current user: public

If you have questions about the server, please let us know.

Query: 5Z4P Entity 6(prereleased), from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# E-value Template Links and tools%idFirst MYTFVVRDENSSVYAEVSRLLLATGQWKRLRKDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELSESCTWFPESYVIYPTNLKTPVAPAQNGIRHLINNTRTDEREVFLAAYNRRREGREGNVWIAKSSAGAKGEGILISSEASELLDFIDEQGQVHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHLYNIYLYREGVLRTSSEPYNSANFQDKTCHLTNHCIQKEYSKNYGRYEEGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLADTGQKTSQPTSIFIKLLast
1 0.000e+00UniRef50_A0A078AJM1 Tubulin tyrosine ligase-like member 5 n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078AJM1_STYLE  ali  23  260...............KLIRALLENNGFLQTEAH--DWNVLWTCQSMKLSQYEG--LNENQKINHFPQSYELTRKDRLCYNVVQMQ-----EKFSKEEFNIIPDTYILPDEFAD-----------------FYSHFHKLKSKEQSNLWIIKPQNSSQGK-----DDISEV-----PIDESCIVSRYITNPLLI--NGLKFDLRIYVLITSPWRIYVYHEGLARFASEPYQAQSKQNKFAHLTNYSINKKNDKYIPNDDSGHKWSLAALSKHLEQIGID--LNLMWSKIYDVILKSLLSIDSIIYQNPNKNNCFELLGYDILIDSELKPWLMEVNLSPSLATPLDVKIKSGLIIDTFNLVGIKKFDRRRDN......... 597
2 0.000e+00UniRef50_UPI0005CF760E probable tubulin polyglutamylase TTLL9 n=1 Tax=Ceratosolen solmsi marchali TaxID=326594 RepID=UPI0005CF760E  ali  24  209...........................EIYDYQDTTWDLWWCDTSDLKFALDGK-IKPQQRVSHFRNHSELTRKNYLYRNLKRYKRMLIKAGKIRE---------------AEFCDAMPISFELPHEYWMLMEEHRK----KHGTTWIVKPAAGSQGRGIFLFQRMKDLSNWRAHYQATYIVQKYIDKPYLLE--GHKFDLRIYVLVTSPLKVWLAREGFARLSGEQFSLERIDDNRIHLTNMSIQLKAKKHRIKAESGRKWALCNLRQYLTTHHGVAAVNELLQNIAGVIMASLQAVQSIIIQ---SQNSFELYGYDVILDELLKPWLLEVNASPSLTSPEDFRLKFDLIDDVLNI-LDFERLLTGCETRVGGFDLL 569
3 0.000e+00UniRef50_I7LVA2 Tubulin-tyrosine ligase family protein n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7LVA2_TETTS  ali  20  93.NKKIVFDVTDTIYKVIKNQGSVTMGWTTITSNREEWNICWYDTYISEE--VLRRMLPYQKINHFPGSHNLGKKNYLAANLTRMRKVLE------NEYSFFPKTWTLPLQFEDFKRYNE-------------------NIKTKKPYYIVKPESSCQGRGIYLTKKVENF-----SYNDHCVIQEYIKNPFLID--GLKFDFRIYVLIKNPLKIFMYPEGLARFATVKYNKKNCQNFTMHLTNYAVNKKNPNFIQNDDVGHKRSFSSVLKQLHNMGKDI--PKLYMEIRQLIVKTVISVQPQLSHIYRSSQCFEVLGFDVMIDKELKPWLLEVNHSASFHSPLDFSIKKNVILDTLNILNVSSKEKKK........... 445
4 0.000e+00UniRef50_A0A0M0K2W7 Tubulin polyglutamylase ttll6-like protein n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0K2W7_9EUKA  ali  20  107...........SKYDSVWETT-KSLGWRPYTGSENRCQLCWTDRAV--TNKRVGQLGRMQKINHFPGMLELVRKAGTARNLNKMLLACGK------PYKFFPTTYIMPADYPALKLEWRLTNNNR---------------NHGNKTFIVKPSAGCQGVGIRLTRCLDDI-----SPHEPNIVQRYLHRPHLLD--GYKYDLRLYVLLSSPLRIFIFREGLVRVCTQKYKPKNMGDVRMHLTNYSINKDSEAFVQNCDNAHKRTITSLMETLEGQG--VDTESLWRKIGEVCVKTIISVQPHLEHTYFTCRCFELLGFDIMMDHKLRPTLLEINHTPSFRTPLDYTVKMAVLRGTMEMINMTHD............... 450
