current user: public

If you have questions about the server, please let us know.

Query: 5Z0B Entity 1(prereleased), from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .
26 3.000e-45UniRef50_A0A2I3LVU7 Albumin n=27 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2I3LVU7_PAPAN  ali  22  51.....................................................................................................................................................................................................................................................................DKLCTTLRETYGEMADCCAKQEPERNECFLQHKDDN----PNLPPLVRPEVDVMCTAFHDNEATFLKKYLYEVARRHPYFYAPELLFFAAKYKAAFVECCQAADKAACLLPKLDELRDQGKASSAKQRLKCASLQKFGDRAFKAWAVARLSQKFPKAEFAEVSKLVTDLTKVHTECCH---GDLLECADDRAD-LAKYMCENQD--SISSKLKECCDKPLLEKSHCLAEVENDEMPADLPSLAADYVESKEVCKNYAEAKDVFLGMFLYEYARRHPDYSVMLLLRLAKAYEATLEKCCAAADPHECYAKEFQPLVEEPQNLVK. 368
30 3.000e-42UniRef50_S9XSQ6 Vitamin D-binding protein-like protein n=2 Tax=Boreoeutheria TaxID=1437010 RepID=S9XSQ6_CAMFR  ali  19  23.................................................................................................................................................................................................YEKDKVCKELASLGKDDFTSLSMVLYSRKFPSGTFEQISHLVNEVVSLTEACCTEEAPDCYDNRTSALSKSCESDFPVHPGTAECCTTEGLERKLCMAALKHQPQEF----PTYVEPTNDEICEAFRKDPKGFANQFLYDYSINYGQAPLTILVSYTKSYLSMVGSCCTSPSPTVCF----------------------------------------LREKVPTADLEDVLPLAEDVTTILSKCCGSASED---CMAKELPEYTVKIC--DSLSTKNSKFKDCCQEKTPM--DIFVCTYFMPAAPTPELRDVKLPTNKDVCDKENTKVL---DQYAFELSR-KTHIPEVFLSKILEPTLRGLAECCNSGESTACLHEKGPQLKKELSSFIA. 362
35 1.000e-30UniRef50_M1ENJ5 Extracellular matrix protein 1 (Fragment) n=1 Tax=Mustela putorius furo TaxID=9669 RepID=M1ENJ5_MUSPF  ali  14  5......................................................................................................................................................................................................................................................HTNRLDCAKLWEDAMTRFCEAEFSVKTRPHWCCKQQGEARFSCFQEEAPRPHYQLCPSHQPGISSGPEL-PFPPGVPTLDNVKNICHLRRFRSTDPIQRQLQALTRLEGEFQRCCRQGNNHTCTWKAWEDALDGYCDQEQSVKTHHHSCCHYPPSPVRDECFARRAPYPNYRVLSKHKQIPGLIRNMTAHCCNLPFPEQACCAEEEKLAFIEDLCGPRHNFWRDSAL-CCNLNPGDEQTNCFNTYY............................................................................................. 282
36 4.000e-30UniRef50_W5PXZ3 Uncharacterized protein n=9 Tax=Eutheria TaxID=9347 RepID=W5PXZ3_SHEEP  ali  19  193..RHHHLCEIGIKFNHRVATAVELVLLTKKQPKANFSEIAKLSMDIKNLHQICCEGNAVVCVL--GRSQLMDYICSKQAILSS--KFTPCCEMPEPFRGECIINSENDDKSLPLRRFTEDQSVCKQFTDKQDFFLQRFLYEYSRRHPELAVPVILRVDTVYQSLLGKCCKLENPLECYSHGEGIFQRVVRESHERVKNQCDLREKLGDSNFHDRYASKILSRLCLLVF..................................................................................................................................................................................................................................................................................................................................................................... 418
37 2.000e-29UniRef50_O89020-2 Isoform 2 of Afamin n=3 Tax=Euarchontoglires TaxID=314146 RepID=O89020-2  ali  20  218.SYQRNVCGALIKFGPKVLNSINVAVFSKKFPKIGFKDLTTLLEDVSSMYEGCCEGDVVHCI--RSQSQVVNHICSKQD--SISSKIKVCCEKKTLEREACIINANKDDRSLREAKFTESENVCQERDSDPDKFFAEFIYEYSRRHPDLSTPELLRITKVYMDFLEDCCSRENPAGCYRHVEDKFNETTQRSLAMVQQECKQFQELGKDTLQ..................................................................................................................................................................................................................................................................................................................................................................................... 428
38 5.000e-28UniRef50_A0A2K6F7Z2 Uncharacterized protein n=1 Tax=Propithecus coquereli TaxID=379532 RepID=A0A2K6F7Z2_PROCO  ali  21  38...................................................................................................................................................................................................................................................................................................................................................................................................KDKVCKEITSLGKDDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACC--AEGADPDCYDTRTSALSVKSCESDSPFPVHPGTAECCTKEGLERKLCMAALK----HPPQEFPTYVEPTNDEICEAFRKDPKGFADQYTFELSRR-THIPEVFLSKVLEPTLKSLGECCDLEDPTACLKAKGPLLKKELSSFIG. 227
39 1.000e-27UniRef50_A0A1U7SRL4 extracellular matrix protein 1 n=1 Tax=Alligator sinensis TaxID=38654 RepID=A0A1U7SRL4_ALLSI  ali  14  5...............................................................................................................................................................................................................................PGHSPEVWDCLDDPRANAVKECCQRPEPLGCAKWSDTLQSFCQDEFGVKTKPFHCCKQRGTVREQCFAS---DAXXXXXXXXXXXXXXXHPVSSFPPGQPTSANLRNICQLARFRTPGATDQANNIAI-LEREYRRCCQGNGNLDCAHAAWRKAMARFCKEKGAVKTHIEPCCQVPLGERRDTCFARQAPYPQHVLITKRKPVPDLIQALKKPCCSLQGNERVQCAERKKSQLIATLCNTKKDSWKDTE-KCCSQTATEARASCFDTKYMAD.......................................................................................... 297
40 2.000e-27UniRef50_UPI00074FFB10 LOW QUALITY PROTEIN: vitamin D-binding protein n=1 Tax=Gekko japonicus TaxID=146911 RepID=UPI00074FFB10  ali  22  123................................................................................................................................................................................................................................................................................................................................................................................CSGNWNTPIFLIAHGRDYMREKVCREFNSXGKEHFRAGAIIASSRKYSNATFEEILNVVKDFVSIAEKCC--PEGADPDCYENESLALSARSCHDTAPFPKHPGIAACCTEQGLERKLCLAALK----HQPKEFPTYVEPSNEEACEAFARDPQDFQDRYLYEYSADYSSAPLPVLAASTTSYLSMVATCCASATPTPCFLKE--KLNRRSLAMLT. 330
41 3.000e-27UniRef50_A0A212D5Z9 AFP n=1 Tax=Cervus elaphus hippelaphus TaxID=46360 RepID=A0A212D5Z9_CEREH  ali  18  205..RHHHLCEIGIKFNHKVATAMELVLLTKKQPKANFSEITKLATDIKNLHQICCEGNAVVCVL--GRSQLMNYICSKQAILSS--KFSPCCELPEPFRGECIINSENDDKPLPLRRFTEDQSVCKQFTDKQDFFLQEFLYEYTRRHPELAVSVILRVDAVYQNLLGRCCKLENPLECYSHGG-CFKEWFVKSHERVKNQCDVREKLGDSNFHDRYASKMLSRL.......................................................................................................................................................................................................................................................................................................................................................................... 424
43 1.000e-26UniRef50_A0A2I0LR37 Group-specific component (Vitamin D binding protein) n=2 Tax=Columba livia TaxID=8932 RepID=A0A2I0LR37_COLLI  ali  21  27....................................................................................................................................................................................................................................................................................................................................................................................................DKVCQEFKTLGKDQFRTLTIIANSRKYSNATFEEINHLVHEIVSLAETCC--AEGTDPSCYDAGSSALSAKSCSSQSPFPAHPGTAECCTHEGLERKLCLAALQHPPQPVPKYLQ----PSNEEICQAFKKDPKDFADRFLYEYASSYSQAPLPVLLGSTRTFLSMVSTCCISPTPTVCFLKE--KLERKNLSLLTL 215
44 6.000e-26UniRef50_A0A091RDY8 Vitamin D-binding protein (Fragment) n=3 Tax=Aves TaxID=8782 RepID=A0A091RDY8_9GRUI  ali  21  7....................................................................................................................................................................................................................................................................................................................................................................................................DKVCQEFKALGKEDFRTLTIIANSRKFSNATFEEIGHLVREIVSLAETCC--ADGADPSCYDDGSSALSAKSCSGRSPFPVHPGTAECCTHEGLERKLCLAAL----HHPPQELPKYLQPSDQELCQAFRSDPKDFADRFLHEYASSYSQAPLPLLLGSARTFLSMVSSCCISPAPTACFLRE--KLERKTLSLLTL 195
45 1.000e-25UniRef50_UPI0007ACD6C7 vitamin D-binding protein-like n=3 Tax=Sinocyclocheilus TaxID=75365 RepID=UPI0007ACD6C7  ali  20  26.................................................................................................................................................................................................................................................................................................................................................................................................YAKENVCQGLKDIGIEKFKEMVTVLYSQKFPNGTFQEVSCVADEMTKLAEKCCK--DDASPDCYDTGATEISEKSCGKDSPFPKHPGIEQCCTLQGQERKLCLASL----RYTADELPSLTEPTNEEICTEYTKDEKDYSVRYVYEFARRHRNIPAGFILNATQNHVRMAERCCRPAIKNSCFLQERLQMRS........ 211
46 8.000e-25UniRef50_UPI000CEFC817 vitamin D-binding protein n=1 Tax=Terrapene mexicana triunguis TaxID=1415176 RepID=UPI000CEFC817  ali  20  27....................................................................................................................................................................................................................................................................................................................................................................................................DKICQEFNSLGKDNFRSLAIIMNSKKFSNATFEEISHVVKDVVSLAETCCVKGADPN--CYDTGASALSAKSCEENVPYPDHPGIAACCTHQGLERKLCLAAL----HQPPKEFSTYVEPSNEELCEAFKKDPQDFADRFTHEYSSNYGQAPLPVLVGSIKSYLSMVGTCCISPSPTVCFLKEVS............ 205
47 2.000e-24UniRef50_A0A1W5AFT1 vitamin D-binding protein n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W5AFT1_9TELE  ali  17  21..............................................................................................................................................................................................................................................................................................................................................................................................EGETRVEELCRERNEAGKDAFKAMVIALYSQRFANGTFEEISATSDHILKILEKCCS--PDANPGCYEKETRELVTLFCRKDSPFPKHPDLDKCCGKGEHEWGLCLASL----HYSSEELPSLQELTNEEICEQLKHGAQVFSARYTYELSRRYQSIPADLVLKATKNYVEMAEKCCSRSLSKICFLQERLQHKD........ 209
48 2.000e-24UniRef50_Q6DGV8 Zgc:92753 n=4 Tax=Danio rerio TaxID=7955 RepID=Q6DGV8_DANRE  ali  17  19.............................................................................................................................................................................................................................................................................................................................................................................................DKGTYTKEKVCQDLQVIGIEKFKEMVTVLYSQKFPNGTFEEVNCVADEMTTLAEKCCK--DDASPDCYDKGATEISEKSCRKDSPFPKHPGIEQCCTLQGHERKLCLASL----RYSADELPSLLEPTNEEICAEYTKDEKQYAVRYAYEFARRHRNIPAGFVLNATQHHVRVAARCCRPAVKNSCFFQERIQMRS........ 208
49 2.000e-24UniRef50_A0A218UND9 Vitamin D-binding protein n=5 Tax=Amniota TaxID=32524 RepID=A0A218UND9_9PASE  ali  18  43....................................................................................................................................................................................................................................................................................................................................................................................................EKVCQEYKMLGKENFRTLTIIANSRKYSNGTFEEIGHLVREIVSLAETCCT--DGADPSCYDAGSTALSAKSCGADSPFPAHPGTAECCTHEGLERKLCLAAL----RHPPQPLPRYLQPSDRELCQAFQRDPREFADRFLYEYASSYSQAPLPVLLSSTTTFLSMVSTCCISPAPTACFLKE--KLERKTLSLLTL 231
50 2.000e-24UniRef50_S7PWY9 Alpha-fetoprotein n=1 Tax=Myotis brandtii TaxID=109478 RepID=S7PWY9_MYOBR  ali  18  21............................................................................................................................................................................................................................................................................................................................................................................................VFRRDAHKSELAHRFKDLGEEYFRGLVLVTFSQFLQQCPFEEQVKLAKEVTDFAKTC--AADESAENCDKSLHTLFGDKLCAVASLRDTYGDMADCCTKKEPERHECFLKHKDDN----PNLPALVRPEPDALCTAFKESDQKLLGSYLYEVARRHPFFYGPELLYSIQEYKGVLTECCEAADKAACLGPKLDALKEKV...... 213
51 4.000e-24UniRef50_P02768-2 Isoform 2 of Serum albumin n=37 Tax=Mammalia TaxID=40674 RepID=P02768-2  ali  22  21............................................................................................................................................................................................................................................................................................................................................................................................VFRRDAHKSEVAHRFKDLGEENFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCH---GDLLECADDRAD-LAKYICENQD--SISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKEFKPLVEEPQNLIK. 221
52 7.000e-24UniRef50_F1NVF3 Vitamin D-binding protein precursor n=55 Tax=Archelosauria TaxID=1329799 RepID=F1NVF3_CHICK  ali  19  27....................................................................................................................................................................................................................................................................................................................................................................................................DKVCQEFKTMGKDDFRAMTLIMNSRKFSNATFEEISHLVHEMVSLAETCC--ADGVDPSCYDTGSSALSAKSCSPDSPFPAHPGTAACCLHQGLEQKLCLAALE----HPPRQLPHYVEPSNEELCEAFKKDPKDFADRFLHEYVSSYGQAPLPVLLGSTRNFLSMVSTCCISPSPTVCFLKE--KLQRKTLSLLTL 215
53 2.000e-23UniRef50_L9L5M3 Serum albumin n=2 Tax=Tupaia TaxID=9394 RepID=L9L5M3_TUPCH  ali  16  9............................................................................................................................................................................................................................................................................................................................................................................................VVRRETHKSEIAHRFKDLGEENFKGLVLIAFSQYLQQCPFEEHVKLVGEVTEFAKTC--VADETAENCDKSLPTLFGDKLCTIATLRETYGDMADCCAKQEPERNECFLKHKDDK----PSLPALVRPEADVMCTSFQESENMFLGKYLYEVARRHPYFYAPELLYYAQKYKTALKECCAEADKAACLTPKLDALKEK....... 200
54 3.000e-23UniRef50_A0A093EPG5 Vitamin D-binding protein (Fragment) n=11 Tax=Neognathae TaxID=8825 RepID=A0A093EPG5_TYTAL  ali  19  26....................................................................................................................................................................................................................................................................................................................................................................................................DKVCQEFKALGKEDFRTLTIIANSRKFSNATFEEISHLVGEIVSLAETCC--AEGADPSCYDAGSSALSAKSCSKDSPFPGHPGTARCCTQEGLEQKLCLAALQ----HPPQQLPRYLQPSNEELCQAFKKDPKDFADRFLHEYASSYGQAPLPVLLGSSRTFLSMVSTCCISPAPTACFLKE--KLERKTLSLLTL 214
55 4.000e-23UniRef50_UPI0003C17E23 extracellular matrix protein 1 isoform X1 n=2 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0003C17E23  ali  16  103..............................LPPSGFGHLHRQLDAIKHLFATCCQQPVKLNCAQALWRDVLKQFCRDE--FSVKTRHYSCCKKTESERDSCFEENAPSPSYLPSDV------------GKESLAAGASVILDSRNPP--------------------ICPLQDPSQCHSTVTTSQEIPKVSFPPGEPNQSNIQNVCKLRKFRPRYSQDSLPSSGFSWLRRQMKAVNKMEVQFKNCCKTDVLSCAQNKWEALDEFCEQEFSVKDRSNPCCKKQGTEKYSCFAERAPHPNY------------DKEIQTIDLGNMTAATMEIVCAHVKVFTKQTPIPML-----LKSLKKNCCSAEENIFCAEDKKEEIFDRMCTTKKKFWADPERCC............................................................................................................................................................................................. 424
56 4.000e-23UniRef50_UPI000A28377E serum albumin-like n=1 Tax=Phascolarctos cinereus TaxID=38626 RepID=UPI000A28377E  ali  22  34.........................................................................................................................................................................................................RYRDLGEVNVKGLVLITFAQFLQKCPYEDHIKLVNEVVEFAKGCAADETAENCDKSLHQLDKLCSNFRERYGEMAECCTKEEPERNQCFLSHKDD----HPDLPKIEAANADTLCHNFQENADRVLGKYLYEVARRHPYFYAPALLAYTFQYKDAVGECCQSADKATCLQEKLPALREKVLSAGARQRYRCSSLDKFGERAVK..................................................................................................................................................................................... 236
57 5.000e-23UniRef50_W5KYJ2 Group-specific component (vitamin D binding protein) n=5 Tax=Otomorpha TaxID=186634 RepID=W5KYJ2_ASTMX  ali  18  29...................................................................................................................................................................................................................................................................................................................................................................................................KEKVCGGLRNVGAKNFKMVVIALYSQKFPNGTLEEVSSVADEMTKLAEECCQ--DNASPDCYDKGATQISDKSCGKDSPFPKHPGIEQCCTVQGHERRLCLATL----RYSSDELPSMMEPMPEEICTQYTKDPSGYAMRYVYESARRHRSIPAGFILNTTQNHVQTAEKCCSPAASTPCFFKERFQQRSST...... 214
58 6.000e-23UniRef50_A0A2Y9FYZ6 LOW QUALITY PROTEIN: alpha-fetoprotein-like n=1 Tax=Trichechus manatus latirostris TaxID=127582 RepID=A0A2Y9FYZ6_TRIMA  ali  16  234....KRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTTPELISITRKMAATGATCCSEDKQLACGEGAADLIIGHLCIRHEETPVNPGVGQCCNSSYANRRPCFSNLLVDETYVPPAKFLFHKDLCQAQGAALQSMKQEFLINLVKQKLQITEEQLETVIADFSGLLETCCQGREQEACLAEEGPKLISKTR........................................................................................................................................................................................................................................................................................................................................................................................................... 425
59 7.000e-23UniRef50_UPI000CEB0B89 serum albumin 2-like n=1 Tax=Salvelinus alpinus TaxID=8036 RepID=UPI000CEB0B89  ali  20  141.EYYKNLCAAEAALGDYNFEKSMMVYYTRIMPQASFVQLHVVSETVADVFHDCCKDQPVLPCAEEKSTNVLDATCNDDDYSSINPRIAHCCNQSYSMRRPCILAIQPDTEFTPPEQDANDPELCTKNTKDLLLSGKKLLYDVVRHKTTITEDHLKTISTNFSITKEKCCAAEDKEACFTDKAAKL................................................................................................................................................................................................................................................................................................................................................................................................................ 331
60 9.000e-23UniRef50_A0A091LU66 Alpha-fetoprotein (Fragment) n=42 Tax=Neognathae TaxID=8825 RepID=A0A091LU66_CARIC  ali  16  415ESVMKTSCDIYKEKGDYYFQNELLMSFTKKMPQLTSAELIKFTKQMTTIGSKCCSQDKLLPCAEENLDLVLGEICRRHLTNPINPGVCHCCSSSYALRRPCMGKLEIDESYVPLSLTPFHEDLCTTEEEKLQHKKQEMLINLIKYKPQITQEQLTSVTAAFTAMREQCCKEENREACFARE.................................................................................................................................................................................................................................................................................................................................................................................................................... 601
