLLFLLFSPSITYAVKEDLAPENSTGLQKNIISSNSLVVTANPHATKAGLHILKQGGTAADAAVAIQAMLTLVEPQSSGIGGGAFLLYWDQTTEKLVAFDGRETAPLAANPQLFY-RNKKPMRWVDALVGGRSVGTPGVLKMLELTQSKYGKRPWKTLFNDAINRSKEGFKISPRLHKLIASNPGLNRYPEAREYFLKDGSPLPTGFLRKNPALADSLELIAQQGSSVFYQGTISTKIVSQVQDNPGLLSTADLKQYKAIERAPICLPYQAYKVCGFPPPTSGGVTVLQILKLLEHTNYSALAPDSSTAKHLFTQASRLAFADRGRYLADSDFVDVPVSGLLNENYIQQRAQLINPSKDIGTLAPGRPQGPELPSTSHFVVVDQWGNAAS. 416
344 0.000e+00UniRef50_A0A0W8D5U0 Uncharacterized protein n=1 Tax=Phytophthora nicotianae TaxID=4790 RepID=A0A0W8D5U0_PHYNI  ali  34  6.................................TRSPVYGRHGMVSCSQPLASEIGLRILKQGGNAVDAAIAIAAALNVTEPCSTGVGGDCFLLFYDAKTKQVRGLNGSGRSPAALTAEQAIKDLGE-DATVIPSGHGHAVTVPGTVAGWVDAVEAWGTLSMAEILNPVIGLAREGFPVSPLTAASWERGKSLLRGPNAAELLNADGQAPKAGEIFTNENLAKCFEEVVKNGKKAFYEGRIARAIVDMVKEKGGVMTLEDLKNHKSTFVTPISTKFQGVDVHEI-PPNGQGITALLALNILTQLDGGLPPQGSAEFVHLQIEALRLAFADAKWFVSDMEHTSLPVKELLSENYAKKRATLVDRTKAAIDPKHGSPEL--SCDTVSFQVIDGQGNAVS. 370
345 0.000e+00UniRef50_A0A241W0A6 Gamma-glutamyltransferase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A241W0A6_9GAMM  ali  32  65.....................PAFPEPASGYRTGIKAQYSDKYMVVANTPLATKAGCDVLKAGGSAVDAAIAVQAVLGLVEPQSSTIAGSAFMVYYDAKTKKVTAYDGRETAPAAATEYYLIRQNQADIPAPNARRSGRSIGVPGVMKMFDLAHKEYGKLAWNQLFKESISLASNGFKVPGRLADAIQGSAPFLKDKEATQTFFKDGTAYQVGETLKNAAYAASIQKIAQQGVQAMYSGEMANNIVKKAGQTPSLMTVQDLQNYKAIKREPVCTTYRNYYVCTMPPPSSGGVAVAQTLGILENFDLATLKPQQAAAVHLISEAERLAYADRDKYVADTDFVALPANGLINKDYLKQRAALIQTNKSMGVAQAGNFNISAGKDTTQFTIVDAYGNIAS. 476
346 0.000e+00UniRef50_A0A143PIH3 Gamma-glutamyltranspeptidase n=33 Tax=Bacteria TaxID=2 RepID=A0A143PIH3_9BACT  ali  34  1MTRALGRLAICGLLAGLACAAPPRPPEGASGWTDKPGWSGATWMAAAANPLATDAGAEILNAGGSAIDAAIAVQMVLTLVEPQSSGIGGGAFLLYWDGRS--LVALDGRETAPAAATEALFL-RDGVPMPTAEAIVGGRSVGAPGVLRMLAQAHRRYGLLPWARLFAPAIRLADDGFAISPRLARLVSANKALPSDPDARGHFFADGRPKPVGTLLRNPALAEVLRRVASEGAEAFYTGDIAAAIAEKVRTNPGLLTAADIAAYQPVEREPLCFDYHDARICGFPPPSSGTIAVAQILGALQSRDLKTMKPASPDLVHVYAEAARLAFADRDAYVGDPAFVDVPVAGLIDAGYIRERAALVSMGRALPGLPPGRARSLERPSTSHISIVDRFGNALS. 423
347 0.000e+00UniRef50_A0A015LKI6 Gamma-glutamyltransferase n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A015LKI6_9GLOM  ali  31  5........................DQPFIKFPSRRSVVFGTNAMVACTQPLACQAGLEILKKGGNAADAAVATAAALNVTEPASTGIGGDCFCLFYEAKTKKIHGMNGSGRSPSKLTLEYARDKLGIT-ENSIPYTNINSCTVPGAAAGWIDCIEWFGKLSPGEILKPAIELAENGYPVSEISVWEWKNNEKILASPNGSDM-LIDGRAPNVGEIMHMPNLARTFRELAEKGKDGFYKGRIAEAIVELIQSKGGVMTLEDLASHTTTRVEPISIEYKGVRVWEC-PPNGQGITALIALGILEALQLDSLEHNSTQYIHILIESLRLAFADSQYYVTDPEVHHIPIKELLSKEYLSKRAQLINTSKASVDVKKGSPVN--SSDTVYFSVTDQEGNACS. 383
348 0.000e+00UniRef50_A0A2E8QRU3 Gamma-glutamyltransferase n=17 Tax=Bacteria TaxID=2 RepID=A0A2E8QRU3_9BACT  ali  31  10MSRSILLLALFAATTLTPFSIEAQATSRMTGPSGRSTVYAPNDAVATSQPLATTTALEILAAGGNAIDAAVAAAAVLNVTEPHMTGIGGDMFAILWDANSGRLVGLDASGKSGSNVDVEALLAEEEPSVPGS----GPRSVTVPGALSGWNALIEKYGTMTLAELLAPAIRIANEGFPVTPIIAQDWAGTVNLRRDMGAAATFLIDDEAPAAGDWFRNPDLAKSFQRISEDGVQAFYGGDLGREVVEGLGTLGGYLTLEDLQSHEPKWVEPLSVDYKGYRLWEL-PPAGQGIAALQMLKMLEGYDFSTMEHNSAEYLHTLIEAKKLAHADLSRYIADPAHMD</