5 0.000e+00UniRef50_A0A2Y9SC00 probable beta-tubulin polyglutamylase n=1 Tax=Physeter catodon TaxID=9755 RepID=A0A2Y9SC00_PHYCD  ali  22  1.......................................................MRPYQKINHFVGTSAISRKNYLARNLLRMKAYY------PNEYKFFPHTWSLPADLAVFRSQFT---------------------GKRRKTFIIKPDASSQGRGIFLTRNVEDI-----NPSEHLVAQRYIHRPFLID--GLKFDLRIYVLLSNPLRIFVHQDGLVRFATKAYTTRNLGDKTMHLTNYAINKSSSNFEQNCDPGNKRSMFHVLDRLRKEGHD--VDSLCRTIDECLCKTIIGIQPSLAHIYGSCKCFEILGIDIMIDHKLTPWLIEVNHSPSFTTDLDSLVKFRVIRDALVLLDVSPEARRK........... 296
6 0.000e+00UniRef50_A0A0X3P3D0 Tubulin polyglutamylase TTLL4 n=3 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0X3P3D0_SCHSO  ali  20  295....KLIWRNSTLTPNVVKRALWRSNFTILEDTRDTWIGYFGRH---FTAKSFRFVREYQKINHFPGSFNIGRKDRLTVNLQRM-----KTRFGATEYNFYPPTFILPREYSRLKEFWEEYSVEDQNSNGNRISAPR---------WILKPPACARGIGVYVVSKLSDV-----PSRKRLIAQLYLADPFLI--NGNKFDLRVYVYVSCPLQLYIHKTGLVRFASQKYSPQNVSNRFIHLTNYSVNRKSGCYRPSTENAHKWELRELWKYLREHGHNS--ETIWENIKMLVFKTIASVISPLASNVLRECVHELFGFDILLDAALKPWLLEVNVSPSLHTSLDNKIKTEVVVDMLNIAFPPMPRYFKRQCRTLDF... 669
7 0.000e+00UniRef50_A7RW52 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RW52_NEMVE  ali  24  257...............................................................................................SWSAILVNFYLVLSSGAVIANASPFARECQSTLNQLREHLPQFDIDGVRNVWIVKPGAKSRGRGIVCMDKLEDIMKLVGQKEGRWVVQKYIERPLLIY--GVKFDIRQWFLVTDPLTLWFYEDCYLRFCSQNFSLEDFH-VSIHLANNSIQKNYDNNSTRDPDENMWSSDEFKAYLKKRDLGHMWDSIYPGMKQGVMNVLQSCQEVVECRK---NSFELYGADFIIGVDYKPWLIEINCSPTMSTAVTRKLCAQVLEDTMKVIL---DRKEDKNCGTGRFEL. 541
8 0.000e+00UniRef50_UPI0008F9DD2E tubulin glycylase 3A-like isoform X1 n=2 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9DD2E  ali  22  345..............................................................................QHEDIDQRDHAKV-WDHQWDQFLTWYYLLVHDNVPFVSATANQINSKHTVESIQPFWPQWHLDGVHNIWIVKPAAKSRGRGIQVTPKLEDILSNINSKDPRYVVQKYIEKPLLIY--NTKFDIRQWFLVTNPLTIWMYKESYLRFCSQSFSLKNMHE-SIHLSNNAVQCKYKNGERNLPDENMWDCYTFQTYLRTIGQAGLWETIYPGMREGIVGTLLASQDQMDQRK---NCFELFGADFMLANDFFPWLIEINSSPCMSTSVTARMCAQVLEDVVKVVI---DRREDKYADTGMFEL. 648
9 0.000e+00UniRef50_A0A146X5A2 ARPC4-TTLL3 readthrough n=7 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146X5A2_FUNHE  ali  23  295..............................................................................................EQWAEFINSYYLVAHGGAHIERSEHLVSSCKAMLQRLEKVSPQLGIDGAQNIWIIKPGAMSRGRGIKCAKRLDHILRLVDTKESKWVVQKYIEKPLLIH--GTKFDVRQWFLVTDPLTVWFYKKCYLRFSTQLYSLDTL-DSSVHLCNNSIQKHLRPSQQRHPADNMWLDDQFKAFLASQGKEALWETVVPGMKTTIIHAVQTAQDLMESRK---NTFELYGADFMLDLSLHPWLIEINASPTMSTSVTAQLCAAVQEDTLRVVL---DRRVDRAANTGDFQLI 582