61 3.000e-22UniRef50_UPI0004F0DBA8 vitamin D-binding protein n=1 Tax=Acanthisitta chloris TaxID=57068 RepID=UPI0004F0DBA8  ali  20  2.......................................................................................................................................................................................................................IISNSRKYSNGTFEEISHLVREIVSLAETCCADGADASCYDASALSAKSCGTDSPFPPGVASCCAHAGLERKLCLAALQHPPQ----PLPRYVQPSDQELCQEFRKDPREFADRFLYEYSSSYSQAPLPVLLGSTRTFLSMVSTCCISPAPTTCF-LKEKLERKTLSLLTLTSNRVCSRFSAYGKDKATFSYLASLAQKVPDVSFEDIFPL............................................................................................................................................................... 211
62 5.000e-22UniRef50_A0A226NPE5 Uncharacterized protein n=2 Tax=Galliformes TaxID=8976 RepID=A0A226NPE5_COLVI  ali  24  1..............................................................................................................................................................................................................................MPQLTSAELIKFTKQMTTIGSKCCQDKLLPCAEENLDLLGEICRRHNPINPGVCHCCSSSYALRRPCMGKLEIDENYVPLSLTPDLFTFHEDLCTTEDEKLQHKKQEMLINLIKYKPQITQEQLTSVTVAFTAMREQCCKEENREACFVKEEEELKKHIYETESVMKTSCDIYKEKGDYYFQNEYLSSVFK............................................................................................................................................................................ 197
63 7.000e-22UniRef50_A0A2P4SUP0 Uncharacterized protein n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4SUP0_BAMTH  ali  17  203..VVKTNCDLLNAHGKPDFLKSILIRYTKKMPQVPTDLLLETGKKMTAIGTKCCQEDRRMACSEGYLSIVIHDVCRRQETTPINDHVSQCCSGSYADRRPCFTAMGVDTKYVPPPFNPDDEKLCSAPAEEREVGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDINTCFGEEGANLIVQSRAT......................................................................................................................................................................................................................................................................................................................................................................................................... 398
64 1.000e-21UniRef50_UPI000943624B LOW QUALITY PROTEIN: afamin-like n=1 Tax=Rhinolophus sinicus TaxID=89399 RepID=UPI000943624B  ali  15  31.................................................................................................................................................................................................................................................................................................................................................................................FSKQAQPVLQYLKALSSYQETVCGAYWKFGPQVLKSLNIAVLSQKFPKIEFKKLTSLLEDVSSKYDGCC---EGDVEQCTRDG-SKVMSYICXKQD--SMSSKIKECCEKKIPEGGECITYSSKDNQAKDLSLREAKFTENENVCEEWNADQDSFMDEFLSEYSRRHPELSTPELLRMARVHDDLLKECCNAENAPDCYNAEVGNMIDQSESTL.. 242
65 1.000e-21UniRef50_G1KNL0 GC, vitamin D binding protein n=2 Tax=Iguania TaxID=8511 RepID=G1KNL0_ANOCA  ali  24  25.................................................................................................................................................................................................................................................................................................................................................................................................YFKEKICQEFNSLGKDKFRSITIVLNSRKYCSATFEEISSIVNEIVALAEKCC--VEGADPECYNTESTTLSAKSCDPNSPFPKHPGTAACCTEEGLARKLCLAALK----HPPKEFFTYMEPSSDEICEAFKKDPQDIEDRFLYEYSSDNSHTPLPLLLASTTTYLSIVGKCCTDANPVACFLKER--LERTSLRALT. 215
66 2.000e-21UniRef50_UPI000854F9D0 extracellular matrix protein 1 n=1 Tax=Nanorana parkeri TaxID=125878 RepID=UPI000854F9D0  ali  16  75...................KTRTIVTYGENLPQTGFSHLSRQGNAINSVEERCCSQSEKLRCALEVWKNGMDDFCTEE--FSVKTSHYHCCKKRGAEREPCFSAEAPNPNYISSAPLLEVG---------------------GADSPSLPRPRSLKSC------------SSHSPNCLDNPEGKYKLSDLAFPPGEPKTSNIQNICKLRKYRPLYTEDVLPNSGFGHYVRRAKAIYWAESELKKCCKTEDVACAHRGWQAVSKFCTKELEVKSKHYECCKKKDASMFHCFASEAPFPEYD............................................................................................................................................................................................................................................................................................. 326
67 2.000e-21UniRef50_Q8JIA7 A/B over-sized serum albumin (Fragment) n=1 Tax=Sphenodon punctatus TaxID=8508 RepID=Q8JIA7_SPHPU  ali  20  196....KTHCSFYTSQGKDPFQKMVLVRYTKKMPQLPAEELIEISKKLTGVGVKCCSEDKRLSCSEKHLSMVLFEICRQHEASPVNNHVTHCCTDSYSEMRPCFTKLGVDDSYVPPEFCPSDEQLCTAPEEARLKKQLTFLVKLIQLKPQIEDEQLKKLVTDYHAMEEKCCQAENKQECFSTEGEKLTQEGKALLGVQLNV.................................................................................................................................................................................................................................................................................................................................................................................................. 396
68 3.000e-21UniRef50_G1SHH2 Afamin n=1 Tax=Oryctolagus cuniculus TaxID=9986 RepID=G1SHH2_RABIT  ali  20  380.......CKRFQNLGKDGLKYHYLIKLTKTAPQLSTEELLSLGQEMVMALSTCCTLSEEFACVDNLMDLVLGELCGIKENRTINPAVDHCCQTNFAFRRPCFEGLKADQTYVPPPTFAFPLDWCQDQKEELQRKKDRFLVNLVKLKPELPDEELQSLFTNFTDTLEKCCNAKGPEACFNQEHLKI................................................................................................................................................................................................................................................................................................................................................................................................................ 561
69 6.000e-21UniRef50_A0A2Y9RE35 alpha-fetoprotein-like n=6 Tax=Eutheria TaxID=9347 RepID=A0A2Y9RE35_TRIMA  ali  19  412.EHVKYYCALHETLGESNFHNRLIVLYTKKAPQLSAEELVVFTKNMATAASKCCSEEQQFACIEDSAKLILGALCRRHEAEPINTGVGHCCGDSYAFRKPCFDDLPADETYVSPSVISLNEDLCKAQEEQLQTEKQKLLSNLVKQNPRAAETQLQSIVRDFAYLVEMCCQVEKSEMCFQGKP................................................................................................................................................................................................................................................................................................................................................................................................................... 599
70 8.000e-21UniRef50_A0A2I2V487 Uncharacterized protein n=39 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2I2V487_FELCA  ali  19  413.ERIKNHCDLREKLGDANFHDRLIILYTKKVPQLSAQELVTLTKNMAAAATKCCRDEQQFVCMEDSAKLILGALCRRHEAEPINAGVGHCCEDSYAFRKPCFDDLQVDRTYISPPVISLKEDLCKAREEQFQTEKQKLLSNLVRQKPRATEMQVRSIIADFAHLVETCCQAEESEMCFRGEGSKLIEKCQ........................................................................................................................................................................................................................................................................................................................................................................................................... 608
71 1.000e-20UniRef50_UPI00099FE8F5 serum albumin 2-like n=1 Tax=Oncorhynchus kisutch TaxID=8019 RepID=UPI00099FE8F5  ali  21  1...........................................................................................................................................................................................MIADEIEYYKNMCAAEAALGDYNFEKSMMVYYTRIMPQASFIQLHMVSETVADVFHDCCKDQVLPCAEEKSTVLDTTCNDDDSINPRIARCCNQSYSMRRPCILAIQPDTEFTPPKLDANDFNMGPELCTKNSKDLLLSGKKLLYNVVRHKTNITEDHLKTLSANYSITREKCCAAEDKEACFTDEAAKLLAESVE.......................................................................................................................................................................................................... 203
72 1.000e-20UniRef50_L5LGU8 Vitamin D-binding protein n=2 Tax=Myotis TaxID=9434 RepID=L5LGU8_MYODS  ali  21  18...............................................................................................................................................................................................................................................................................................................................................................................................REYEKDKVCKELNNFGKDDFTSLSMVLYSRKFPSGTFEQISHLVKEVVSLTEACC--AEGADPDCYDNRTSALSAKSCDSDSPFPVHPGTAECCTQEGLERKLCMAALK----HQPQEFPTYVEPSNDEICEAFRKDPKEFANHHLIKLAQKAPTANLEDVLPLAEDVTTILSKCCGS-TSEDCMAKELPEHTVKI...... 206
73 1.000e-20UniRef50_A0A2K6MJ38 Albumin n=1 Tax=Rhinopithecus bieti TaxID=61621 RepID=A0A2K6MJ38_RHIBE  ali  19  180...VKQNCELFEQLGEYKFQNALLVRYTQKVPQVSTPTLVEVARNLGKVGSKCCKLPEAKPCAEDYLSVVLNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALELDEAYVPAETFTFHADMCTLSEKEKQVKKQTALVELVKHKPKATKEQLKAVMEDFAAFVEKCCKADDKEACFAEEGPKF................................................................................................................................................................................................................................................................................................................................................................................................................ 367
74 1.000e-20UniRef50_UPI00093970F5 serum albumin isoform X3 n=1 Tax=Crocodylus porosus TaxID=8502 RepID=UPI00093970F5  ali  14  13.................................................................................................................................................................................................................................................................................................................................................................................FSSATSRDLSRFAQEAEYKNEIAHHFNNLKEEHFKAVAIITFAQYLQKCSYESISELVKNVVDLAQRC--VANKDDLGCTKSLQAIFLDEICQIKRLHDFYGAMADCCANADPERNDCFLSFKM---TYPPFLTPYQRPEPDAVCKELKEDRQSFLGHYVYGVARRLPFLFAPTILALGDDYELAVQTCCAVTDIDVCLERKIAALKEKSTE.... 219
75 2.000e-20UniRef50_E2RQF8 Uncharacterized protein n=2 Tax=Laurasiatheria TaxID=314145 RepID=E2RQF8_CANLF  ali  16  105.......................................................................................................................................................................................................................VVYGPWNLPQSGFSHLTRQGETLETRYSRCCHTNRLDCAKLVWEAMTRFCEAEFSVKTRPHRCCKQQGEARFSCFQEEAPRPHYQLCPSHQPGISSGPEL-PFPPGVPTLDNIKNICHLRRFRSTDPIQRQLQTLIQLEGEFQRCCRQGNNHTCTWKAWEEALDGYCEREQAIKTHHHSCCHHPPSPARDECFARQAPYP.......................................................................................................................................................................... 320
76 2.000e-20UniRef50_L5K9K2 Afamin n=4 Tax=Laurasiatheria TaxID=314145 RepID=L5K9K2_PTEAL  ali  16  56................................................................................................................................................................................................................................................................................................................QEASFEEAEMLRKAMTEYKDQCLANMTLPMCSKLPNDVLQETICAIEGLKHNFSHCCNKERRLCFFRNKKAGVEFLPSPLTLDPEEKCQAYKNNSESFLNN-YIYEVSRRNPFVFAPTLLMLAARFEVITKTCCE--EQDKANCFQTK-SKVMDHICSKQD--SISSKIKECCEKKIPERGECIISSNKDDRPKDLSLKETKFTENKNVCEERNADQDIFMAEFLYEYSRRHPELSVPELLRIASVYDDLLTESCNTKNPPDCYCNAENKFNETTEKSLRI 335
77 2.000e-20UniRef50_Q8JIA8 Serum albumin (Fragment) n=1 Tax=Woodworthia maculatus TaxID=1165302 RepID=Q8JIA8_9SAUR  ali  18  1.................................................................................................................................................................................................................................................................................................................................................................................FAEKSPATKKKLKEATLMEKQNCFVLKKFGPKELHTWKFAQLAQKFPKADRFVLHNITHDIVHVHKERCRGDTLESYLDQVQISRFV----CGHQDLFS--PKVKKCCDDILLHRPECLVAMENDEPPADLSPTVREFVDNKEVCQRFAENHDDHLERFVYEYGRRHQDFSPQLLQRLQKGYHDLLEKCCLLEAPEACLLEGEPLLKKHVADTLAV 210
78 2.000e-20UniRef50_W5MZW6 Uncharacterized protein n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=W5MZW6_LEPOC  ali  17  21............................................................................................................................................................................................................................................................................................................................................................................................LRRQKREANTICQYYTALKEEGFKAIVLVGLAQNLPKSTFEELVPLIRQSTAAAQGCC--GDSPSADCSKDEKELFQGVVCSSQEVVTKN-ELADCCAKQGEERTKCFIEHKK---KIPRDLSLMHHLPASEKCEEFEKDHIGYMGHFIFRFSKRNVLLQPQVILGIADGYEKTLTECCKAADAKHCLDAKKAALQRVIEDRIT. 218
79 6.000e-20UniRef50_G3UHC2 Uncharacterized protein (Fragment) n=3 Tax=Eutheria TaxID=9347 RepID=G3UHC2_LOXAF  ali  19  251NEHVKNLCALHEKLGDGNFHNRLIVLYTKKAPQLSAEELVVFTKSMAAAASKCCSDEQQFACIEDKAKLILGALCRRHEAKPINAGVRHCCEDSYAFRKPCFDDLPADETYVSPSVISLKEDLCKAPEEKLQTEKQKLLSNLVKQNPHAAETQFQSVITDFTRLVEMCCQAEKREMCFQRKN................................................................................................................................................................................................................................................................................................................................................................................................................... 441
80 6.000e-20UniRef50_UPI000703F64C serum albumin n=3 Tax=Eutheria TaxID=9347 RepID=UPI000703F64C  ali  18  408.EYVKKDCETFENLGEYGFQDALLVRYTKKVPQLSTPTLVHLSTKLASMGSKCCPESQRTACAEDYLSVVLSVFCTAHEQTPVSNKVTLCCTEPFLDRLPCFSALETDETYIPKATFTLHAFVCARAEPEQQVMKQIALAELLKHKPKATEEQLKTVMEEFSALIQKCCAAADKEACFAEEIKAQINHRPSSLPRN..................................................................................................................................................................................................................................................................................................................................................................................................... 608
81 1.000e-19UniRef50_UPI0004DFED8E afamin n=1 Tax=Ursus maritimus TaxID=29073 RepID=UPI0004DFED8E  ali  18  783.ERVKHHCDLHEKLGNANFHDRLIILYTKKAPQLSAQELVTFTKNMAAAATKCCRDEQQFACMEDSAKLILGALCRRHEAEAINAGVGHCCDDSYAFRKPCFDDLQGDGTYISPPLTNLKENLCKAQDEEFQTEKQKLLSNLVKQKPQATEMQFQSVMAEFAHLVKKCCQAETSDMCFREEHSENMFPPNNPIATQ..................................................................................................................................................................................................................................................................................................................................................................................................... 984
82 2.000e-19UniRef50_H7C013 Serum albumin (Fragment) n=5 Tax=Euarchontoglires TaxID=314146 RepID=H7C013_HUMAN  ali  25  36.........................................................................................................................................................................................................RFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLDKLCTTLRETYGEMADCCAKQEPERNECFLQHKDDN----PNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQA.............................................................................................................................................................................................................................. 197
83 3.000e-19UniRef50_UPI0007BA58C3 vitamin D-binding protein-like n=2 Tax=Cyprinidae TaxID=7953 RepID=UPI0007BA58C3  ali  17  11.................................................................................................................................................................................................................................................................................................................................................................................HPGGIRRTRLQMQSSKNFLRFLSNVCNNQVNLKSFKFGLSAYYGNLLGLSFEEASAISARFQSGLEKCCLQPQPE---CIIQELTSFQKVLCSESKLDAMSEDFRKCCSKPALDTLPCVDDLKRQPHQSADVAN----PVSSKLC---EEAQPHRIDRYLFLIGVNHASISLPVLTTVLDRIKNTVTACCSSADVTACLTEKESKLKKITALLSKL 216
84 3.000e-19UniRef50_A0A2I3LQM9 Albumin n=1 Tax=Papio anubis TaxID=9555 RepID=A0A2I3LQM9_PAPAN  ali  19  130...VKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGAKCCKLPEAKPCAEDYLSVVLNRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALELDEAYVPAETFTFHADMCTLSEKEKQVKKQTALVELVKHKPKATKEQLKGVMDNFAAFVEKCCKADDKEACFAEEGPKF................................................................................................................................................................................................................................................................................................................................................................................................................ 317
86 8.000e-19UniRef50_A0A091CQY6 Serum albumin n=9 Tax=Euarchontoglires TaxID=314146 RepID=A0A091CQY6_FUKDA  ali  17  21............................................................................................................................................................................................................................................................................................................................................................................................VFRREAHKSEIAHRFKDLGEEHFKGLTLIAFAQYLQKCPFEEHIKLVKEVNEFAKTC--AADESAENCDKSI--------------------VPDCCAKEEPERNECFLQHKDDN----PSLPPFERLEPEAMCTSFNEDKQLFLGHYLYEVARRHPYFYAPELLYYAEQYKDVLTECCQSADKATCLTPKLQALKEKVLASAA. 198
87 1.000e-18UniRef50_F6SKH8 Group-specific component (vitamin D-binding protein) n=6 Tax=Xenopus TaxID=262014 RepID=F6SKH8_XENTR  ali  17  25...................................................................................................................................................................................................................................................................................................................................................................................................KDKVCQELKFLGKDKFSAVALVMNSRKYSNATFEEIGHLVTAIVSLSETCCAT--EAAADCYDKKADALSVQSCDPKSPFPKHPGVERCCVHKGLERKLCLADLK----QPPKEFPTYTEPSNEKLCESFKENAQLF-SSFLYDYSSNYAQTPFLVVVNYTEKYLKMITECCTKPRQTQCFLKQRLQIKS........ 207