10 0.000e+00UniRef50_A0A068XJL9 Tubulin polyglutamylase ttll9 n=2 Tax=Hymenolepis TaxID=99110 RepID=A0A068XJL9_HYMMI  ali  23  2..............................................................................................................................EYHMFLEEFKK----NPNYIWIMKPVAKSQGRGIFLFRKLKHIEAWRKSSPEHYVVSRYIENPYLI--GGRKFDLRVFVLVTSPLKAWVYRDGFARLSNVGFSMDSINDQYVHLTNVAIQKTSPDY--DATMGCKWSICRLRRYMIAKHGNEKVKQLFREIDKIFLMSLLSVQNVMISDK---HCFELYGYDILVDDNLKPWLLEINASPSLSSSEDYNLKVKLLDDTLS-VIDMEGRLNGDEKRIGDFDCV 264
11 0.000e+00UniRef50_A0A1S4EWD3 Uncharacterized protein n=6 Tax=Stegomyia TaxID=53541 RepID=A0A1S4EWD3_AEDAE  ali  24  333........................................................................CKEYLDYCLHNDIDVEEDVKWDHDWDVFLTHHYLLTHEGGTIQLMKEYVAEAKSVLEQIKNHWPQYALDGYLNIWIVKPGNKCRGRGIHLMNNIKQIITMVNPPKTRYVIQKYIERPLIIH--NTKFDIRQWFMITSPLIIWFYKESYLRFSSQQYNLMNYHE-SVHLTNHAIQKKYHNAVRDEPHENMWDCHTFQAYLRQIDKYEMWERIYPGMQKAVIGSLLACQDNMD---RRPNTFELYGADFMITEDFYPWLIEINSSPDLSTSVTARLCPQCVEDTIRVVI---DRRHDVNASTGSFEMI 649
12 0.000e+00UniRef50_A0A226ETV7 Putative tubulin polyglutamylase TTLL1 n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226ETV7_FOLCA  ali  22  12...............SVLNTNFEKRGWQQVGPDD-DWNFYWANCRVIFGVESGYRMHDNQIISHFPNHYEITRKDLLVKNIKRYRKDVEKEGGPYVHLDFIPTTFVLPAD-----------------YNMFVEEYRK----NPLSTWIM--------------------------VKDAYVISKYIENPLLI--GGRKFDMRLYVLVTSPLKVYLYKLGFCRFCTAKYDTSELENMYVHLTNVSVQKHGDEY--NNIHGGKWSLRNLELYLESTQGKDVTTKLFDGMKWLVMHSLKAVAPLMVSDR---HCFECYGYDIIIDNNLKPWLIEVNASPSLTSTTDRILKYKLINDIISVVLPPPEAKWNKREAYGNFELL 343
13 0.000e+00UniRef50_S4RJH6 Tubulin tyrosine ligase like 8 n=2 Tax=Vertebrata TaxID=1261581 RepID=S4RJH6_PETMA  ali  24  219.......................................................................ACETFLRSQEHEDIDGTASRPESPDWDAFLQRYYRFVHGGERLRGVAELAPQCRDLLARLRAARPQLDMEGTRNTWVVKPGAMSRGRGVLCMNRLCEMLRLVECKDGRWIVQKYVERPLLIHA--TKFDIRQWFLVTDPLTVWFYQDCYLRFSTQPFQLDNL-DTSIHLCNNSIQKHFENAQGRLPRDNIWHGRQFVSYLESLGLGFAWEVVVPGMKQAIIHALQAAQDVVDARRG---SFELYGADFLLGEDQRPWLLEINSSPTMSTPVTAELCARVQDDLLRVVL---DRRVDRSAHTGGFYLI 533
14 0.000e+00UniRef50_B8BZF1 Uncharacterized protein (Fragment) n=3 Tax=Stramenopiles TaxID=33634 RepID=B8BZF1_THAPS  ali  22  1..............YSVVKRSALKLGWKLVSEESPNTHVIWIDRSF-VSDKLFLSIQPWQRINHFPGMTNICRKTRLAQSLELMKKQ------FPLEYSFYPTTYSLPHNIATFKTLFD-------------------SNGQSKTTFIVKPDGSAQGKGIFLTNKIEDV----ENRSMCCVAQQYIRNPLLID--KKKFDLRIYVLVTSPLRVYLFRDGLVRLCTEEYTSSNRHDRCMHLTNYSVNKRSDKYERDGDEGSKRSIKWLLEMLAKERSEAEANEMWSKVGDICVMTIISILPTLRREYNSSRCFEVLGVDILIDDGLRPYLIEVNHLPSWGTDIDEDIKSRVIAQALSAINVKARDRQR........... 351
15 0.000e+00UniRef50_A0A2C9JEB0 Uncharacterized protein n=10 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9JEB0_BIOGL  ali  25  639...............................................................................................QWDDLIQWYYQLVHEEGSFINPVDLVKQCESLTRRLAQHCPQFEMDGIRNVWIVKPGAKSRGRGIICYEKLEDMLKLVSSKDGKYVVQKYIERPLLIY--NTKFDIRQWFLVTDPLTLWFYRDSYLRFCSQQFTLEDF-DQSIHLSNNAIQKHYKNGPRRLPDENMWTHYEFKDYLKSKKQPNAWDEIYPSMKKAIICSLLVTQDLVEYRKS---SFELYGADFMLTEDLSPWLIEINSSPSMSTAVTAKLCAAVLDDTIKVVI---DRKLDRNCDIGAFEL. 923
16 0.000e+00UniRef50_A0A158NQ73 Uncharacterized protein n=23 Tax=Eumetazoa TaxID=6072 RepID=A0A158NQ73_ATTCE  ali  21  114..TRHLKWHLTTVTPILVRRTVVNSGYRLMKK-CRYWSGTWGKHMKSISY---KSLKESQKVNHFPGTFQIGRKDRLWRNLSRM-----MMKYGKREFGFVPRTYVLPQDMRMFRQVWEK--------------------NGGKEKWIIKPPASARGTGIRVVHRWSQI-----PKKRAVVVQQYLSRPMLIR--GAKFDLRLYVFVTSPLKVYIYPDGLVRFASVKYNDDILSDRFMHLTNYSINKTSATYTSNDSTGHKWILKTLWSYLEQE--NVNVVKIWKSIKDIVIKTMIAGESSINNTTSRYCCYELFGIDIILDENRKPWLLEVNISLQSSSPLDIAVKGPLIRNLFNMA.................... 446
17 0.000e+00UniRef50_A0A1R2ARP1 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2ARP1_9CILI  ali  24  134..............ARLVRSILDCAGF--VSTDCHDWNIMWVGSSGQNYLYEG--LNEFQKINHFPNSFELTRKDKMYININ-----AQATNYGKEDYNFIPETFLLPEQYNDFYAAFHR---------------------NKGSMWIHKPNGSSQGKGIFLVSSPNDI-----PLNTACVVSKYISNPLLI--NELKFDIRIYVLVSSPLRIYIYDEGLARFASEIYNPVNINNRFSHLTNYSVNKKNEKFIQNDNIGHKWSLAALNTELETMGIDTV--LLWISIEPLVLDSLR------NLSVKRNNCFDLFGFDVLIDSNLKPWLLEVNLSPSMATPLDLHIKSNLISDTFNLIGVRAFDRKKETVNK...... 466
18 0.000e+00UniRef50_W4FVY9 Uncharacterized protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=W4FVY9_9STRA  ali  26  854...............IVVEALKKLPDWDELPVDNTTWNLLWTWSKPRVDRQ---SLLCWQKVNHFAGAKALTRKDML---KKSLQRYAAMGDKMKASFDIAPETFILPNEYIPFVQAFKRRAD---------------AIGSSKNFWIMKPVALSRGRGISLLNDLGQV-----TYGQAVILQKYIENPLLLD--GFKFDLRLYVLVTSPLEAFFYNEGFVRICTHRYNTDDMNDLFMHLTNSSIQKHSDNPVNNAEAGTKASLAYLWSRLAAAHAP--VDTIKAAILDVIIKSLVAGEDSIP---FQVNSFDLYGYDILLDESFRPWLIEINSSPSMGRDLDYVIKDALIYDTMRLVRPLHFDR............. 1189
19 0.000e+00UniRef50_A0A1S8WYL4 Tubulin-tyrosine ligase family protein (Fragment) n=2 Tax=Opisthorchiidae TaxID=6196 RepID=A0A1S8WYL4_9TREM  ali  21  135...............KLIRNILSAHGFQESANHLGKFNLLWTGGHLRPT--QLRILSDFHKINHFPRSYEITRKDRLAKNVHRMQRL-----KGLHQFDILPPSFILPEEFQELCSAYAQ----------------------DKVPYIVKPMASSRGRGIFLISHPEEI-----PCDEPVVVSRYISNPFLLD--GFKFDVRIYAAVTSPLVLYIYEEGLVRFATVRYQPKHLRSQCMHLTNYSVNKKNFEFVHNDDAGNKWSLGALLRYLRSEGAD--VTGLMLRIEDVIVKSFLSVLSPILATCNQSKCFELYGFDIIVDDNFRPWLLE............................................... 426