88 2.000e-18UniRef50_D2I058 Uncharacterized protein n=2 Tax=Laurasiatheria TaxID=314145 RepID=D2I058_AILME  ali  18  276.ERVKHHCDLHEKLGNANFHDSTIILYTKKAPQLSAQELVTFTKNMAAAATKCCRDEQQFACMEDSAKLILGALCRRHEAEPINAGVGHCCDDSYAFRKPCFDDLQVDGTYISPPVINLKENLCKAQEEEFQTEKQKVLSNLVKQKPQATEMQFQSVMAEFAHLVKKCCQAETSDMCFREERNLL................................................................................................................................................................................................................................................................................................................................................................................................................ 480
89 3.000e-18UniRef50_Q5NTZ2 Serum albumin n=5 Tax=Colubroidea TaxID=34989 RepID=Q5NTZ2_PROFL  ali  17  415..VVKNNCDNYKEIGGYFFQNVYLIKYSKIIPQAPTSNLIEITKRVAKVAEKCCHLDSQVSCALENTDKVIGSVCRYHKEHFINKQLCHCCDSSFISRWECISNLGPDPSYVPPPFRPKPENLCSPNEETVQESKQCLLSDLIKSKPNISDEMLASAIEAFRNLQADCCAAENKKECFDTKGRKLVEDIQNDHIIQ..................................................................................................................................................................................................................................................................................................................................................................................................... 614
90 4.000e-18UniRef50_V8NL73 Extracellular matrix protein 1 (Fragment) n=1 Tax=Ophiophagus hannah TaxID=8665 RepID=V8NL73_OPHHA  ali  16  80......................................................................................................................................................................................................................................................................................CKEVGCTRKVPFYKLEEFPPGRPSLSNLGA------LCSAGRKKP-SYGPWNLPQTSFSHLSRQGEALNQL----ELQFTRCCQLAEKLPCASNEWEKCLVRYCKQEFSTKTLPFHCCRAGAREARLSCFARQAPFPKKPSPA-------LVQNITESCCKLPESERTPCAQGVKSQFITAFCSSQRRSWRDPQ-KCCAQTEEAARNDCFDRSY............................................................................................. 276
91 4.000e-18UniRef50_A0A2U9AY54 Putative PIP5K1A and PSMD4-like protein-like n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9AY54_SCOMX  ali  15  94.............................YFPASGFGQQRRRASAVNNAFSTCCEGNQTLCCAKQAWELSVKSFCNEDS--SVKDRLYHCCRLTDSDLLNCFNNDAPNPNYEPTEEIPLPPLPSTLFVFDPNTCQRTVMTQYIVR------------GNREKKMMTPS---------TSKKIDINFPPGRPTADSIDSLCRNQN------LRPLYNVKCLPGVGYEWLVRQAKTVNRMEKGFKQCCKQDVLNCARKWSEELNKFCLVKKGGKVDF-PCCSGDGADRHNCFQNMSADPHYNMTSATEQLSLGN--ICDTHKIIKKNF................................................................................................................................................................................................................................................................... 372
92 5.000e-18UniRef50_A0A2D0RGD7 extracellular matrix protein 1 isoform X3 n=5 Tax=Ictalurus punctatus TaxID=7998 RepID=A0A2D0RGD7_ICTPU  ali  14  62.........................................................................................................................................................................................MDPSIPFPLACPTMDNILAICQYSNLRPRYTKDMLPKSGFDHLRRQARAVNQLESWFTLCCEELTLCCAKQAWESLSTFCEEEFQIKTSHYHCCKRHRPEIWDCFEEEAPDPLYQTKIAGHEVATTLSSTIQGFDFNPSNCQKTSVSEIAPRLEMVPEPPPHGGMEQRLVIPGGIGFPHHVSSPRSRKPSILFPLARPDTTNILAICQYSNQRPRHPKETLPRSGSGYLHRQANA------VNQLESWYTVCCAQDFDQTLCCAQQAWEKSLSAFCEME--FRVKTTHYHCCRERGLARLDCFEEHAPDKSYQPLPVTIQGFDFDPNSCQK..................................................................... 402
93 1.000e-17UniRef50_UPI00077DC506 serum albumin-like n=2 Tax=Peromyscus maniculatus bairdii TaxID=230844 RepID=UPI00077DC506  ali  19  1......................................................................................................................................................................................................................................................................................................................................................................................................................MVVSTSQKFPNADFTENSKLATDITKITKECCH---GDLLACADDRA-ELAKYICANQ--ASISSKLQACCDKPVLQKSHCLAIGEHNDMPVDLPSLADDFD-GGQVCTNYVAAKDIFLSKFLYEYSRRHPDFSVALLLRIAKKYEATLEKCCTESDPAISCGSVVGFHRPRAQQLLA. 171
94 1.000e-17UniRef50_M7ARI6 Extracellular matrix protein 1 n=1 Tax=Chelonia mydas TaxID=8469 RepID=M7ARI6_CHEMY  ali  14  124.............................NLPQTGFSHLKRQGDALNFLRERCCPRPERLSCMESAWKEALEQFCDHE--FTVKTKPYHCCKRAGADRELCFTSEAPNPGYLPIDASAVPPQILPAQPGAR----------LGPRLPEVSFP-----------------------------------PGEPTSSNIRNICRL------RKFRPVHAPSAIPTTGYSWLQHQARTTTRMESDFRKCCKNENVNCAHAWEKALAQFCKLELSMKTTPHKCCKQTGKARFSCFSSQAPNPAY------------DKEIQAVSLGEVTPELLDMLCGEMKLFTKQKP-----IPDLIQNMTEPCCSLEERTQCAEKEKARSIAALCKDSWKDKEQCCSQEEEGDRTY...................................................................................................................................................................................... 437
95 1.000e-17UniRef50_UPI00093E0BE0 LOW QUALITY PROTEIN: uncharacterized protein LOC109309310 n=1 Tax=Crocodylus porosus TaxID=8502 RepID=UPI00093E0BE0  ali  18  413...VKANCDLLKE-GEFEFLKVVLIRYTKKMPQVSTETMLEVGKKIILAGVKCCQEPENRACAEGYLDMLIQEMCERQKAVSVNDQVAHCCSASYANRRPCFTKXGVDENYEPPPFNPFGENLCNAPLATQQETQLKLLVNLIKCKPSMTDEQLGKIIAGFIEMVDKCCKKEDHDACFGEEGANLIVESRATLGIELQKSIKENSF........................................................................................................................................................................................................................................................................................................................................................................................... 620
96 2.000e-17UniRef50_UPI000813AEF1 afamin-like n=1 Tax=Manis javanica TaxID=9974 RepID=UPI000813AEF1  ali  21  36...........................................................................................................................................................................................................QNYLEENLRHITSIMVAQFLQKSTYEEVQTVVKELVGLAEKCSHESLSECSHQLMTVLEHICNNQGMADKHFSECCSINNTARLKCFLLNKKDDAGYNDTF---QIPNPEQTCEMDKENQVSMKERNIYETSRKHPFLYGPTILTMSACYETAIQSCCQEENKSECFQIKKTGTR............................................................................................................................................................................................................... 213
97 2.000e-17UniRef50_A0A226NPJ0 Uncharacterized protein (Fragment) n=1 Tax=Colinus virginianus TaxID=9014 RepID=A0A226NPJ0_COLVI  ali  15  14............................................................................................................................................................................................................................................................................................................................................................................................................KQNETDHSEIAMIMFAQYVQGSTFGQVVKMAEAVTDLAKRCTD-AERDNPNCQKPLDRIFLNTICQEDNL----PRFTDCCAKKDPDRNDCFLSLKNSSRGLISPFER---PNAEAACKNYSEHHHTLPGHFIYEVSRRHPLLYASTILSVAMHYDKMMKDCCRTANLEECFRRQAPKVVKPIRE.... 195
98 2.000e-17UniRef50_I6QYU6 Serum albumin (Fragment) n=62 Tax=Plethodon TaxID=8335 RepID=I6QYU6_9SALA  ali  18  405....KTNCAALEKLGSYHFEVMLLGKYTPKIPQVTTPTLIHLIDDMTHVGEFCCKAEKQLPCSEGALGLIIGAMCEKQEGHFVNNQVAHCCSDSYANQRSCFTAMGPDPSYVPPAPSADNDELCAAADSEEEXKKKSFLVDLLKLKPNIEAEQLKEIIASFLGMQEKCCKAEHHAECFAVEGPKLIAKCEGIIGLHPAV.................................................................................................................................................................................................................................................................................................................................................................................................. 606
99 3.000e-17UniRef50_UPI000D09ED11 serum albumin 2-like n=1 Tax=Oncorhynchus tshawytscha TaxID=74940 RepID=UPI000D09ED11  ali  24  12...........................................................................................................................................................................................LLCVSARSQNQICTIFTEAKKDGFKAMALVGLAQNLPDSLLDDVVPLVAEAFTMGIQCCSDEPLDCNRDVADLFQSVCSSETLVKSNLKHCCENTATERTHCFVDHK-AKIPRDLSLTSESPAADQ--CEDFKKDRKAFVESFIFRFSKRNTMLPPHVILAVTKSYGEVLATCCSEAEAQTCFNTKKPTFEHFVRNRVNELKALCIVHNK............................................................................................................................................................................................ 223
100 3.000e-17UniRef50_A0A091U0G7 Vitamin D-binding protein (Fragment) n=3 Tax=Neognathae TaxID=8825 RepID=A0A091U0G7_9AVES  ali  25  60....NRVCSLFTVYGKDKVTFSYLASLAQKMPAASFEELFPLAEDAAEAFSQCC-DSVDEDCMQKKLSEHTAKACG--ALSARDGRVADCCGKNLMQNYFCIALPPAPAPKLPEPQKPTNEQLCGEEGAHQVV----YLFELARRHTSVPDAFLGKLYDASEKVRGECCSAKDASACLDNKLEQMGGELPRFLEKANQLCGQYNKLDFLDFKKR................................................................................................................................................................................................................................................................................................................................................................................... 264
101 4.000e-17UniRef50_Q8UW05 Serum albumin n=4 Tax=Salamandroidea TaxID=30367 RepID=Q8UW05_AMBMC  ali  14  422....KTNCGALDKLKSYLFQNLLIFKYVARMPALSEQSLLRITKSMTTIGEKCCHEDQQMTCSEGGLGIVFGQICMKQKTTPVNEKVAQCCSHSLSSQTPCFSALPVDETYVPPPLFNFNDELCTTSEPEQQSKKQVFLIRLMKQYPHMTDEQLKTCVVNFVPMVDQCCKADNHNECFALEGAKLIDACKAILAVHPAV.................................................................................................................................................................................................................................................................................................................................................................................................. 622
102 4.000e-17UniRef50_UPI0009E46CD8 alpha-fetoprotein-like n=1 Tax=Pogona vitticeps TaxID=103695 RepID=UPI0009E46CD8  ali  17  54...........................................................................................................................................................................................................................................................................................................................................................................................................................SQFLQQSTYDEVHKVVEDMDALAKKCTA-DEHSDPECAKSVSTVLLDEICHEEAIAAKH-GFGACCAQTDPERHECFLTHKNASKGFVPPYQK---PEPEEACKQFHDNKKEVLNHYLYEISRRSPYIKIVTILHAEDEYEKVLTACCEAEDKAACFMEKAPLAKKKFMKAVAV 222
103 1.000e-16UniRef50_UPI0003D73659 alpha-fetoprotein related protein isoform X4 n=4 Tax=Boreoeutheria TaxID=1437010 RepID=UPI0003D73659  ali  13  52...........................................................................................................................................................................................................................................................................................................................................................................................................................AQFLQDAAYDQVQTIAKELLKLAEKCKRLKPESPSECAHQLVAAFLIHICNNQGLVDSHV-FTDCCKMKTAARLRCFLSYKKDDA---DSHDTPLIPRPELTCEVAAENNVSLKERFSYEISRRHPFLYGPTILSMSACYDTAVQSCCQEENETECLRTKLEPIRKYIRGISA. 220
104 1.000e-16UniRef50_A0A1A6GNE0 Uncharacterized protein (Fragment) n=3 Tax=Cricetidae TaxID=337677 RepID=A0A1A6GNE0_NEOLE  ali  20  12......................................................................................................................................................................................................................................................................................................................................................................................................................................................PISDEQHGGCLENQISVFLDEICHKKEISDKH-GLSDCCSQSGEGRHQCLLARKKTAAASIMPFS---FPEPAESCKAYKENREMFMNRVIYEVSRRYPFLYSPAILSLAAQYDKAVPDCCKAENAEECFQTKRASIAKELRE.... 150
105 1.000e-16UniRef50_A0A287D006 Uncharacterized protein n=65 Tax=Eutheria TaxID=9347 RepID=A0A287D006_ICTTR  ali  13  36...........................................................................................................................................................................................................................................................................................................................................................................................................QNYVEENLKDLTSIMIAQFLQKATYEEIQTVAQQLLDLVEKCKNFKSHSATECAHQLMTRFLEHICDNQGMLAKH-LFANCCNTNSTARLKCFLFYKKDYGDHKDGFQSLK---PEMICEMDKENQVTMKERYSYEISRRHPYLYGPTILTMSACYKTAIQSCCQEENKTECLQIKLEPIRKYIREI... 219
106 2.000e-16UniRef50_UPI000A1C3AE3 extracellular matrix protein 1-like n=1 Tax=Boleophthalmus pectinirostris TaxID=150288 RepID=UPI000A1C3AE3  ali  15  59..............................................................................................................................................................SEFLVGLKEGPVAFSPRASRPRAFVPVSKYDVQFPLALPTAQNIQNICLHGFRRPRYPESYFPSSGYGVSKRQADAVNTLEAWFVTCCEEARLCCAIQAWESISHFCEVGFRIKAPQFYCCKLNKSEWLPCFDRSAQNPEYNPPVLTENKFNFDPSSCPFPLAAPTDSNIGSVCRNLKVRPHYNIKCLAKSINTLEKNFKVCCKNNNKLPCAQKTWQEEMKKFCVASKHKRIDFPCC--DGGVQFECFKNISTDPDYSKTLTKNLSSVGVPLKSVVRKCCHLSPIEKSTCIAQSVEELFVSTCSSRKSPP---SVKRCCRLSSPE---CFHKLLMD........................................................................................... 454
107 2.000e-16UniRef50_Q66RQ0 Vitamin D-binding protein (Fragment) n=1 Tax=Sus scrofa TaxID=9823 RepID=Q66RQ0_PIG  ali  21  5...............................................TILSKCC-DSASEDCMAKELPEYTVKIC--DNLSSKNSKFTDCCEKTPMDIFICTYFMPAAPPELPDVKLPTNKDAC---DKGNPKVLDQYIFELSR-KTHIPEVFLSKILEPPLKSLDECCHSEDSTACFKAKGPQFKKELSSFIEKGQELCADYSENTFTEYKKKLAERLRGKWPDATETELEELVKKRSDFASKCCSINSPP............................................................................................................................................................................................................................................................................................................................................. 204
108 2.000e-16UniRef50_UPI0009E51F19 extracellular matrix protein 1 isoform X1 n=1 Tax=Pogona vitticeps TaxID=103695 RepID=UPI0009E51F19  ali  15  154.............................NLPQTGFSHLSRQGDALNALLDRCCSEEEKLPCSSEAWSDALAQFCEAE--FSTKTKPYHCCLLEGAPQERCFLREAPSPKDGSLRGQPSPGEK------------------------------------------PGSC--TDPSRCNTAELASPRSVPKSFPPGEPTDANILNICKLSKFRPRYPAARLPESHFGWVVLQARAVNRVEKAFKKCCRAKDVGCAHRGWETLIQYCKQEFSVKTRPHMCCEKQLDDRLACFAIQAPYPAY------------DKEVTTVNLAQITSSLLDSLC-----RPVSLLSKQKPIPALVQNITEPCCQAEQRTQCAQETKSQFIANICSSQKKTWKDPQKCCAREESQARDDCF................................................................................................................................................................................. 479
109 2.000e-16UniRef50_UPI000514FC63 vitamin D-binding protein n=1 Tax=Phalacrocorax carbo TaxID=9209 RepID=UPI000514FC63  ali  18  6....................................................................................................................................................................................................................................................................................................................................................................................................DKVCQEFQALGKEDFRTLTIIANSRKFSNATFEEISHLVREIVSLAETCCT--EGADPSCYDDGSSALSAKSCSGDSPFPDHPGT------------------------PPQQLPRYLQPSNEELCQAFKEDPKDFAHRFLHDYASSYGQAPLPVLLGSTRTFLSMVSTCCISSTPTTCFLKE--KLERQTISLLTL 174
110 3.000e-16UniRef50_A0A1L8F4G3 Uncharacterized protein n=4 Tax=Xenopus TaxID=262014 RepID=A0A1L8F4G3_XENLA  ali  13  108.............................NLPQTGFSHLTRQGQAINAVYELCCDQEDKLHCAEELWKSALGDFCQEE--FSVKTSHYHCCKKKGKAKEACFKTEAPNPS---------------------------YSFAMGQESGAAGAPRVARARSQSQ-------CSPSSPRC--RREPKYKLPDLSFPPGEPKASNIQNICKLRKLRPTYSESELPTSGFGHFIRQAKTINRLENEYKKCCKDENVACAHIAWEKLDEFCTQEQEVFTKPYECCKER-VNMFSCFASNAPFPEY------------DKEVEQINLSDITSVNLQKLCGDIKVLTKQKQIPLL-----VSELRESCCNTEEMMVCADDQKLAFFETVCDKKDLWKDSQGCCKKKDQERIECF................................................................................................................................................................................... 435
111 3.000e-16UniRef50_UPI00042C24BF extracellular matrix protein 1 n=4 Tax=Sauria TaxID=32561 RepID=UPI00042C24BF  ali  14  124.............................NLPQTGFSHLKRQGDALNFLRERCCPRPERLSCMESAWKEALEQFCDHE--FTVKTKPYHCCKRAGADRELCFTSEAPNPGYLPIDASAVPPQILPAQPGAR----------LGPRLPEVSFP-----------------------------------PGEPTSSNIRNICRL------RKFRPVHAPSAIPTTGYSWLQHQARTTTRMESDFRKCCKNENVNCAHAWEKALAQFCKLELSMKTTPHKCCKQTGKARFSCFSSQAPNPAY------------DKEIQAVSLGEVTPELLDMLCGEMKLFTKQKP-----IPDLIQNMTEPCCSLEERTQCAEKEKARSIAALCKDSWKDKEQCCSQEEEGDRTY...................................................................................................................................................................................... 437
112 4.000e-16UniRef50_A0A0U2IDQ4 Endo16-like 235 n=3 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=A0A0U2IDQ4_SACKO  ali  13  293.......................................................................................................................................................................CCKGEDRRMCFERRQPPAEIMRKMEYIRLEFVCDEMSIPMNEQMRERNSEISLCCMKSEKEERRECFDESRESHYERVCQGEDIPIYFSFYNKGMSM--GKDSQEKRDHICCEEEDDDRIQCFENEERREFFPNMIDEDQIANDLENMCRHMREGESHERKEDIRECCDRRGREKLQCFRRLLHEYIDNV---CSGESESYSYEIGFGESIEEDRMMFPKYDRNDICCSLEGLERYKCFALKAKPAAQRIIDHVEESRISNLCDTILKTCCLLENPDKSECFKTQEMVHIDNVCDEEDMNEVVTMDHPCCLENGEDRYLCFESMSR............................................................................................ 654
113 5.000e-16UniRef50_UPI000642DEDF extracellular matrix protein 1 n=1 Tax=Condylura cristata TaxID=143302 RepID=UPI000642DEDF  ali  11  95..........................................................................................................................................................................................................................................................................................................PVPPRLPLQRPVDPPQPPKVIPQHQGLPPVQAPLRQKELDPPFPHQKEMTLRDKQRGEWPRCPFSPPLSG---PQWEDALDGYCDREQAVKTHHHSCCQHPPSPARDECFARRAPYPNYRVLSKHKQIPGLIHNMTVRCCDLPPPEQACCAEDEKSAFIDELCGSWRNSWHDMAF-CCDLSPGDQQTNCFNTHY............................................................................................. 308
114 5.000e-16UniRef50_UPI0007B89D40 vitamin D-binding protein-like n=3 Tax=Cyprinidae TaxID=7953 RepID=UPI0007B89D40  ali  21  28....................................................................................................................................................................................................ENFCQELKAIGIEKFKEI------QKFPNGTFQEVSCVADEMTKLAEKCCKDDSPDCYDKATEISEKSCGKDSPFPKHIEQCCTLQGQERKLCLASL----RYSADELPSLLEPTNEEICTEFTKDEKDYAVKYVYEFALRHRNIPAGFVLNATQNHVRMAERCCHPAVKNSCFLQE.................................................................................................................................................................................................................... 198