20 0.000e+00UniRef50_C3YPK7 Uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3YPK7_BRAFL  ali  24  259................................................................................................WNTFIQQYYTLVHDCGTLSDSDVDIDRCIDTLEQFKEAWPQCQIDGTTNMWIVKPGAKSRGREIKVMNKLEDICKLVESKEGKWVVQKYIEDPLLIH--NTKFDIRQWFLVTDPLTIWFYKDSYLRFCSQEFSLENFHEA-IHLSNNSVQKNYSPRSSNIPANLMWHSKTFKEYLRSDGNGHMWESLYSGMKQAVIYAMEASQDMIEGRKG---SFELYGADFMLDTDLNPWLIEINSSPCMSTTITAEMCASVLEDTMKVVL---DRRSDKNCDTGRFEL. 541
21 0.000e+00UniRef50_A0A0K8T169 Uncharacterized protein (Fragment) n=5 Tax=Lygus hesperus TaxID=30085 RepID=A0A0K8T169_LYGHE  ali  24  366......................................................................................VTEEQVWDHQWDQFLTHYYQFVHDNLKFIDAHEMYACAKVALESIAPHWPQLHMDGTNDLWIVKPGAKSRGRGILVFNKLEDIVSRVSTFNSNFVVQKYIERPLLIY--NTKFDIRQWFLVTSPLTIWMYKESYLRFCSQLFSLTNMHE-SVHLSNNAIQCKYKNTQKRDPDENMWDCYTFKTYLRTIGFSDSWETIYSGMRESITGALLAAQEHMEHRR---NCFELYGADFMLTEDLVPWLIEINSSPCMSTSVTARMCSQCLEDVIRVVI---DKRIDKDADTGMFEL. 663
22 0.000e+00UniRef50_A0A2B4SLI9 Tubulin monoglycylase TTLL3 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SLI9_STYPI  ali  20  741........................................................................................GPAISEDSWKLLLVYYYQVKSPGTVIATAYPFLKECQNIMKQMKEYLPQIEIDGTKNIWIVKPGAKSRGRGIMCMDRLDQIVKLVGSKEGHLVVQKYIERPLLIH--GVKFDIRQWFLVTDPLTLWFYKDCYIRFCSQNFSLEDFH-ISIHLANNSIQKHFENGVRDIPDENMWSSDDLKAYLTKRGVGEMWEEIYPGMKKAVISAVQSCQEIVEYRK---NSFELYGADFIIGEDYKPWLLEINCSPTMSTAVTRKLCAQVLEDTMRVVL---DRREDKNCDTGRYEL. 1032
23 0.000e+00UniRef50_A0A1Y2BVI6 TTL-domain-containing protein n=1 Tax=Rhizoclosmatium globosum TaxID=329046 RepID=A0A1Y2BVI6_9FUNG  ali  20  419......KWKICKFTPRVVRTCLRRAGFKLVRG-GKKWIGYWGKHYPA---EKFKSVQPWQKVNHFPMSFEIGRKDKMYLNVSRMRERVKDDTMGL---DFLPATYFLPSQRRRLKLAF-----------------------NSHPTWIIKPPASARGIGIRVVNKWKDV-----PQRKEIIVSKYVQNPYLID--KKKFDIRLYVVVTSPLRIYLYKEGIVRFAGETYSTHSIRNRFIHLTNYSVSRKKKKVDPNYPFGSKWSLATLEEYFSRQGID--FNPIMEKIRHVVVSTVISGHASNSSGTRMYCCYELFGFDVLLDANLKPWVMEVNISPSLSCDMDLGVKSRLSVDLFNLVLDESQKKRKKSPIQKPF... 782
24 0.000e+00UniRef50_A0A1X0NFU6 Tubulin tyrosine ligase n=1 Tax=Trypanosoma theileri TaxID=67003 RepID=A0A1X0NFU6_9TRYP  ali  21  134...........................EIVEDEDGDWNFFWMNVGRIRSIFATYRLTDSQIINHFPNHYELTRKDLMYKNIKKYIRDPANAHICIPHTP-PPSSVQFPLIETRFSECVPVTYNIPNDLQMFVEEFRRQ----PGSTWIVKPTARSQGRGIFLINRISQLKRWLKEKKEGFIVSKYVVDPLLI--GGKKFDLRLYVLVTSPLVAYLHEEGFARFCATRYVASALDNLHAHLTNVALQKGDEAYNNSH--GGKWSLANLCLFLRGRYGAACADGLLRSIEFVIQHSLRAVAPVMFNDK---HCFELYGYDILIDSSLRPHLIEVNASPSLSTTTDRLLKESVLEDVLRVIFPPGFPS............. 502
25 0.000e+00UniRef50_UPI000CDF8FBA tubulin monoglycylase TTLL3-like isoform X1 n=5 Tax=Salmoninae TaxID=504568 RepID=UPI000CDF8FBA  ali  23  307...............................................................................................QWVKFMHDYYLVVHEGVGIEGSGVYVERCQAMLNRL-QVCPQLETDGLHNIWIIKPGAKSRGRGIMCMNRLEEILSLVDSKDSKWVVQKYLERPLLVYA--TKFDLRQWFLVTDPLTVWFYRECYLRFSTQPYSTQTL-DSSVHLCNNSIQKHFQPSQWRHPEDNMWSCSQFRAFLHAQGQGASWGALVPGMQRAVVHALQTAQDLVEGRRG---SFELYGADFILGXDLRPWLLEINASPTMSTAVTARLCPAVQLDTLKVVL---DRRADPGAYTGGFQLI 592
26 0.000e+00UniRef50_UPI000A2A8C36 tubulin monoglycylase TTLL3-like n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A8C36  ali  23  733................................................................................................WNEIINYSYQLRQSQTVIASAFPFLRECQNVVNKMKEHMPQIDIDGQRNIWIVKPGAKSRGRGIMCMDRLEDILKLIGQKEGRWVVQKYIERPLLIY--GVKFDIRQWYLVTDPLTVWFYQDCYLRFCSQNFSLEDFH-VSIHLANNSVQKNFENDKVRDPEENMWSSDEFKSYLRKKGLDGKWNVIYPGMKQAVIYAMESCQEIVEYRK---NSFELYGADFIIGDDFKPWLIEINCSPTMSTGVTRKLCAQVVEDTMKVVL---DRREDRNCDTGRFEL. 1016
27 0.000e+00UniRef50_A0A1S0TQY7 Tubulin-tyrosine ligase n=25 Tax=Chromadorea TaxID=119089 RepID=A0A1S0TQY7_LOALO  ali  24  93....KLMWCKNSLLPIVMRQSLAASHFAIVD-ESDFWIGYWGRHLKSAQYRTI---KPYQKVNHFPGAFHMGRKDRLWQHISEMIAL-----WGPEEYHIMPTTYVLPRDVKKLKSYLH---------------------GNPSHVVILKPPASARGTGISIASKIKQI-----PKKTPLVAQHYIDRPLIV--NSAKFDLRLYVYLTDPLRIYLYNDGLVRFASIPYSLSSMSNKFMHLTNYSINKLAQSAGERTTPVPKWKLSDFWAHIAEH---VDVNVVKPRITDIIIKAVLACESHIKHSLYTFTSHELYGMDILLDDTLRPWLLEVNISPSLHTPTDIAVKTTLAKDVLNLIQIPPDMTDKNN......... 430
28 0.000e+00UniRef50_A0A210PDS5 Tubulin monoglycylase TTLL3 n=4 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PDS5_MIZYE  ali  23  664...............................................................................................QWDEFMVWYYQLCHDGGVISGPENMLTEVENLTNRLKSKHTQYELDGMRNVWIVKPGAKSRGRGIVCYDKLEDMLKLVNSKDNKYVVQKYIERPLLIY--NCKFDIRQWFLVTDPLTLWFYQDSYLRFCSQEYTLDDFDE-SIHLSNNAIQKNYKNGHRNLPADNMWTHEQFKEYIKSNKGNLFDDMIYPGMKKAIICALLCTQDLIEYRKS---SFELYGADFMLTDDYRPWLIEINSSPSMSTAVTSRLCNNVLEDTLKVVI---DRKYDRNCDVGRFEL. 948
29 0.000e+00UniRef50_A0A2H1BTN2 Tubulin-tyrosine ligase family protein n=1 Tax=Fasciola hepatica TaxID=6192 RepID=A0A2H1BTN2_FASHE  ali  22  160...............KLLRSVLQSHGFQESFNHLGRFNLLWTGSHLKPC--QLRMLTDFHKVNHFPRSYELTRKDRLAKNVQRMQQIRGLRQF-----DFVPHTYILPEEFREFSYAY----------------------GQEKGPYIVKPIASSRGRGIRVISHPDEI-----SYEEPVIVSRYISNPFLLD--GFKFDVRMYVAVTSPLVVYIYEEGLVRFATVRYQMRHLKTQCMHLTNYSVNKKNFEFVQNDDPGNKWSLGALLRFLKSEGAD--VTGLMVRIEEIIIKSFLCVVNPIASACAMFRCFELYGFDIIVDDEFRPWLLEV.............................................. 452