115 5.000e-16UniRef50_A0A1W5ADF7 serum albumin 2-like n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W5ADF7_9TELE  ali  13  23.................................................................................................................................................................................................................................................................................................................................................................................................HAANKICKFYSELKEDGFRTLAFIGLSQNLPESTPSEFKSLVDQAVVTVSECCKKDHHE--DCNKDPEHMFQREVCASQSVAEKN-GLKHCCELTAASRTQCFVDHK---SKILVNVSHEPDVSAQVLCKEYKEDEKKHLGEFIYYFSRQHVMLQPQIIVGIMHGYNEILKSCCHEKDVQSCFDEKKNLFKQKTEERVT. 215
116 6.000e-16UniRef50_UPI000981050D afamin-like n=1 Tax=Castor canadensis TaxID=51338 RepID=UPI000981050D  ali  14  1.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................NQVMNHICSKQD--SISSKIEGCCEKKIPEREDCIINSKKDDRPKDLSLREAKFTDSENVCQERDTDPDNFFAEFIYEYSRRHQDLSTPELLRIGRVYEDLLGDCCNRENPPDCYRHAEDKFNETTEKSLKM 130
117 7.000e-16UniRef50_A0A0R4IIK5 Extracellular matrix protein 1b n=8 Tax=Cyprinidae TaxID=7953 RepID=A0A0R4IIK5_DANRE  ali  14  141.............................MFPSSGFGNVARQGEAVNQLQSVCCGQEEQICCAEQAWKKSLSAYCSQE--FTIKTSHFFCCKKNGRARWSCFDKEASDSSYQVSSEISN---------GNASQKFKGFKYNSSACKGSLASPKALK--------------------------KQTAAPDLTFPPGRPESSNIANICAHRKIRPRYITSCLPHTGYGWLVRQSKAINVLEREYNRCCKEKKQRCAEQKWKKMDKFCKDEKKSKRQQFECCEKKKEEQYACFTSAAPDPSTDGQLSSSAAPPTLHTFCDVHTAIQSMKGFSF---------------------SLDNMAERCCAAQERPACIEAELGSHLNDMCKTKEPVKHHC................................................................................................................................................................................................. 461
118 9.000e-16UniRef50_A0A0M3CSP1 Uncharacterized protein (Fragment) n=1 Tax=Pseudomonas putida TaxID=303 RepID=A0A0M3CSP1_PSEPU  ali  20  4....................................................................................................................................................................................................................................................................................................................................................................................................KHQCGILQNYGERTFQANKLTRMSQKYSNAPFPELLKLVHEMKDAYKECC---EGDMVECVDD-WSELLVSLCSKQDIFS--SKIKPCCELPVLERTRCIIEADFDDKPDNLPSLVEKYIQDKEVCKSYEANHDAFLSEFVYEYARRHPEFS............................................. 149
119 1.000e-15UniRef50_G3IMS5 Serum albumin n=1 Tax=Cricetulus griseus TaxID=10029 RepID=G3IMS5_CRIGR  ali  17  2.....EICSVLFCF----LNDRLLVRYTQKAPQVSTPTLVEAAQNLGKVGTKCCPEAQRLPCVEDYLSAILNRVCVLHEKTPVSEQVTKCCTGSVVERRPCFSALPVDPKEFKAETFTFHADICTLPEKEKQTKKQTALAELVKHKPKATSDQLKTVMGEFAAFLDKCCKADDKEACFSE..................................................................................................................................................................................................................................................................................................................................................................................................................... 178
120 1.000e-15UniRef50_UPI0003C11130 serum albumin-like n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0003C11130  ali  14  51..................................................................................................................................................................................................................................................................................................................................................................................................................IKTEVLAYYSQLLIRSTYDDVNRLANKLIEFLSNCC--LDGAEAGCFKGKADIFLDRICADEASKQKHKETGTCCKKYGSERTNCFKNLQSNPPMKLPPIDDYGV---EQECLAYMANTGSFVEKYLHGFAKRTTRFPATVVTKIAYHYVKTYAKCCNKEEYTDCFTIEKKLFMEKLGDTIK. 227
122 2.000e-15UniRef50_UPI0007BABEFC extracellular matrix protein 1-like n=2 Tax=Sinocyclocheilus TaxID=75365 RepID=UPI0007BABEFC  ali  14  138.............................MFPQDGFGHEYRQADAINQLQSVCCKQDEQICCAEQAWKKSLAAYCSRE--FSIKTSHYFCCKKSRKARWSCFDKEASDTSYHVSSEVSN---------GNSPKKIRGFKYNSS------------------------ACKGSSVSS-PKALMKQTEVPYISFPPGRPDSSNIAHICAHHKIRPRYMPKCLPRTGYGWLIRQSKAINVLEREYNQCCEGEQRCAEKKWKKMVDKFCKDEKKTKGQQFECCKKKGEEQYSCFAASAPDPEYDGALSLPAAPPTLQTLCDTHTAVQSMKGFPF---------------------SVDQMVERCCPRQERPACIEAELDSHLNEMCKAKELAKPHCCAPKIKNRVKCATKLLLRYIGKADKDS...................................................................................................................................................................... 486
123 2.000e-15UniRef50_P84407 Alpha-fetoprotein n=45 Tax=Archelosauria TaxID=1329799 RepID=FETA_CHICK  ali  16  54....................................................................................................................................................................................................................................................................................................................................................................................................................KCAMIMFAQYVQGNTFGQVVKMAEAVTDLAKKCTEV-DRDNPNCRKPLDWIFLNTICQEDNL----PRFTDCCAKKDPERNDCFLSLKNSSRGFISPFER---PNAEAACKNYSEHRHSLPGYFIYEVSRRHPFLYAPTILSVAIHYDEMMKDCCRSANLEECFRRQAPKVVKPIRE.... 227
124 4.000e-15UniRef50_UPI000762A5D1 LOW QUALITY PROTEIN: afamin-like n=1 Tax=Marmota marmota marmota TaxID=9994 RepID=UPI000762A5D1  ali  20  15.........................................................................................................................................................................................................VIQKFIEENMGSITIIAFAQNVQEATFDEMEILMKYVIEYRDKCAHKTLLEYAEIAINVLQERIYAMEVFPQKFSHCCSQVDFERRLCFFYNKKADIGFLPPFPTL---NPEEKCQAYKNKRESFLKHYMHEVARGNHFAFGPTLLTLAALFEEVAKICCEEQQKPNSFQAKFPR................................................................................................................................................................................................................. 189
125 5.000e-15UniRef50_UPI000644737E extracellular matrix protein 1-like isoform X1 n=2 Tax=Clupea harengus TaxID=7950 RepID=UPI000644737E  ali  15  144..............................LPRTSFSHLSRQADALHRYSQQCCQGERTLCCTHQAWEKALELFCEEE--FSIKTSHYFCCKIEGKARWNCFEREAPNPSY--------------------QATTHYFGPELLPRGPAFTFTNKCPRSQRRPQRMSAATRAQRGQS--GHIPDISFPPGRPTSSNIRMVCKL------RKLRPRYTPSCLPSGGFGWLARQSKAINRLERGLKLCCKKDVLACADKWREEMDRFCQDEHGVKTKHYECCKLPGEARLSCFSSKAPFPDYRGELLQRQIVPAD------------------LSHFCVMHKILNKQ---KVALPVDNVVNKCCHLEQRNACVVDMLDSLQRESCSAEP....................................................................................................................................................................................................... 464
126 5.000e-15UniRef50_S7N7I3 Serum albumin n=2 Tax=Myotis TaxID=9434 RepID=S7N7I3_MYOBR  ali  16  107....................................................................................................................................................................................................................................................................................................................................................................................................................QMLLVDFSQLLRMSHLDEIVKLANDLTDLADVC--ALNELAENCGKSLHTLVGEKLCSVKSL----GKLAACCEKQEPERNQCFLKHKDDDLDILPLPPIDPSAT----CTAFHQFEQKVLGTFIYEIARRYPYFYGPELLYYTQAYKETLTECCKDAGADARLGPKLDALRKEVLRS... 274
127 1.000e-14UniRef50_A0A1W4YG51 extracellular matrix protein 1 isoform X1 n=3 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W4YG51_9TELE  ali  16  129..........................................INRVESWYSTCCSEELTLCCAQQAWEHALSQFCEEE--FSIKTSHYQCCKIRGRERWNCFEGMAPNPTYEPSSQGTVNTQ------SPPEPGFTW--------NPNNCPSIRLQL---------------NPKNFSEGTSTLNFPPGRPTSANIDHACNL------RKMRPRYPLKCLPQMGYNSLVRQIKTVNKLEKGIDKCCKGRTLTCVRKWRKLMDQFCLNEQMVKTSQFPCCLYEDKERYTCFAERSPNPEYTREIEQSEVF.................................................................................................................................................................................................................................................................................... 370
128 2.000e-14UniRef50_A0A091CRY6 Alpha-fetoprotein n=1 Tax=Fukomys damarensis TaxID=885580 RepID=A0A091CRY6_FUKDA  ali  17  15.........................................................................................................................................................................................................................................................................................................................................................................................................................................................SEQPAECFENQLSTFLEEICHERAIAEKH-RLADCCSRSEEERHKCLLARKKAASASIPALQVPDVVTS---CKAYEENREMFINRYIYEVSRRHPFLYAPTALSLAARYDKILPSCCKAENADECFQTQVASITKDLSES... 151
129 2.000e-14UniRef50_A0A1U8BMK2 afamin n=1 Tax=Mesocricetus auratus TaxID=10036 RepID=A0A1U8BMK2_MESAU  ali  19  366.......CKLFQGLEKDALLLHYLVKFTKAAPQLSLEELIYLSKGMTEALTTCCTLSEEFACVDDLADLVLGDLCGVNENRTINPAVDHCCRADFAFRRHCFEHLEADTTYALSSVSALISALCQNHNEDLQNKKHRFMVNLVKWMPEITAKERLCLFTKFTAVGEKCEEVQEPETCFRPEGSNIGNESE........................................................................................................................................................................................................................................................................................................................................................................................................... 552
130 5.000e-14UniRef50_A0A2U4A0Y9 extracellular matrix protein 1-like n=1 Tax=Tursiops truncatus TaxID=9739 RepID=A0A2U4A0Y9_TURTR  ali  16  53......................................................................................................................................................................................................................HVVYGPWNLPQTGFSHLVRQGETLETGYSRCCRTNRLDCAKTWEDAMTRFCEAEFSVKTRPHWCCKRQGEARFSCFQDEAPRPHYQLCPSHQPGISSGPEL-PFPPGLPTLDNIKNICHLRRFPATDPIQRQLQALTQLEGEFQHCCQQGNNHTCTWKA.................................................................................................................................................................................................................... 227
131 5.000e-14UniRef50_A5H0J9 Serum albumin (Fragment) n=2 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A5H0J9_ONCMY  ali  20  1...................................................................................................................................................................................................................................FDQLHIVSERVHDVLHDCCKDELPCAEEKLTDAIDATCEDYDPINPRIAHCCNQSYSMRRPCILAIQPDTEFMPPELDASNFHMGPELCTKDSKELLLSGKKLLYGVVRHKTTITEEQLKSISTKYHSMKEKCCAAEDQAACFTEEAPKLVAESAE.......................................................................................................................................................................................................... 163
132 6.000e-14UniRef50_UPI0006B1FA03 serum albumin-like n=1 Tax=Thamnophis sirtalis TaxID=35019 RepID=UPI0006B1FA03  ali  19  51.......................................................................................................................................................................................................................................................................................................................................................................................................................LVLFAQALPNTTLEELKTLSANVKAIHQKCVD-NQYSSPECTKPLGIVFLDLLCHDEE-FSKKYGINDCCAKSDPERHACVLSHKISAIG---SVSPFVRPTAEEACQAYHNDRNDVLAHHLYEISRRNARAPVTVLSAATKSFDKILETCCKEVEKDTCIEGKATVVRNKAREII.. 221
133 6.000e-14UniRef50_A0A2I0MGU6 Uncharacterized protein n=1 Tax=Columba livia TaxID=8932 RepID=A0A2I0MGU6_COLLI  ali  19  80............................................................................................................................................................................................................................................................................................................................................NVSQRHPFLYAPTILSAATSYDETMNCCRNAEDPTECFQKQAPKVLKPIKEDSLRQEHTCGILNKFGERTLKALKLAQISQTFPKADFVTVNKLVMDIVNMHKDCCC---GDMLDCMHD-RERILYYVCTNQDI--ISSKIKKVCEKPLLQRSECIVNAENDNKPADLSPHIREFIEDKN---------------------------------TTGKGYKDLLKECCKTGCPADCCSEELRKHIYETESVMK. 299
134 7.000e-14UniRef50_P21847 Serum albumin (Fragment) n=2 Tax=Lithobates catesbeiana TaxID=8400 RepID=ALBU_LITCT  ali  15  185EELRKQNCGALQLLGFRDYNIQLLFRYFFKMPQVTAPTLVELAGRMTKVAVYCCAENKQQTCAEEKLDILLGEMCEKEKHTFVNDNVRHCCVDSYANRRKCFTDLQRYPNYVAPSKLHFNEDLCKGSEDDQIKKKLEVLVEYMKMKPDCGPEKLKEVVEAFRKIDIKCCAAEDHQKCFDDEKAGLLQIIE........................................................................................................................................................................................................................................................................................................................................................................................................... 380
135 8.000e-14UniRef50_UPI000C812D20 LOW QUALITY PROTEIN: afamin n=1 Tax=Loxodonta africana TaxID=9785 RepID=UPI000C812D20  ali  24  2.........................................................................................................................................................................................................................................LVKEMMEIRNKCITDMTPECAKLVDDVLQESIRTMKGLPQKFSHCCGKKDFERRRCFLYNKKADVGFLPPFPT---VDPEKQCQDYKQKKDLVLNNYLFEVARRNPFVFYPILLTVAARFEEVAKTCCKEQDIASCFRT..................................................................................................................................................................................................................... 140
136 1.000e-13UniRef50_UPI000775B535 vitamin D-binding protein n=1 Tax=Protobothrops mucrosquamatus TaxID=103944 RepID=UPI000775B535  ali  18  108....NKACALHALLGENKTKVSYLIKFTQQTPSLPFENAMTLAGEASKILSKCCA-SLEENCIQNELKRHIAHICN--TACSGNERIRTCCSKDDVGKYLCIYSLPAKRSEVPRSPSSIDEGVCREGGEID---VYRNIFDVARIYTRAPEALIITLYSASQAAATDCCDLLDVRSCFAERDSTIAPLQALIEKGNE-ICGEYADHTYVEFLKRLKANVLALLPAGTLETVSSLLEQRIGYVTKCCHLNAPPIYCGIQDVL.................................................................................................................................................................................................................................................................................................................................... 362
137 3.000e-13UniRef50_UPI00073FBB43 vitamin D-binding protein n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=UPI00073FBB43  ali  21  4................................................................................................................................................................................................PYEKERICQEYADFGKETFKAIGVILYSQKFSTGTFEEINAVTDEMVKLADKCCAEESPDCYDTVATKMSEISCGKDSPFPKICKCCGEKGLERKLCLAAL----RVTSEELPSLQESSNDEICKQFKQDPKGYSLRYVIELTTYYGQISFEEVSPIASYLQEGLSNCCLDPQP-DCLMKK.................................................................................................................................................................................................................... 192
138 5.000e-13UniRef50_UPI0005D18646 extracellular matrix protein 1-like isoform X1 n=2 Tax=Takifugu rubripes TaxID=31033 RepID=UPI0005D18646  ali  13  101.............................YFPNSGYGQLKRRATAVNNAFSDCCRQEATLCCATQAWEHHIKLFCEEDS--SVKDRLYECCRKRGGEQHDCFHDDAQNPNYDPTEERPV----------TPVASKDEFSFEPS----TCPRPVVTPHSFREHSNIKK--KDERNKQLPSSQNVSNFPLGRPTPDNIEALCQN------KKLRPLYSVNCLAGPQNKLLAQQAKSINRMERGFKVCCKQEVLNCAEQKWREELDMFCEKIRTKKQNVHCCSLAQHHRFECFQDASPDPHYQMFSAKEELALN--KLCEDHKLIKKKPLKAFVSQCCQNKTDCFEQRIMEISKKTSPAVSRCCRAAGVPGCLSKLFMHAVNKVA--HIKKKKTCPL............................................................................................................................................................................................... 464
139 8.000e-13UniRef50_S7N7H2 Alpha-fetoprotein n=1 Tax=Myotis brandtii TaxID=109478 RepID=S7N7H2_MYOBR  ali  16  3...................................................................................................................................................................................................................................................................................................................................................................................................................................................................HMTTFLEHICDNQGMVDKHV-FSDCCNVNNTARHKCFLLNKKDDANYREILQ---IPNLEQICEVNKGNQVLVKKRYIYETSRKHPFLYGPTILTMSACYETAVQSCCQEENKTECFQIKR............. 119
140 8.000e-13UniRef50_A0A0P7V086 Uncharacterized protein n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A0P7V086_9TELE  ali  23  2..........................................................................................................................................................................................................................GSQRFANGTFEEISATSDHILKILEKCCSPDANPGCYEKEELVTLFCRKDSPFPKHLDKCCGKGEHEWGLCLASL----HYSSEELPSLQELTNEEICEQLKHGAQVFSARYTYELSRRYQSIPADLVLKATKNYVEMAEKCCSRSLSKICFLQE.................................................................................................................................................................................................................... 156
141 2.000e-12UniRef50_A0A1B8Y8J6 Uncharacterized protein n=4 Tax=Xenopus TaxID=262014 RepID=A0A1B8Y8J6_XENTR  ali  20  23.....................................................................................................................................................................................................................................................................................................................................................................................................................RALVFYAKMKPSDPLEKAIDFDNNYMALASQCC-MPESLTSECFETWSGVLFAHICSLME----NNLQKACCLKNIPERETCLTELAVEESKTLPNVSIDA----EQLCRLRQNLQLLR--WIVYEYSRRNPQFDVKKNLDSAVRVNGLITYCCATNNPSDCISS............... 176
142 2.000e-12UniRef50_A0A2S6W9S6 Uncharacterized protein n=1 Tax=Streptomyces sp. 46 TaxID=1777322 RepID=A0A2S6W9S6_9ACTN  ali  21  1......................................................................................................................................................................................................................................MREFTKRLVNIAAECCHQDDLSCAQNHLELLGYLCHEQHPINKQVCKCCSDSYAKRRECFSALGVDPEYVPVPFNPEVVSFHGDYCTAKAEEQQQKKQTVLIHMLQHKPDMTDEQLAGAIVDFTGVVTGCCAEENKDECFNRETPKLIERTK........................................................................................................................................................................................................... 158
144 7.000e-12UniRef50_UPI0003C29DC6 alpha-fetoprotein-like n=1 Tax=Alligator sinensis TaxID=38654 RepID=UPI0003C29DC6  ali  17  9..................................................................................................................................................................................................................................................................................................................................................................................RDGQPVVIKPVKEDGSMQEHTCEILKKFGERTLKALTLALFSQKFPKADFDTMMKMTTDIVEMQKECCQ---GDMLDCM-HNRAEFTSYACSHQD--AISSKIQNCCEKPVLERSKCIFMSENDDKPTGLSPQVRQFIEDQDVCKHFEEKKDIYLAE.......................................................... 159
145 1.000e-11UniRef50_H2ZZM2 Uncharacterized protein n=2 Tax=Latimeria chalumnae TaxID=7897 RepID=H2ZZM2_LATCH  ali  21  18.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PFPKHPGTEDCCTKEGLQRKLCLAAL----HHSLDEFPAYVEPSNEELCQSFKEDPQLFSDMYLYEFSRTYLSAPLGLLVNATNGYLKMIASCCNAKNTNICFLGERLQLKNIL...... 127
146 2.000e-11UniRef50_D5H440 Serum albumin 1 protein (Fragment) n=2 Tax=Oncorhynchus mykiss TaxID=8022 RepID=D5H440_ONCMY  ali  17  166.TELRALCIVHKKYGDRVVKAKKLIQYSQKMPQASFQEMGGMVDKIVATVAPCCSGDMVTCMKER--KALVDEVCADKSVLSRAAGLSACCKEDAVHRGSCVEAMKPDSK........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 272
147 3.000e-11UniRef50_Q90WZ8 Serum albumin (Fragment) n=1 Tax=Larus argentatus TaxID=35669 RepID=Q90WZ8_LARAR  ali  20  1.................................................................YLSIVIQDMCRRQETTPVNDNVSHCCSDSYAYRRPCFTAMGVDTKYVPPAFDPEDEKLCTAPPAEQELGQMKLLINLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDIETCFGEE.................................................................................................................................................................................................................................................................................................................................................................................................................... 120
148 4.000e-11UniRef50_A0A1B8Y8N3 Uncharacterized protein (Fragment) n=4 Tax=Xenopus tropicalis TaxID=8364 RepID=A0A1B8Y8N3_XENTR  ali  17  4.........................YFTMHHPVGLMGNAAEFATTYQKFSSQCCDETKWSDCFLDESEVLLLQFCSK----SSSAAQIACCQMTGTQRSECLDNAADEEAQISREIYVTSEQLCSIHNAPDGRLIIWYTYEYTRRNRNDSLDVVLKSVSELGLALKLCCQDQNKSDCFSTHLAPL................................................................................................................................................................................................................................................................................................................................................................................................................ 161
149 4.000e-11UniRef50_W5LIH9 Extracellular matrix protein 1b n=4 Tax=Characoidei TaxID=1489739 RepID=W5LIH9_ASTMX  ali  14  123..............................LPSSYFGYLVRQANAINRLFSVCCSSGTLLCCADQAWKKSLSAFCDDE--FSVKTRHYHCCKQTGSNRRTCFE--KASPSHLQSYVPSDHERGSWAVIP---SMAEGFNFNPSSCHKQRSLIARRAIT--------------------GKIPKDVFPPGRPNADNIESICANHKQ------RWWYVSKCLLRKANSAVAHQAKAIDVLEKGFGQCCKREKQSCAEMKWKMMDDFCKDGMKADMKQFVCCEKEGEEQYNCFAAAATNPGYSPNNDSASLYEARPSLDTFCDM------------YRKYHSL--QRELGSWHIVADKWSTRCCSEEKNSACLQTQMQSILDEVC-SHPLWKNSGSCCRERGKSRSKCF................................................................................................................................................................................... 464
150 5.000e-11UniRef50_UPI000D6A4820 serum albumin B-like n=1 Tax=Python bivittatus TaxID=176946 RepID=UPI000D6A4820  ali  19  10......................................................................................................................................................................................................................................................................................................................................................................................................................................................................ELSQYVC--KNKDTISSKLDHCCGLPLVERPTCLHGLENDEKPAPPDHPSKQIINEAEACQSYNEHADEHLESFLFNLTRSHLELSKLFDVEIFLRYKDLLGQCCKLEDHAQCLHTGEEQLESLITKI... 135
151 5.000e-11UniRef50_UPI000CD605BF serum albumin 1-like n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD605BF  ali  19  378...........................SRMLPQATFLQMDAISEVLYDIMKHCCSIDRALPCATTKVTAFLDNMCQDMPPENRNPQVIKCCNESHSEWRFCIGDLEADENFQPPFTEANNASVCDKRADERLQSQKRLLYDIVRLSMKLPPNLAMTIFDKFDQMLSKCCEEADKDTCLTTEGTKLILHIKIFVEE...................................................................................................................................................................................................................................................................................................................................................................................................... 552
152 1.000e-10UniRef50_UPI00046296F1 extracellular matrix protein 1-like n=1 Tax=Anolis carolinensis TaxID=28377 RepID=UPI00046296F1  ali  14  145.................................................................................................................................................................................LPQSNLAEFPPARPAPSNIANICSEGRK---------KLSYGPWNMPQTSFSHLSRQLNELEAGVKTCCQLDEPCCLEAWEKVLMHYCRWEFSVKTKPHECCLKDQKERFSCFTNLAPFPAYDMAFPLVSLAEINPQLCGQFTLLNKQKLIPSL---------------------IQNITESCCQLQGSEQCSKDAKSHLVSTLCTSRRNTWKDPQRCCAHAEDAPREACFANYLDSLPLASLAE................................................................................................................................................................... 374
153 2.000e-10UniRef50_A0A1L8FBW7 Uncharacterized protein n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8FBW7_XENLA  ali  16  65..........................................................................................................................................................................................................................GRHNLPTNSFGHLLRQANSLEEGYKKCCEQDKLSCAETWKKTLEDYCEEEISIKTKGNVCCNRQGAARELCFSITAPDPNYGADSSQEGESPRGLNRCPFPPGKPESGNIRNMCSLRHVRPRYSYVQQTQALDLLEDEYEKCCEDENVP-CANAAWEKVLAEFCTWKREADNKPYKCCQKQSRISMYSCFARRAPYPQY........................................................................................................................................................................ 298
154 3.000e-10UniRef50_P85295 Serum albumin (Fragments) n=1 Tax=Capra hircus TaxID=9925 RepID=ALBU_CAPHI  ali  76  16................................................................................................................................................................................................................................................................................................................................................RHPEYAVSVLLR------------------------------HLVDEPQNLIKKH-------GEYGFQNALIVRXXXKAPQVSTPTLVEISR............................................................................................................................................................. 70
155 4.000e-10UniRef50_A0A1L8HVK7 Uncharacterized protein n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8HVK7_XENLA  ali  24  3...........................................................................................................................................................................................................................SRKYSNASFEEIGHLVTAIVSLAETCCAKEAAA-----------DCYDKKGIGIVLANLCRLGPLERKLCLADVKQ------PPKEFLTLNHPMKSCVNLSKKKLVFSARFLYDYASNYTQAPFLAVVNFIEKYLNMIRECCTKPRQTLCFLKQRLQLKP-LHLLTVMSNRLCGRYNIYGEEKF...................................................................................................................................................................................... 170
156 6.000e-10UniRef50_A0A146ZT82 Extracellular matrix protein n=7 Tax=Ovalentaria TaxID=1489908 RepID=A0A146ZT82_FUNHE  ali  15  81...................................................................................................................................................................................AKINSMTNADVPFPPASPTTLNLGAICQKGHCRPRYLASFFPRSGASHFRRRGKAINRLESWYSLCCEAQKLCCAQQAWKLLSQFCVEEFSTKTLAYECCEFKGDARWSCFDSELPNPDYSPAVLSEPGFTFNQDACQ............................................................................................................................................................................................................................................................................ 229
157 6.000e-10UniRef50_A0A1A6GYU5 Uncharacterized protein (Fragment) n=1 Tax=Neotoma lepida TaxID=56216 RepID=A0A1A6GYU5_NEOLE  ali  21  65.........................................................................................................................................................................................................RFNDLGEQHFKGLVLVTLAQHLQKCPYEEHVKLVNEITEFAKTCVADESAANCDKSIQTLDELCSNLRENYGELADCCTKQEPERNECFLQHRDDN----PNLPPFVRPEAEAMCTSFQEN....................................................................................................................................................................................................................................................................... 185
158 6.000e-10UniRef50_A0A1L8HVA3 Uncharacterized protein n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8HVA3_XENLA  ali  17  65..................................................................................................................................................................................................................................................................................................................................................................................................................FQTNALIFYSQILVKNSLEDIRSLVRSLSDFVSNCC--MQDARKDCYQDKNSIFIDRVCEDPVSKSKSHDISMCCSKGHMEREQCFRAVQNGPSVKMPEI-DTLVPFWTQ-CLEFITDQRTFMEMYIYSLSRHYRIYPPKTMAKIIFASLRTYRICCKLSTSLYCIDD-VEQQNKKIKKNVTI 242
159 7.000e-10UniRef50_A0A226ME89 Uncharacterized protein n=1 Tax=Callipepla squamata TaxID=9009 RepID=A0A226ME89_CALSU  ali  16  13...................................................................DLVLGEICRRHLTNPINPGVCHCCSSSYALRRPCMGKLEIDESYVPLSLTPDHEDLCTTEDEKLQHKKQEMLINLIKYKPQITQEQLTSVTVAFTAMREQCCKEENREACFVKEVLVLLSFIYSQSK....................................................................................................................................................................................................................................................................................................................................................................................................... 143
160 8.000e-10UniRef50_UPI0004422975 serum albumin-like n=1 Tax=Python bivittatus TaxID=176946 RepID=UPI0004422975  ali  19  2......................................................................................................................................................................................................................................................................................................................................................................................................................................................................ELTEYVCKHKD--TISSKLDHCCGLALVERPTCLQGLENDEKPAPPDHPPKQIINEAEACQSYNEHPDEHLESFLFNLTRSHLELSKLLDVEIFLRYRDQLKECCKVEHHVECIHGGEKQLESLVTKI... 127
161 1.000e-09UniRef50_UPI0007AD1A99 extracellular matrix protein 1-like n=2 Tax=Cyprinidae TaxID=7953 RepID=UPI0007AD1A99  ali  11  72...............................................................................................................................................................................................................FSKTPVRYPKDMFPQDGFGHEYRQADAINKLQSWYGVCCQEEQICCAEQWKKSLAAYCFQEFTIKTSHYFCCKKSRKARWSCFDKEA-----SGFPPGRPDSSNIAHICAHHKIRP-----RYMPKCLPRTGYGWLIRQSKAINVLEREYNQCCEEKK............................................................................................................................................................................................................................ 225
162 1.000e-09UniRef50_A0A2G9S8Y5 Uncharacterized protein n=1 Tax=Lithobates catesbeiana TaxID=8400 RepID=A0A2G9S8Y5_LITCT  ali  15  30.............................................................................................................................................................................................................................................................................................................................FPPGEPKASNIQNLCKLRKYRPLYSDTELAKAINDMENAFRKCCKTEDVTCAHSGWQKTLSKFCEKELEVKTKHYECCKNDQASMFRCFASEAPFPEYDKKLLTKQKMLPLLVLGIKNSCCVLPQDKRLTCAQEQKETFMKTLCGPKKDSWKDNQ--NCCSMDELERGECFN................................................................................................ 232
163 2.000e-09UniRef50_A0A1A6GEB5 Uncharacterized protein (Fragment) n=1 Tax=Neotoma lepida TaxID=56216 RepID=A0A1A6GEB5_NEOLE  ali  15  212................DDFLQEFLYEYSRRHLELAVPVILRVFATYKQLLEKCCKSESPLECHSPGKEMFQRVICESQDRVKIYCDLHKCCDSSYAFRKPCFDDLQVDGTYISPSVISLREDLCQAQEEQLQIEKQKLLSNLVKQQPHAAEEAFQSIGEDFIWLVEMCCSAEKRQICFQEKVSMPFK.............................................................................................................................................................................................................................................................................................................................................................................................................. 424
164 4.000e-09UniRef50_A0A2I0TGV4 Serum albumin n=1 Tax=Limosa lapponica baueri TaxID=1758121 RepID=A0A2I0TGV4_LIMLA  ali  13  101......ICKEYQD-NRVPFLGHFIYTVARRNPFLYSPTILSLAADYEHALQSCCAGSDVGACLDEKAE-LMTYICSKQDVFSS--KIKECCERPVVERSQCIIESEFDPADLPSLVEKYVQEVCKSYEAGHDEF-------LSERQETTPI----------NDQVSHCCSDAYRRPCFTAMGVDTKYVPPAFNPDMFNFDEKLCTAPPDERQMKLLINLIKRKPQMTEEQIKTIADGFSAMVEKCCKQSDIDTCLGEEVFPISF................................................................................................................................................................................................................................................................................................................................. 346
165 5.000e-09UniRef50_UPI000A280339 LOW QUALITY PROTEIN: serum albumin-like n=2 Tax=Phascolarctos cinereus TaxID=38626 RepID=UPI000A280339  ali  21  287.......CDLFEKVGEYNFENATLIRDTKRLPQSPTPTLVGLVHHFGKVATRCCKDQEKTACAEDHGAIVYDKLCHQHEKTPVSDRITKCCTDSLVNQRPCFNAFGVDDPYFSADTFTFHADLCTLPEEEKQNNKQSQEHLVS.......................................................................................................................................................................................................................................................................................................................................................................................................................................................... 428
166 7.000e-09UniRef50_UPI000C9DB15F alpha-fetoprotein isoform X1 n=2 Tax=Equus caballus TaxID=9796 RepID=UPI000C9DB15F  ali  17  31.........................................................................................................................................................................QRPHHHPVATIWKQMFQRVVHESHEHVKNHCDLRQKLGDSNFHDSLIVLYTKKAPQLSAQELVMFTKNMAAAATKCCDEQQFICMEDSVKLLGALCHEAKPINAGVGHCCDDSSAFRKPCFDDLQIDETYISPPLSCGQVISKEDLCKAQEEE....................................................................................................................................................................................................................................................................... 190
167 8.000e-09UniRef50_A9UHN1 Alpha fetoprotein (Fragment) n=2 Tax=Rodentia TaxID=9989 RepID=A9UHN1_MICLV  ali  19  1............................................................................................................................................................................................IEESQALAKQSCAAFQKMGPYYLQNEFLIAYTRKVPQLTSAELIDLTXKMVGIASTCCQEDKWSASGEGAAFIGHLCHEANPLNPGIGHCCNSSYSNRRPCLTSLVRDESYVPPPFSADK..................................................................................................................................................................................................................................................................................... 126
168 8.000e-09UniRef50_G5E2F3 Putative group-specific component (Vitamin d binding protein) (Fragment) n=1 Tax=Hymenochirus curtipes TaxID=8362 RepID=G5E2F3_9PIPI  ali  21  181....SRLCGRYNSYGEEKLKFSALIMLSQKIPSAEFKDVKPIIEQSTKALAKCC-NSLTDDCIENELSTHVQQVC--KKFSTKDARVSECCKRSSSEILYCLHSLPAAESTLPKLQWPKTNQLCK---KGKNEEMIKYTFELARRNTKLPF.................................................................................................................................................................................................................................................................................................................................................................................................................................................. 322
169 1.000e-08UniRef50_H2L3P1 Extracellular matrix protein 1a n=17 Tax=Percomorphaceae TaxID=1489872 RepID=H2L3P1_ORYLA  ali  20  51...............................................................................................................................................................................................................................................................................................................................................................................................................EGSGRPRYPDSFFPPSGYSHDRRRGKAINRLESWFSLCCSQQPSQILCCAQQAWIQALSQFC--EEEYSTKTMVYECCEDKGPARWICFNSELPNPDYSPKPPQEPGFSFDPNVC....................................................................... 174
170 1.000e-08UniRef50_G3PF11 Uncharacterized protein n=3 Tax=Percomorphaceae TaxID=1489872 RepID=G3PF11_GASAC  ali  18  105................................................................................................................................................................................................................................................................................................................................................................................................................GDRRPSYPESYFPASGFGQQKRKASAVNKAESWFSTCCQGNQELTLCCATQAWELYIQSFC--EEASSIKDRLYHCCKLSGNDELACFQNDAPNPNYVPPLPSTGVFPFDPSTC....................................................................... 227
171 1.000e-08UniRef50_UPI0006B1DB52 serum albumin-like n=1 Tax=Thamnophis sirtalis TaxID=35019 RepID=UPI0006B1DB52  ali  18  1...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................LCHDEE-FSHKYGIDDCCAKADPERNECVLSHKV------SPIGRVDHPSAEKTCQAYHNDKSAVIVQYIYELSRRYPKALVVVILHGTQNYDKILETCCAATDKDACINEKATEATKKFREII.. 117
172 2.000e-08UniRef50_L5LI30 Serum albumin n=1 Tax=Myotis davidii TaxID=225400 RepID=L5LI30_MYODS  ali  16  148........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LAECCAKQEPERNQCFLKHKDDDLDIPPLAATD----PSAICTAFHQFEQKVLGTFIYEIARRHPYFYGPALLYYTQEYKGDLTEGCQGAGADARLGPKLDALQKEVLRS... 253