30 0.000e+00UniRef50_H0X8R3 Tubulin tyrosine ligase like 8 n=3 Tax=Boreoeutheria TaxID=1437010 RepID=H0X8R3_OTOGA  ali  24  269..............................................................................................DEWKDLTQQYYLVQKDMAELKEMKETHRCCQALLNKITSVKPQTEIDGLRNIWIIKPAAKSRGRDIVCMDRVEEILDLVPPTKDKWVVQKYIETPMLIYD--TKFDIRQWFLITDPLTIWFYKESYLRFSTQRFSLDNL-DSAIHLCNNSIQKHLKNDKARLPGHNMWTSSCFQEYLQKRGRGAMWSVIYPAMKRAITHAMRVAQDHVEARK---NSFELYGADFILGRDFKPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVVV---DRKLDRNCDTGNFELL 558
31 0.000e+00UniRef50_A0A1S3DFB2 probable tubulin polyglutamylase TTLL9 n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S3DFB2_DIACI  ali  23  13......GQTNNTVIEDVLRG---RPGWMPVGSDDTNWDIFWCDLA-TTKLILESSMKNHQKIAHYRNFYEISRKNYLARNLKRYRRQCVKNGNTEE---------------AELSNAMPMTFEIPSETALFLQEARRD----SHNMWIVKPSGGSQGRGILLFKKLSEFEEWRENKDEVYVAQKYITNPYLLE--GRKFDMRMYVLVTSPLTVWIARDGFARIAGIKYCKDNFADNCMHLTNTAIQLSGEN----LSQGRKWDIQNLRLFLTAMHGREIVDELFQKIAKVVITALKSVECIMMGNK---HCFELFGFDILLQDNLNVCLLEANAAPSMTDDHDYKLKYNLIQDALN-VIDLEKKLTGKEIRVGGFDKI 374
32 0.000e+00UniRef50_UPI000B45C900 tubulin monoglycylase TTLL3-like isoform X1 n=4 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=UPI000B45C900  ali  23  664...............................................................................................QWDEFMVWYYQLCHDGGVISGPENMLTEVENLTNRLKSKHTQYELDGMRNVWIVKPGAKSRGRGIVCYDKLEDMLKLVNSKDNKYVVQKYIERPLLIY--NCKFDIRQWFLVTDPLTLWFYQDSYLRFCSQEYTLDDFDE-SIHLSNNAIQKNYKNGHRNLPADNMWTHEQFKEYIKSNKGNLFDDMIYPGMKKAIICALLCTQDLIEYRKS---SFELYGADFMLTDDYRPWLIEINSSPSMSTAVTSRLCNNVLEDTLKVVI---DRKYDRNCDVGRFEL. 948
33 0.000e+00UniRef50_UPI00051E1537 protein monoglycylase TTLL8 n=4 Tax=Sauria TaxID=32561 RepID=UPI00051E1537  ali  23  240....................................................YNEMGVKQLPGKLVDMACLVCETYLEQMQHKDIDRTADCSSEEKWNELLDDYYSLVHEGAVICNAYSYVGQCQTILSKIMSANPQQAIDGNRNIWIIKPGAKSRGRDIVCKDRLDDILRLVELKENEWVAQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQHFSLDDL-DSSIHLCNNSIQKNYKNASNRLPFHNMWSSTKFQEYLEKKGHGTVWKNLIPSMKKAIIYTMKMAQESVEPRK---NSFELYGADFILGQDFKPWLIEINTSPTMSTPVTAELCTQVQEDTIKVVL--TSKKVGKNKDIGKFELL 574
34 0.000e+00UniRef50_UPI0008402598 probable tubulin polyglutamylase TTLL9 isoform X3 n=4 Tax=Amniota TaxID=32524 RepID=UPI0008402598  ali  24  24..................................................................................................................CDFFPKTFELPSEYHLFVEEFRK----NPGITWIMKPVARSQGKGIFLFRRLKDIMDWRKDTRENYVAQRYIENPYLI--GGRKFDLRVYVLVMSPLRAWLYRDGFARFSNTRFTLNSIDDQCIHLTNVAVQKTSPDYHPK--KGSKWMLQRFRQYLASKHGPQAVETLFRDMDNIFIKSLQSVQKVIISDK---HCFELYGYDILIDQDLKPWLLEVNASPSLSSQEDYELKTCLLEDALHVV-DMEARLTGREKRVGGFDLM 312