173 3.000e-08UniRef50_UPI0009A05CE6 LOW QUALITY PROTEIN: serum albumin 2-like n=1 Tax=Oncorhynchus kisutch TaxID=8019 RepID=UPI0009A05CE6  ali  18  2..............................................................................................................................................................................................................NNNAFEKSMMVHYTRIMPQASFDQLHMVSERXHDVLHDCCKDELPCAEEKLTDAIDATCEDYDPINPRIAHCCSQSYSMRRPCILAIKPDTEFTPPELDASNFHMGPELCTKDSKE....................................................................................................................................................................................................................................................................... 124
174 5.000e-08UniRef50_G3PF08 Uncharacterized protein n=2 Tax=Percomorphaceae TaxID=1489872 RepID=G3PF08_GASAC  ali  18  122................................................................................................................................................................................................................................................................................................................................................................................................................GDRRPSYPESYFPASGFGQQKRKASAVNKAESWFSTCCQGNQELTLCCATQAWELYIQSFC--EEASSIKDRLYHCCKLSGNDELACFQNDAPNPNYVPPLPSTGVFPFDPSTCLRTEMTLQSVQGQ.......................................................... 257
175 6.000e-08UniRef50_UPI0007B93415 vitamin D-binding protein-like n=1 Tax=Sinocyclocheilus rhinocerous TaxID=307959 RepID=UPI0007B93415  ali  23  4.....................................................................................DFRKCCSKPALDTLPCVDDLKRQPRQSADVANPVSSKICE---EAQPHGIDRYLFLIGVNHASISLPVLTTVLDRIKNTVTACCSSADVTACLTEKESKLKKTIALLS-KLDGTCSYFR------LDLPSFKTLMQKEVQGEGGE--KQTQAWVDLGTSCCSQRSPACQKLTEDVIKY.................................................................................................................................................................................................................................................................................................................................. 171
176 1.000e-07UniRef50_UPI000B4F8699 serum albumin 1-like n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=UPI000B4F8699  ali  25  6............................................................................................................................................................................................................................................................................................................................................................................................................................................................PFLCPLSKSTNVLDTTCNDDDYSSINPRIARCCNQSYSMRRPCILAIQPDAEFTPPELDANDFHMGPELCTKNSKDLLLSGKK.......................................................... 88
177 1.000e-07UniRef50_UPI000CF83A0E extracellular matrix protein 1-like n=1 Tax=Oryzias melastigma TaxID=30732 RepID=UPI000CF83A0E  ali  15  124...............................................................................................................................................................................................................................................................................................................................................................................................................HGDFRPRYPKSYFPTSSFSKFKRMAAAVNNAESWFGTCCNQNNDTVLCCTTQAWELSVKLFC--EEDSAVKDVLYECCRKRGIDRLKCFNADSLNQNYQPPVPPTAEFNFDPSICPRKLMTPRSVRKKEKKTFTSQKTDINFPLGQPTADNIESL............................... 287
178 1.000e-07UniRef50_UPI000510EFFD serum albumin-like n=1 Tax=Pelecanus crispus TaxID=36300 RepID=UPI000510EFFD  ali  19  13.................................................................................................................................................................................FSSATSRNLQRVARDTDHKSEIAHRYNDLKEETFKAVAMITFAQYLQRCSYDGLSKLVKDVVDLAQECAHEDDPKCKKPLPTILDEICEKLRDSYGAMADCCSKADPERNACFLTFK---IPQPDFVQPYQVPASDVICQEYQDNRVSLL.................................................................................................................................................................................................................................................................. 163
179 2.000e-07UniRef50_H9G5I0 Uncharacterized protein n=1 Tax=Anolis carolinensis TaxID=28377 RepID=H9G5I0_ANOCA  ali  14  5.........................................................................................................................................................................................FPPARPAPSNIANICSEGRK---------KLSYGPWNLPQTSFSHLSRQLNELEAGVKTCCQLDEPCCLPQWSDALEYYCLSEFAVKTTPYDCCKLEGRRRERCFVQGARFPRY.............................................................................................................................................................................................................................................................................................. 116
180 2.000e-07UniRef50_UPI000A1C4CFC extracellular matrix protein 1-like n=1 Tax=Boleophthalmus pectinirostris TaxID=150288 RepID=UPI000A1C4CFC  ali  18  47................................................................................................................................................................................................................................................................................................................................................................................................................GNRRHRYPAHTIPSSWSSHFRRRATAITRLESWYQFCCSGPMIQQLCCTQQAWMQALSQFCV--EEFSTMTAAYDCCRLQGAARWICFSTEPFNPSYSPTLEHITQFTPNAEV........................................................................ 161
181 2.000e-07UniRef50_UPI0007ACB6EE serum albumin-like n=2 Tax=Cyprinidae TaxID=7953 RepID=UPI0007ACB6EE  ali  18  83....SNVCNNQVNFKSFKFG---LSAYYGNLLGLSFEKASAISARFQSGLEKCCLQPQPERIIQEL-TSFQKVLCSESKLDAMSEDFRKCCIKPALDTLPCVDDLKRQPRQSADVANPVSSKICEEAQPH....................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 204
182 3.000e-07UniRef50_UPI00077D98C7 serum albumin-like n=2 Tax=Rodentia TaxID=9989 RepID=UPI00077D98C7  ali  20  34.........................................................................................................................................................................................................RFNDLGEQHFKGLVVVTLAQHLQKCPYEEHVKLVNEITEFAKICVADMSAANCDKSIQTLDKLCSSLCENYGELADCYMKQEPERNECFLQHKDDN----PNLPPLVRTDAETMCTSIQENTVSF................................................................................................................................................................................................................................................................... 158
183 3.000e-07UniRef50_UPI00093D5DBB extracellular matrix protein 1 n=1 Tax=Meleagris gallopavo TaxID=9103 RepID=UPI00093D5DBB  ali  14  104..............................LPPAAFAHLRRQVAALDSFLDSCCQHHTPLPCARRAWTDVLDTFCEDE--FGVKTRQFHCCHRHGAARRRCFADATMGTAEITEITEITVFEPVLVPSFPPGEPNAANIENICRLRGLRPSPKGLPGPARFHSRLERRCCHNSSLECAHTAWQRGLERFCREEGAVKHRCCKQEVHNISLARPGPAMLRTLCGPIRLLSKRRPVPELLEAVTTTCCQDEQSPCAEEQSQQIDVLCAAPRSSWRDPRGCCAWGGNERLRCFEEE.................................................................................................................................................................................................................................................................................................... 399
184 3.000e-07UniRef50_A0A091U2F7 Serum albumin (Fragment) n=2 Tax=Neognathae TaxID=8825 RepID=A0A091U2F7_PHORB  ali  10  57....KEVCKSFEA-GHDAFLSEFIYEYSRRHPEFSTQLILRVAKGYETLLEKCCKAANPAECYANAVEELNKHIKETQDVVKTNCELLTTHGEPDFLKALLIRYTKKMPQVSTDTLLEIGKKMCQLPEERRLPCSEGYIHDMCRRQETTPI----------NDNVSHCCSDS-----YAYRRPCFTAMGVDTKYVPPAFDPEMFNFDEKLL----LVNLIKRKPQMTEEQIKTIADGFTAMVDKCCKQSDIDTC........................................................................................................................................................................................................................................................................................................................................... 297
185 4.000e-07UniRef50_UPI00071A87EE extracellular matrix protein 1 n=1 Tax=Sturnus vulgaris TaxID=9172 RepID=UPI00071A87EE  ali  20  4.........................................................................................................................................................................................................................................................................................................................................................................................LNRFCQEESSIKTGQHRCCQRGGPRLRARCFASAAPHPPTRLFTQRRPVPELLGAMTAACCPLPAPERGTCAREQLSQGIATLCATPQDAWRDPQ--GCCSLEEPERRRCFDSTY............................................................................................. 140
186 8.000e-07UniRef50_UPI0009E45879 extracellular matrix protein 1 isoform X2 n=1 Tax=Pogona vitticeps TaxID=103695 RepID=UPI0009E45879  ali  15  127.........................................................................................................................................................................................FPPARPTVDNLANICAEGRK---------KASYGPWNLPQTGFSHLSRQLNALEDDLDRCCEEEKLPCSSEAWETLIQYCKQEFSVKTRPHMCCEKQLDDRLACFAIQAPYPAY------------DKEVTTVNLAQITSSLLDSLC-----RPVSLLSKQKPIPALVQNITEPCCQAEQRTQCAQETKSQFIANICSSQKKTWKDPQKCCAREESQARDDCF................................................................................................................................................................................. 333
187 8.000e-07UniRef50_T1W4X9 Serum albumin (Fragment) n=1 Tax=Panthera tigris altaica TaxID=74533 RepID=T1W4X9_PANTA  ali  15  2..............GKDVFLGTFLYEYSRRHPEYSVSLLLRLAKEYEATLEKCCATDDPPTCYAHVFDEFKPLVEEPHNLVKTNCELFEKLGEYGFQNALLVRYTKKVPQVSTPTLVGVSRSLCTHPESERLSCAEDYLSVVLNRLCVLHEKTPVS------ERVTKCCTESNRRPCFSALQVDGTYVPKEFSAEHADLCT-LPEAEKQIKKQSALVELLKHKPKATDEQLKTVMGDFGSFVDKCAAEDKEACFAEE........................................................................................................................................................................................................................................................................................................................................ 251
188 9.000e-07UniRef50_C0HA37 Extracellular matrix protein 1 precursor n=18 Tax=Salmoninae TaxID=504568 RepID=C0HA37_SALSA  ali  16  155..................................................................................................................................................................................................................................................................................................................................................................................................................RRPRYPAYSFPQTGFGYLRRQGDAVNRIESWYSACCHQVQEVTLCCVTQAWEQTLSTFCTDE--FSVKTRHHHCCKKQGGARLSCFHSQTPNPNYLPSPIPEPGFTFNPNTCHKSQPGP................................................................ 283
190 1.000e-06UniRef50_UPI0007F87B3B extracellular matrix protein 1-like n=3 Tax=Percomorphaceae TaxID=1489872 RepID=UPI0007F87B3B  ali  17  54...............................................................................................................................................................................................................................................................................................................................................................................................................QSQSRPRYPNSFFPASGFSYFRRLGSTINRLESWYSLCCSGLVAQQLCCTQQAWKQALSRFCIDE--FSVKTSPYECCEYKDEERWTCFNSQLPNPHYSPPMPAEPGFSFNPTAC....................................................................... 177
191 1.000e-06UniRef50_UPI000DBC634E extracellular matrix protein 1 isoform X9 n=1 Tax=Bubalus bubalis TaxID=89462 RepID=UPI000DBC634E  ali  14  272......................................................................................................................................................................................................................HVVYGPWNLPQTGFSHLSRQGETLETGYSRCCRANRLDCAELVWETLDGYCDWEQAIKTHHHSCCNYPPPLRDECFARRAPYPNY------------DRDILTLDLSRITPNLMNHLCGNRRV-----LSKHKQIPGLIQKVTARCCDLPEQACCAEEEKSAFIDELCGSRRNFWRDSALCCKLSPGDEQINCF................................................................................................................................................................................. 459
192 2.000e-06UniRef50_A0A0G2JGM6 Vitamin D-binding protein (Fragment) n=1 Tax=Mus musculus TaxID=10090 RepID=A0A0G2JGM6_MOUSE  ali  18  3..................................................................................................................................................TQVPEVFLSKVLEPTLKTLRECCDTQDSVACFSTQSPLLKRQLTSFIEKGQEMCADYSENTFTEYKKKLAERLRTKTPNTSPAELKDMVEKHSDFASKCCSINSPP............................................................................................................................................................................................................................................................................................................................................. 108
193 2.000e-06UniRef50_A0A212D668 GC n=1 Tax=Cervus elaphus hippelaphus TaxID=46360 RepID=A0A212D668_CEREH  ali  22  7.....................................................................................................................................................................................................................RSMVLYSRKFPSGTFEQISHLVNEVVSLTVTCCEGADPDCYDNRSALSDKSCESPFPVHPGTPECCTHEGLEKKLCMATLKHQPQE----FPTYVEPTNDEICEAFRKDPKGFADQ................................................................................................................................................................................................................................................................ 122
194 2.000e-06UniRef50_O42279 Serum albumin-like protein n=1 Tax=Petromyzon marinus TaxID=7757 RepID=O42279_PETMA  ali  19  341....HKICEQLQKDGHEVFEEMVLIDFAIEARTLSLDKVVEFAHRYTHHAIRCCAHQAH--CLLDENLHLFSSLCSDLSYLAAHDGYRKCCRLAPSEAVSCHVEHERAEAVEAPFAEEGAARSCLRFRQLPGKYLQRLLYKAAHQAPGVDHSRIRLQVHHFVEVTAKCCRAYDKSECFSHEIKEMKN.............................................................................................................................................................................................................................................................................................................................................................................................................. 549
195 3.000e-06UniRef50_A0A060ZB83 Uncharacterized protein n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060ZB83_ONCMY  ali  19  2.............................................................................................................................................................................................................................................................CVQADLFQSAVCSSETLVKSNLKHCCENTAIERTHCFVDHK-AKIPRDLSLTSESPAADQ--CEDFKKDRKAFVESFIFRFSKRNTMLPPHVILAVTKSYGEVLATCCSEAEAQTCFNTKVRKCPKW............................................................................................................................................................................................................. 128
196 3.000e-06UniRef50_UPI0006440276 extracellular matrix protein 1-like n=1 Tax=Clupea harengus TaxID=7950 RepID=UPI0006440276  ali  19  42..............................................................................................................................................................................................................................................................................................................................................................................................................TQGGSRPRYPSSFFPKSGYGHMRRCGSAVNRVESWYSVCCAEKESQKLCCAKQAWEYVLKVFCR--EEYGVKGLPHECCEESGASRLSCFEREAPNASYQPTPPVDLEFAWDPKTC....................................................................... 163
197 3.000e-06UniRef50_A0A060Y0E7 Uncharacterized protein n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060Y0E7_ONCMY  ali  17  107.TELRALCIVHKKYGDRVVKAKKLIQYSQKMPQASFQEMGGMVDKIVATVAPCCSGDMVTCMKERPLTSYS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 176
198 5.000e-06UniRef50_UPI00077DC30A serum albumin-like n=1 Tax=Peromyscus maniculatus bairdii TaxID=230844 RepID=UPI00077DC30A  ali  18  11....................................................................................................................................................................................................................SKVLVIFSQHLQKCPYEEHVKLVNEITEFAKTCVADESAANCDKSIQTLDKLCSSLCENYGELADCCTKQEPERNECFLQHKDDN----PNLPPLVKPDAETMCTSFQENTAAFIGQ................................................................................................................................................................................................................................................................ 127
199 6.000e-06UniRef50_A0A226NQX1 Uncharacterized protein n=1 Tax=Colinus virginianus TaxID=9014 RepID=A0A226NQX1_COLVI  ali  33  1........................................................................................................................................................................................................................................................................................................................................................MLLRIGKGYEDLLDECCKTGSPDNCCSRGEEELKKHIYETESVMKTSCDIYKEKGDYYFQNEYLSSVFK............................................................................................................................................................................ 69
201 8.000e-06UniRef50_UPI0008740D35 extracellular matrix protein 1-like n=8 Tax=Percomorphaceae TaxID=1489872 RepID=UPI0008740D35  ali  19  128...............................................................................................................................................................................................................................................................................................................................................................................................................HGDRRPRYPDSYFPASGFGKQRRKATAVNNAESWFSTCCKGNQEVTLCCATQAWELSVKSFC--EDDSSVKDRQERCCRLTDSDRLSCFDREAPNPNYEPPLLSAANFNFDPKTCQR..................................................................... 253
202 1.000e-05UniRef50_UPI0004434212 extracellular matrix protein 1 isoform X2 n=4 Tax=Theria TaxID=722675 RepID=UPI0004434212  ali  15  205.....................................................................................................................................................................................................................KHVVYGPWNLPQTGYSHLSRQGNALETGYTRCCHKDQLDCAEVWEEALDSYCDEELAIKTHHHVCCQHPAPARDICFARHAPYPNYDRDILTVDSRITPDTMAQLCGHRKVLTKHKHIPGLIRNMT------------------ARCCELAPPEQCAEEEKSAFIRDLCGSRRDSWRDTESCCDHSPGDEQTCCFNTHY............................................................................................................................................................................. 395
203 2.000e-05UniRef50_A0A0J9YU60 Alpha-fetoprotein (Fragment) n=1 Tax=Mus musculus TaxID=10090 RepID=A0A0J9YU60_MOUSE  ali  24  36...........QCVTEKNVLSIATITFTQFVPEATEEEVNKMTSDVLAAMKKNSGDGCLESIFFSQLSVFLDEICHETELSNKYG-LSGCCSQSGVE........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 121
204 2.000e-05UniRef50_UPI0007429845 extracellular matrix protein 1-like n=1 Tax=Cyprinodon variegatus TaxID=28743 RepID=UPI0007429845  ali  17  89.............................YFPNSGFGKQKRQATAVNNAFSTCCKGEMTLCCATQAWQQSVNLFCEEDS--SVKDRLYHCCRRTDTSRFQCFKENAQNPNYEPTLELPVEEVGSQSFNFNQDTCPRNLM---------------------SPHLARASREKTELNPAASPKTDIIFPPGRPSAINIESLCSNQK------FRPLYSTKCLPRSGYEVLAHQVKTINRLEKKYKQCCKKKALQCAEQKWRLLNRYCSGKIAGQIDLQ-CCQSKDP--FGCFQTVSLDPLYNKTSEKEA...................................................................................................................................................................................................................................................................................... 347
205 2.000e-05UniRef50_A0A2F0B5P2 Alpha-fetoprotein (Fragment) n=1 Tax=Eschrichtius robustus TaxID=9764 RepID=A0A2F0B5P2_ESCRO  ali  31  90....................................................................................................................................................................LSDCCSQEERHDCFLAHKKAAPESIPPFQVPEPVTSCKAYEEDRELFMNRTVTKLSQKFPKANFTEIQKLVVDVAHVHEECCRGNVLECLQD......................................................................................................................................................................................................................................................................................................................................... 183
206 2.000e-05UniRef50_Q5KTJ4 Alpha-fetoprotein (Fragment) n=1 Tax=Macaca fascicularis TaxID=9541 RepID=Q5KTJ4_MACFA  ali  17  12...................................................................................................................................................................................................................................................................IIGHLCHETTPVNPGVGQCCTSPYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVI........................................................................................................................................................................................................................................... 104
207 2.000e-05UniRef50_UPI0003443CD1 afamin isoform X2 n=1 Tax=Mustela putorius furo TaxID=9669 RepID=UPI0003443CD1  ali  15  107.................................................................................................................................................................................................................................................................................................................................................................KHNFSHCCSKERKLCFFHNKKADVGFLPPLPTLDPEEKCQTYKNNRESFLNN-YVYEVSRRSPFVFAPTLLTVAARFEEMTKTCCE--AQDKANCFRTNAEPVIQYL-------------------------------------------KASSSFQKNVCGAFKFGPQVLGLMFLYEYSRRHLELSVPELLRIAGVYENLLKECCRTENPPDCYRHAEYKFNETTEKSLKI 296
208 3.000e-05UniRef50_A0A1S3M456 extracellular matrix protein 1-like n=19 Tax=Euteleosteomorpha TaxID=1489388 RepID=A0A1S3M456_SALSA  ali  20  56................................................................................................................................................................................................................................................................................................................................................................................................................GQSRPRYPPSFFPRSGVSFFRRCGKAINRLESWYGMCCNGEVAQQLCCAQQAWQNALSMFCV--EEFAVMTRAYPCCRKSGEARWSCFNDELPNPFYEPTAPHEPGFTWKPNTC....................................................................... 178
209 3.000e-05UniRef50_Q61508-2 Isoform Short of Extracellular matrix protein 1 n=33 Tax=Eutheria TaxID=9347 RepID=Q61508-2  ali  15  206......................................................................................................................................................................................................................HVIYGPWNLPQTGYSHLSRQGETLETGYSRCCDTNRLDCLKLVWETLDGYCERELAIKTHPHSCCHYPPPARDECFAHLAPYPNY------------DRDILTLDLSRVTPNLMGQLCGSGRV-----LSKHKQIPGLIQNMTIRCCELPYPACCGEEEKLAFIENLCGPRRNSWKDPALCCDLSPEDKQINCF................................................................................................................................................................................. 393
210 3.000e-05UniRef50_I3JG54 Extracellular matrix protein 1b n=44 Tax=Percomorphaceae TaxID=1489872 RepID=I3JG54_ORENI  ali  17  155................................................................................................................................................................................................................................................................................................................................................................................................................SDLRPRYPSSYFPESGYGVNKLRASAVNNAEAWLSTCCKENQEVTLCCATQAWELSVEKYC-EEDLSIKHPWYHCCKINNNNKRLSCFSNNAPNPNYRPPLPSTIEFTFNPNTCQR..................................................................... 280
211 3.000e-05UniRef50_UPI00081A1B67 extracellular matrix protein 1 n=2 Tax=Neognathae TaxID=8825 RepID=UPI00081A1B67  ali  14  228.................................................MSDCCRHHAPLPCARRAWTDVLDGFCTDE--FAVKTRQFHCCRRHGAARRRCFSQETPAPPPFPPPTTTNLGNICGLREDAPSGPRDRLRVRLEREYGRCCRNESLSCAHAWLKGMNRFCREESAVKCCQRRGLRARGRCFAAAAPVPAYDREL--HNVSLVRPGPALLRSLCGPTRLFTQRRPVPELFGAMTAACCEERGVCAREQLSQAITTLCAAPEDAWRDPQGCCSWEEPERRRCFDNA.................................................................................................................................................................................................................................................................................................... 506
213 4.000e-05UniRef50_UPI000D6A475D alpha-fetoprotein-like n=1 Tax=Python bivittatus TaxID=176946 RepID=UPI000D6A475D  ali  13  223..EQEDICFILNNYGKDTLYPLKFVETIDKFSHADQATVAHIAKNILHIHEATCKGDTLESLLDRDQSFLFNLTRSHPELSKLKDLLGQCCKLEDHA--QCLHTGEEQLELLIAKIEEVVKKNCEQYKKIGGYFQNELLVKYTKIMPQLPSLKLILFTKELAHAAEKCCSSHHQLSCALEDMDKVIGSICQYHKEHHINKQVCQCCDYFSIRRWNLGADPDYVPPATFSHVMDDPDGLCSTDEHIVQKNKQGLLIDLIEFLPHITDNQLANATIQAECC--ADEHKRECFDS..................................................................................................................................................................................................................................................................................................... 530
214 5.000e-05UniRef50_Q16610-2 Isoform 2 of Extracellular matrix protein 1 n=24 Tax=Boreoeutheria TaxID=1437010 RepID=Q16610-2  ali  15  187......................................................................................................................................................................................................................HVVYGPWNLPQSSYSHLTRQGETLEIGYSRCCHTNRLECAKLVWETLDKYCDREYAVKTHHHLCCRHPPPTRDECFARRAPYPNY------------DRDILTIDIGRVTPNLMGHLCGNQRVLTKHKHIPGL-----IHNMTARCCDLPEQACCAEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCF................................................................................................................................................................................. 374
215 5.000e-05UniRef50_A0A1D5PLR3 Uncharacterized protein n=1 Tax=Gallus gallus TaxID=9031 RepID=A0A1D5PLR3_CHICK  ali  15  54................................................................TQWTDVLDTFCEDE--FGVKTRQFHCCHRLGAERRRCFADATVATAEITEITEITVFEPMVVPSFPPGEPTAANMENICRLRGLRPSPRGLPGAARFHSRLERRCCHNSSLECAHAAWQRGLERFCREEGAVKHRCCKQEVHNVSLARPGPAMLRTLCGPIRLLSKRRPVPQLLEAVTTTCCHDEQSPCAEEQSQQIDALCAAQRSSWRDPRGCCAWGGPERLRCFEEE.................................................................................................................................................................................................................................................................................................... 312
216 5.000e-05UniRef50_M3WRY2 Extracellular matrix protein 1 n=2 Tax=Laurasiatheria TaxID=314145 RepID=M3WRY2_FELCA  ali  13  129...............................................................................................................................................................................................................................................................................................................PPGRPSPDNLDQICLPTRQHVMYGPWNLPHSGYSHLTRQGETLNLVETGYSRCC-RCHSHAHRLDCAKLVWENAMIRFCEAEFSVKTRPHCCNRQGEARFSCFQEEAPRPHYPEMPFPPGVPTLDNIKNIFQRCCRQGNNHT--CMWKAWEDALDGYCYR-EQSVKTHHHSCCHYPPSPARDECFAHRAPYPNYDRDILTLDLSRVTPNLCGNGRVLTKHKQIGLIRNMTAHCCDLPFPE------------QACCAEEEKSA................... 428
218 6.000e-05UniRef50_A0A1S3F2H6 extracellular matrix protein 1 isoform X3 n=6 Tax=Eutheria TaxID=9347 RepID=A0A1S3F2H6_DIPOR  ali  13  92.......................................................................................................................................................................................................................................................................................................AHRLDGFPPGRPSSDNLKQIC-LPERQHVVYGPWNLPQTGFSHLSRQGQALNLLETGYSRCC-RCRSRGTRLDCAQLVWEDTMTRFCEAEFSVKTRPHCCKKQGEARFSCFQEEAPRPHYPEVPFPPAMPTLDNVKNIFQRCCRRGGD--LPCVWKAWEDTLDKYCDQEQAIKTHPH-SCCHYPPSPARDECFARRAPYPNYDRDILTLDLSRVTPNLCGNQRAISKHKQIGLIQNMTARCCDLPSPE------------QACCAEEEKFA................... 398
219 7.000e-05UniRef50_UPI0007BA5B28 vitamin D-binding protein-like n=1 Tax=Sinocyclocheilus anshuiensis TaxID=1608454 RepID=UPI0007BA5B28  ali  16  7........................................................................................................................................................................................................................................................................................................................................RYLFLTGVNHASISLPVLTTVLDRIKNTVTACCSSADITTCLTEKESKLK-MTQALLSKLDDTCSRY-------FRLDLPAFKTRMQKEVQGEGGEKRTQAWLDLAISCCSQRSPAQLC.......................................................................................................................................... 117
220 9.000e-05UniRef50_UPI000775FB6B extracellular matrix protein 1-like n=2 Tax=Protobothrops mucrosquamatus TaxID=103944 RepID=UPI000775FB6B  ali  19  75........................................................................................................................................................................CRGVGCTRKLPLYKLEDFPPGRPSLGNLQALCSVGRK---------KPSYGPWNLPQTSFSHLSRVLNQLETQFTRCCQDQKLSCATNEWEKLIRFCKQEYSIKTRPFHCCRVGARERLACFASQAPFPTY.............................................................................................................................................................................................................................................................................................. 204
221 9.000e-05UniRef50_UPI00052ED468 vitamin D-binding protein n=1 Tax=Tinamus guttatus TaxID=94827 RepID=UPI00052ED468  ali  16  27....................................................................................................................................................................................................................................................................................................................................................................................................DKVCQEYRTMGKEDFRALTIIMNSKKFSNATFEEISHLVHEIVSLAETCCSESADPSCYCAKGFADRFLYEFASDYSQAPLPSMVSTCCMSPAP--TTCFLKEKLQRKTL-----SLLTLLSNRACSRFTAGKDKMKFSYLTTLAQKTPSASFEEIFPLAEDAAEMFAQCCDSV-AEDCMQKKVGSAGAATHRAL.. 236
222 9.000e-05UniRef50_UPI000812F006 alpha-fetoprotein-like n=1 Tax=Manis javanica TaxID=9974 RepID=UPI000812F006  ali  11  106.TEDQFVCQQFTD-KQDDFLHEFLYEYSRRHPELAVPVILRVDTVYRNLLGKCCKLENPLECYGHGKEMLQRVVRESREHVKNHCDLREELGESDFHDRLVVLYTKKAPQMFTKNLAAASTKCCPLSDEQQEDSAKLILGALCRRHEAEPINAAVGHCCDNSYAFRKPCFDDLTVD---GTYVSPHSSCDQVIGFKEELCKAQEEE-FQTEKRKLLSNLVKQVPLATEMQLQSVTEDFAHLVRKCCQAETGPCFREEGFKLMVKCQAL............................................................................................................................................................................................................................................................................................................................. 379
223 1.000e-04UniRef50_Q8MIL1 Alpha-fetoprotein (Fragment) n=2 Tax=Laurasiatheria TaxID=314145 RepID=Q8MIL1_PIG  ali  45  1..............................................................................................................................................................................................................................................................................................................................................................................................ESQGTAKRSCGLFQKLGEYYLQNAFLVAYTKKAPQLTPPELMALTRKMATTGAACCHLSED.............................................................................................................................................. 61
224 1.000e-04UniRef50_A0A0P7WZV7 Uncharacterized protein n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A0P7WZV7_9TELE  ali  15  4.......................................................................................................................................................................................................................................................................................................................................................................................................................FMVYYASLLKLPFDDAFTATRSIRDNLAWCCSQKNSR---CLTEKFTELHQALCNDSSPGLKSEDFQKCCGKAPPGALPCMDNLERH----AQLFPGTALSSLSDLCDTGDGKALQRYEWLV........................................................ 118
225 1.000e-04UniRef50_A0A0R4IMZ6 Extracellular matrix protein 1a n=8 Tax=Cyprinidae TaxID=7953 RepID=A0A0R4IMZ6_DANRE  ali  16  57.........................YTAESFPPSSFAHARRAGKTMNRLEAQCCKNGQILCCAKQAWETALSYFCLEE--FSTKTLVHDCCEKKGGERWGCFEREAPNPYYQPLPGYIAPQ................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 159
226 1.000e-04UniRef50_S4RSU9 Uncharacterized protein n=1 Tax=Petromyzon marinus TaxID=7757 RepID=S4RSU9_PETMA  ali  20  7..........................................................................................................................................................................................................................................................................................................................................................................................................................LSQKAPNASFEKVSQLARHFLSLAKKCC--APDHAAGCFLEERYAIHDEVCRDDEVVDQVGGLATCCRMSGTSRAKCLAQLPRD........................................................................................... 88
227 1.000e-04UniRef50_Q5KTJ5 Albumin (Fragment) n=1 Tax=Macaca fascicularis TaxID=9541 RepID=Q5KTJ5_MACFA  ali  28  1................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................LYEYARRHPDYSVMLLLRLAKAYEATLEKCCAAANPHECYAKEFQPLVDEPQNLVK. 59
228 2.000e-04UniRef50_K7EDF5 Uncharacterized protein n=1 Tax=Ornithorhynchus anatinus TaxID=9258 RepID=K7EDF5_ORNAN  ali  17  6............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ADRYIYEIARRQPFLYTPTLLFHAQEYEKVVQACCSEENKLQCFQTKGTLVTNDLR..... 61
229 2.000e-04UniRef50_K7GC19 Uncharacterized protein n=2 Tax=Pelodiscus sinensis TaxID=13735 RepID=K7GC19_PELSI  ali  21  1................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MFEETRRHTNIPVVFLSKVYDATHNLINECCSDADATTCLATKRLLLRGEILKFLA. 56
230 2.000e-04UniRef50_S9WM21 ADAMTS-like protein n=1 Tax=Camelus ferus TaxID=419612 RepID=S9WM21_CAMFR  ali  13  149.............................NLPQTGFSHLSRQGETLNLLYSRCCSHTNRLDCAKLVWEDAMTRFCEAE--FSVKTRAHWCCKQQGEARFSCFQEEAPRPHYQL--------RACPSRQPATDPIQRQ-----------------LQALTRLEGEFQRCCRQGNNHTCT-----------------------------------WKALISCGQLGTSSVLLPFHLPNPI---------QPQLPPCPLWEDTLDGYCDWEQAIKTHHHSCCHYPPPARDECFARRAPYPNYDRDILTLDLSRVTPNLMSHLCGNQ---------RVLTKHKQIPGLIRNMTAH--------CCELPEQACCAEEEKSAFIDDLCGPRRNFWRDSALCCKLSPGDEQINCF................................................................................................................................................................................. 448
231 3.000e-04UniRef50_A0A061IMD2 Alpha-fetoprotein related protein n=1 Tax=Cricetulus griseus TaxID=10029 RepID=A0A061IMD2_CRIGR  ali  39  19......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ESEDRGKCRLLGNLVKQKPHAAEEEFLSIGEDFMQLVEMCCHAEKREMCFQEE.............. 71
232 3.000e-04UniRef50_UPI000494F637 extracellular matrix protein 1-like n=1 Tax=Cynoglossus semilaevis TaxID=244447 RepID=UPI000494F637  ali  14  120.............................YFPSSGYGQLKRQAKAVNSWYRSCCASGVTLCCAQRAWTRSLKVFC--KESSSVKDRLHHCCKRSGNNVFSCFNSEAVNPHYQPTEEIPAPPLTSTNFNFDPSTCQGYF............................................................................................................................................................................................................................................................................................................................................................................................................................................................... 236
233 3.000e-04UniRef50_A0A0M3CUG7 Uncharacterized protein (Fragment) n=1 Tax=Pseudomonas putida TaxID=303 RepID=A0A0M3CUG7_PSEPU  ali  14  13.................................................................................................................................................................................................................................................................................................................................................................................LSSARSRNLQRTARDADHKSPIAHRFNDLKEETFKAVTMITFAQYLQRCSYDGLSKLVKDVVDLAHKC--VANEDAPECSKSLPSVFLDEICQVDKLRDSYGDMADCC............................................................................................................ 118
234 3.000e-04UniRef50_Q16610 Extracellular matrix protein 1 n=105 Tax=Theria TaxID=722675 RepID=ECM1_HUMAN  ali  13  194.............................NLPQSSYSHLTRQGETLNFLYSRCCSHTNRLECAKLVWEEAMSRFCEAE--FSVKTRPHWCCTRQGEARFSCFQEEAPQPHYQSGLELPFPPGVPTLDNIKNICHLRRFRSVPRNLPATDPLQRELLALIQLEREFQRCCRQGNNHTCTWKAWEDTLDKYCDREYAVKHLCCRHPPSPTRD------ECFARRAPYPNYDR----------------DILTIDIGRVTPNLMGHLCGNQRVLTKHTARCCDLPFPEQACC-AEEEKLTFINDLCGPRRNIWRDPALCCYLSPGDEQVNCFNINYLR.......................................................................................................................................................................................................................................................... 505
235 3.000e-04UniRef50_UPI000DC1ABC9 afamin-like n=1 Tax=Theropithecus gelada TaxID=9565 RepID=UPI000DC1ABC9  ali  11  114.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SNIQNFTHCRFTFEYSRRHPDLSIPGLLRIVQIYKDLLRNCCNTENPPGCYRYVEDKFNETTEKSLKM 181
237 4.000e-04UniRef50_UPI000441BE88 extracellular matrix protein 1 n=1 Tax=Python bivittatus TaxID=176946 RepID=UPI000441BE88  ali  12  10.....................................................................................................................................................................................................................KKPSYGPWNLPQTSFSHLSRQGEALSELFTRCCQERLPCCTHAWEGGLVRFCKQEYSTKTLPFHCCRESKQARLTCFASQAPFPTYALLNLAQLTPLLLDSLCSQASQDSKQRPNPALVQ---------------------NITDTCCKEGERTACAEEVKSQFIAAFCSSQRRTWKDPQKCCSHKDEAARRECFDRSYLGHISLLSSEQAPLPTEAT.......................................................................................................................................................... 220
238 4.000e-04UniRef50_A0A2I0T5Y5 Serum albumin n=1 Tax=Limosa lapponica baueri TaxID=1758121 RepID=A0A2I0T5Y5_LIMLA  ali  27  15...................................................................................................................................................................................KQEIAIKERAKKVNMKQQYSCGILKKFGERTFKAKFVYEYSRRHPEFSTQLILRVTKGYETLLDKCCKTDNPAECYGQEELNKHIKETQDVVKT........................................................................................................................................................................................................................................................................................................................ 110
239 4.000e-04UniRef50_A0A1A6H1K8 Uncharacterized protein n=2 Tax=Cricetidae TaxID=337677 RepID=A0A1A6H1K8_NEOLE  ali  16  1..........................................................................................................................................................................................................................................................................................................................................................................................................................MSQKFPKADFTEITKLATDVTKITQECCH---GDLLECADD-RAELAKYMCEHQ--ASISSKLQACCDKPVLQKSHCIAEVENDDMPADLPPSLEKIFEKNDSCSRYHEDKDMFLSK.......................................................... 111
241 5.000e-04UniRef50_A0A1S3RZV7 extracellular matrix protein 1-like n=4 Tax=Protacanthopterygii TaxID=41705 RepID=A0A1S3RZV7_SALSA  ali  19  39...............................................................................................................................................................................................FPPGRPTFDNIGLVCRLRKHRPLYTPKCLPRTGFGWLARQSKAVNRLERGFKHCCQGDVLPCAEKWREVLDRFCEEEQKGRLHNSSCCDVEGEERYTCFSSAPHPDYDQKLDSAAPQTHNLGHICETYKIIKKKFPVALPVQNLVVHPLPADQRTACVQEKLVTLAESRCSAEKPSS......................................................................................................................................................................................................................... 222
242 5.000e-04UniRef50_UPI00064FCF90 serum albumin-like n=1 Tax=Echinops telfairi TaxID=9371 RepID=UPI00064FCF90  ali  18  208......................................................................................................................................................................................................................................................................................................................................................................................................................................................EISNIPNLPCAD-----LAKYTCENQE--TISSKLKECCEKPVLEKSHCIAEVENDDIPDDLTPLATDFVEDKEVCKNYEEARDIFMESNTFNYS----MLQLEEMKPLIEEPQKLVKKNCDLFNKIGEYGFQNALIIRYTQKV... 340
243 5.000e-04UniRef50_A0A2U3XEH5 alpha-fetoprotein-like n=5 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2U3XEH5_LEPWE  ali  11  222..RHHHLCEIGIKFNHKVAKAVELVLLTKKQPKADFSEIARLAVDIKNLHQTCCEGDVVACVLGRAPQQEAETICNRDAVPINDCRFRPPGGEVPPSRDE..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 321
244 7.000e-04UniRef50_Q9DFD2 Putative serum albumin-related protein (Fragment) n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=Q9DFD2_ONCMY  ali  22  6...................................................................................................................................................................................................................................................................................................................................................................................................................................LARQSKAMNRLERGFNHCCKGLE-NVLPCAEGKWREVLDRFC-EEEQKERPHNSSCCDVGEGEDRYTCFSSLAPHPDYEQKLDSASASDAPQ--------THNLGHICETYKIIKNFP---------VALPVQNLVDQCCSADQRTACVQIQLVMLSQT....... 147
245 7.000e-04UniRef50_UPI00062A647D alpha-fetoprotein isoform X2 n=1 Tax=Dasypus novemcinctus TaxID=9361 RepID=UPI00062A647D  ali  17  341.EHVKNYCDLYAKLGEGNFHSRLIVLYSKKIPQLSAQELIVITKNMAAAATKCCPDENQFYCIEDSVSI.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 410
246 7.000e-04UniRef50_K7FQN8 Uncharacterized protein n=2 Tax=Archelosauria TaxID=1329799 RepID=K7FQN8_PELSI  ali  12  97..EDKDVCDHFAK-EQDAYLAKFVYEYSRRHPEFSVQMLLRVGKGYQELLETCCKSANPPECYGKGEEILKKQLQETQELLKANCNRYKELGEYLLQNQLLVLYTKRMPQLLPEELLQFTKQMCCQLSEDKEGHLDLILGQICRRHYASPINSNVCKCCSSSYALRRPCIGALGID----EKYVPVPLTPDLFAFHEDLCATEEAALQRSKQKLLINLVKYK-PTITEEQLKTIIESFITMREKCCKENHETCFGEEVAH..................................................................................................................................................................................................................................................................................................................................... 360
247 7.000e-04UniRef50_Q7M3A0 Serum albumin, milk-derived (Fragment) n=2 Tax=Mammalia TaxID=40674 RepID=Q7M3A0_9MAMM  ali  63  1DAQKSELGHRYKELGEDHFKALALVTFSQY........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 30
248 7.000e-04UniRef50_P81188 67 kDa serum albumin (Fragment) n=2 Tax=Amniota TaxID=32524 RepID=ALBU1_TRASC  ali  60  4..HKSEIVHRFNDLKEEKFKGAALITFAQFLHKKPEEE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 39
249 8.000e-04UniRef50_A0A1V4KMJ2 Extracellular matrix protein 1 n=1 Tax=Patagioenas fasciata monilis TaxID=372326 RepID=A0A1V4KMJ2_PATFA  ali  17  1.........................................................................................................................................................................................................................................MSLRLEREFGRCCRNQSLDCAHRAWQKLERFCREEAAVKTGQHRCCQRLGGARSRCFAAAAPHPNYD............................................................................................................................................................................................................................................................................................. 68
250 9.000e-04UniRef50_A0A2D4FIT3 Uncharacterized protein n=1 Tax=Micrurus corallinus TaxID=54390 RepID=A0A2D4FIT3_MICCO  ali  23  136...........................................................................................................................................................................................................................................................................................................................................................................................................................PWNLPQTSFSHLARQGEALNQLFSQCCQLAEEQKLPCASNEWEKCLARYC-KQEFSIKTLPFHCCREGAREDRLSCFARQAPFPKYESLDLANLTSPALDSICSQASSQ------------AKQKPSPALVQ---------NITESCCKLPESE.................... 274
252 1.000e-03UniRef50_UPI000D63F99F extracellular matrix protein 1 n=7 Tax=Neognathae TaxID=8825 RepID=UPI000D63F99F  ali  14  105..............................LPPAAFAHLRRQVAALDSFLDRCCQHHAPLPCARRAWTDVLDTFCEDE--FGVKTRQFHCCHRLGAERRRCFADATVATAEITEITEITVFEPMVVPSFPPGEPTAANMENICRLRGLRPSPRGLPGAARFHSRLERRCCHNSSLECAHAAWQRGLERFCREEGAVKHRCCK............................................................................................................................................................................................................................................................................................................................................................................................... 284
253 1.000e-03UniRef50_UPI000CD5E29A extracellular matrix protein 1 n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD5E29A  ali  15  102.................................................................................................................................................................................................................................................................................................................................................................................................................DSRPRYTHQSFPSSGFGSQIRQADTINRVESWYSGCCQENETQTLCCALQAWESALSTFC--DEEFSIKTSHYHCCLKRGYSRWHCFEKAAPNPTTLTPAPQVPGFIFNRSICPSNASGSLQERDK.......................................................... 236
254 1.000e-03UniRef50_D6RBJ7 Vitamin D-binding protein n=8 Tax=Amniota TaxID=32524 RepID=D6RBJ7_HUMAN  ali  19  24......................................................................................................................................................................................................................................................................................................................EKNKVCKEFSHGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESFPVHPGTAECCTKEGLERKLCMAA---LKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASP---TVCFLKERLQLKHLSLLT-----TLSNRVCSQYAAGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESA-SEDCMAKELPEHTVKL...... 285
255 1.000e-03UniRef50_T1W3L3 Serum albumin (Fragment) n=1 Tax=Panthera tigris altaica TaxID=74533 RepID=T1W3L3_PANTA  ali  71  4........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SFVDKCCAAEDKEACFAEEGPKLVATTQAALA. 35
256 0.002UniRef50_UPI0006BA6738 threonine--tRNA ligase, mitochondrial n=1 Tax=Geospiza fortis TaxID=48883 RepID=UPI0006BA6738  ali  17  479...........................................................................................................................................................................................................................................................DSAPQWTDVLDGFCTDEFGVKTRQFHCCRRHGAARRRCFAQETPAPTWAPVP.......................................................................................................................................................................................................................................................................................... 530
257 0.002UniRef50_W5N0L1 Uncharacterized protein n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=W5N0L1_LEPOC  ali  26  9................................................................................................................................................................................................PYEKERICQEYADFGKETFKAIGVILYSQKFSTGTFEEINAVTDEMVKLADKCCAEESPDCYD.......................................................................................................................................................................................................................................................................................................................................... 72
258 0.002UniRef50_UPI000CEB2E05 extracellular matrix protein 1-like n=1 Tax=Salvelinus alpinus TaxID=8036 RepID=UPI000CEB2E05  ali  22  95..............................LPQTGFGYLRRAVNRIESWYRACCHQEVTLCCVTQAWEQTLSTFCTDE--FSVKTRHHHCCKKQGGARLSCFHSQTPNPNYLPTTQ..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 188
259 0.002UniRef50_UPI000B4FCE97 serum albumin 1-like n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=UPI000B4FCE97  ali  13  15..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................RFIFKFSKSNTMLQPHVILAIAKAYGEVLTSCCGEAEAQTCFDTKKATFQRAVGKRVT. 72
260 0.002UniRef50_A0A146N256 Extracellular matrix protein 1 n=7 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146N256_FUNHE  ali  17  346...................................................................................................................................................................................................................................................................................................................................QKLRPLYTTKCLPRSGYELLARQVKTINRLEKRFKQCCKKKKALNCAEQKWREELNRYCSAGNDEQVDLQCCQADDQYSCFQSLITSATEVPPLSMMCDTQIISINRFPVGSQCCPLPEEDRNTCFAQKLEQISQSQCSTTKPATP-AARRCCKMTSPEEILQCFSKN.............................................................................................. 524
261 0.002UniRef50_A0A151MAK7 Extracellular matrix protein 1 n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151MAK7_ALLMI  ali  15  118..............................LPKSSHAHLLRQANALASFVKECCQRPEPLGCAKQAWSDTLQSFCQDE--FGVKTKPFHCCKQRGTAREQCFASDAXXXXXXXXXXXXXHPV--SSFPPGQPTSANLRNICQLARFRTPGATDQANNIAILEREYRRCCQGNGNLDCAHAAWTLIDPCCQVPLGERRDTCFARQAPYPNYDQGLRTLSLAPLTPQHVLITKRKPVPDLIQALKKCCSNERVQCARKKSQLIATLCNTKKDSWKDTEKCCSQTATERASCFD...................................................................................................................................................................................................................................................................................................... 406
262 0.002UniRef50_L9L5Y8 Alpha-fetoprotein n=2 Tax=Boreoeutheria TaxID=1437010 RepID=L9L5Y8_TUPCH  ali  16  36...........QNYLEENLRDLTSIMVAQFLQKATYEEVQTIAKELLDLTEKCKPHELPSECAHQLITSLLVTL----VALSLLLEYLSLCKGSQETKLLIFKKFHKKELVLLTKKQPEIAKLTTDTKNLHQICCDGNAVACALGRAQLMSYICSNQAMLSSKI-TQCCEQPAPGECIENDRPALSSLPLSRFTEDPFVCKHFAD-KEDDFLQEFLYEYSRRHPELAVTVILRVEEAYKKELENCCKLENPLECYSH........................................................................................................................................................................................................................................................................................................................................ 288
263 0.002UniRef50_Q16610-4 Isoform 4 of Extracellular matrix protein 1 n=181 Tax=Theria TaxID=722675 RepID=Q16610-4  ali  14  216.............................NLPQTGYSHLSRQGEALNLLYSRCCSDTNRLDCVKLVWEDAMTQFCEAE--FSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNIQNMTVRCCELPYPECCEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKANCF....................................................................................................................................................................................................................................................................................................... 521
266 0.002UniRef50_Q7LZ08 Thyroxine-binding protein, plasma (Fragments) n=1 Tax=Trachemys scripta TaxID=34903 RepID=Q7LZ08_TRASC  ali  31  6DYVRDKVCQEFNNLGKDNFRSLAIIKFS----DATFEQISHVVKK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 46
267 0.003UniRef50_UPI0004626793 extracellular matrix protein 1 n=1 Tax=Anolis carolinensis TaxID=28377 RepID=UPI0004626793  ali  20  180.............................NLPQTSFSHLSRQGEALNELVKTCCQGEKLPCCLEAWSDA-LEYYCLSE--FAVKTTPYDCCKLEGRRRERCFVQGARFPRY.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 264
268 0.003UniRef50_UPI000C81455D afamin-like n=1 Tax=Loxodonta africana TaxID=9785 RepID=UPI000C81455D  ali  19  105.......CERFQNLGKDDLKYQYFVELVKLKPQRTEEELRSLLTDFINVVEKCCKAEGPEACFTKEGLILEAKS............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 171
269 0.003UniRef50_UPI000980E7E7 afamin n=2 Tax=Euarchontoglires TaxID=314146 RepID=UPI000980E7E7  ali  13  218.SYQKTVCGAYLKFGLKVLNSINIAVFSKKFPQIEFKELTSLLEDVSAMYDGCCEGDVVRCI........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 278
270 0.004UniRef50_V8N5N4 Serum albumin n=1 Tax=Ophiophagus hannah TaxID=8665 RepID=V8N5N4_OPHHA  ali  21  9.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SSNFDHCCGETLVERTSCLVALENDARSSDLPPLSGEILKETEACKFYTEHGAEHNESFLFTLTRNHPELSKLLDLEILH.................................... 88
271 0.004UniRef50_UPI00051EEF03 LOW QUALITY PROTEIN: vitamin D-binding protein n=1 Tax=Egretta garzetta TaxID=188379 RepID=UPI00051EEF03  ali  17  39..........................................................................................................................................................................................................................................................................................................................................IIANSRKFSNATFEEISHLVHEIVSLAETCCTKGADPSCYDAGSSALSAKSCLQHPISNRFCSRFTADGKDKVAFSYLTSLAQKMPGASFEDLLPLAEDAAEVLSQCCDSVAED---CMQKKLSEHVAKACGXAR---RERCADCCKGTNLMQNYFCI................................................................................................. 222
272 0.004UniRef50_H3AEK2 Uncharacterized protein n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=H3AEK2_LATCH  ali  18  16.............................................................................................................................................................................................................................................................................................................................FPPAYPNGNNIENICLYQNQRPTYGPESLLDAIKHLEAGFATCCQQPVKLNCAQALWRDVLKQFCRDEFSVKTRHYSCCKKTESERDCHSTVTTSQEIPKVSFPPGEPNQSNIQNVFKNCCK--NTDVLSCAQNKWREALDEFCEQE--FSVKDRSNPCCKKQGTEKYSCFAERAPHPNY........................................................................................ 254
273 0.004UniRef50_A1YZ84 Preproalbumin (Fragment) n=2 Tax=Galloanserae TaxID=1549675 RepID=A1YZ84_ANAPL  ali  21  171...QQYSCGILKKFGDRIFQADKLALLSQKYPKTSFAEISKLIHDVKDVYKEWCEG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 223
274 0.004UniRef50_F8TGW7 Alpha-fetoprotein (Fragment) n=2 Tax=Bubalus bubalis TaxID=89462 RepID=F8TGW7_BUBBU  ali  28  2..............................................................................................................................FFRGKNLSMARFTYEYSRRHTKLAVPIILRVAKGYQELLEKC................................................................................................................................................................................................................................................................................................................................................................................................................................. 43
275 0.004UniRef50_P83517 Serum albumin (Fragments) n=1 Tax=Neoceratodus forsteri TaxID=7892 RepID=ALBU_NEOFS  ali  24  33.................................................................................................................PFIQVSKEEQCKHYAENRVPYMGNFIYTAAKRHPDLPATEVLIYAFXYES...................................................................................................................................................................................................................................................................................................................................................................................................................................... 82
279 0.005UniRef50_A0A2S3R4N6 Uncharacterized protein (Fragment) n=1 Tax=Vibrio vulnificus TaxID=672 RepID=A0A2S3R4N6_VIBVL  ali  30  1.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DQLKKKLELLVEYLKMKPDCGQEKRTEVIEGVRKTVEKCCAAEGHQLCFDTEKAGILEIILK.... 62

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.