35 0.000e+00UniRef50_A0A024TG46 Uncharacterized protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024TG46_9STRA  ali  24  771...............IVVEALQKLPDWDELPVDSTTWNLLWTWSKPRVDRQT---LLAWQKVNHFAGAKALTRKDQL---KKSLQRFTAMGDKMKAAFDIAPETFILPHDYIPFVQAFKRRAD---------------AVGATHNFWIMKPVALSRGRGISLLNDLGQV-----AYGDAVVVQKYIENPLLLD--GFKFDLRLYVLVTSPLEAFFYNEGFVRICTHRYSTDDLGNLFMHLTNSSIQKHGHMDQVADNPGTKASLAYLWSRLAA--ANAPVDAIKAAIVDVIVKSLVAGEDSIPY---QVNSFDLYGYDILLDDQYRPWLIEINSSPSMARELDYVIKDALLYDTMRVVNPLHFDR............. 1106
36 0.000e+00UniRef50_A0A267GNP0 Uncharacterized protein n=3 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GNP0_9PLAT  ali  22  29..............PDIVREVCEDRNWVEFDPSENDWNLWWKIGRFRASDFE--KLQSWQRLNHHQSTSLITTKDGLHREMKILQGTFGKAT-----IDFVPSTYLMPR-----------------EERQFQQKFAENREKKAANYWIFKPADLSRGRGIFVFNDIGELR-----YSEKSVVQEYIANPYLI--GGYKFDLRLYAVVVSPLIVYICREGLVRFGTEKYDLKNLCNVYSHITNTSINVSGPSYDSAIGEGCKWSLSNLRNYLYSQG--VNDRLIFARVTAIIVLALMAQAKS--ATVSTGNCYELYGFDILLDAALKPWLLEVNFSPALNIDCDAQVKREMLNGVFDLL---CFTESDKLQSRGG.... 362
37 0.000e+00UniRef50_V9KH00 Tubulin monoglycylase TTLL3 (Fragment) n=1 Tax=Callorhinchus milii TaxID=7868 RepID=V9KH00_CALMI  ali  25  134..............................................................................................ECWDRIIQQYYQVIHNGAMIQDWSSYVGVCTHILRQLQAASPQMDMEGMHNIWIVKPGAQSRGRGITCMNRLEEILKVVCGSEGKWVVQKYIENPLLIY--GTKFDVRQWFLVTDPVTIWFYKDCYLRFSSQPFSLKNL-DISIHLCNNSIQRRCENSSSRHPTDNMWTSEQFKDYLRKNGKGSMWEHIIPGMKKAIIHTMQMVQDGMKPRK---NSFELYGADFLIGKDYIPWLIEINCSPTMSTAVTAMLCTNVQEDTIKVVV---DRRNERTCDIGRFELL 421
38 0.000e+00UniRef50_A0BCB7 Uncharacterized protein n=6 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0BCB7_PARTE  ali  22  51.NKRLIMNVSDTQYAAVKFVILNKFQLQYTPYETQVWDFCWTDNAVLPE--TLARMQSHQRINHFPGMYCIARKNYLGKNLNKM------AKQFPEEFDFYPKTWMLPSDISDLR-----------------------QNIGKIKYFIVKPEASCQGRGIFLTKQVESIAS------EHCVVQRYLHKPLLID--GLKFDFRMYVLLADPLRIYLFKEGLARFATQPYQLPNQMNMCMHLTNYAINKDNPNFVFNTDEGHKRSLSSVFKLLSEQ---TNIDELMAKIKDLIIKTFCSVQPFLQSNYANNMCFEILGFDIIIDNAYKPYLLEVNHTPSFTTPLDALIKKNLIRDTITLMNINLKVKNDLQQ........ 398
39 0.000e+00UniRef50_E4XFC1 Uncharacterized protein n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4XFC1_OIKDI  ali  23  237....KLHWKNTSVTPKVIRRVLRNSRFELV-ENGKSWIGYWGKHLKAGNYAKLKSM---QKVNHFPGCFTIGRKDRLWRTL-----STQIARFGHGEYGFIPTTYILPKDRKLLKDNF------------------------GHETFIVKPAASARGIGIKIVSKMESV-----PQRRQIIVQKYIKNPLLI--NGLKWDLRIYVFVSSPLIAYISDDGLVRFATDQYTM-NSKKRFVHLTNYSVNKKSSKFQASDDSGHKWSLKTLWPELEKLGFNK--DRIWGDIKDVVLKTLVASEQNIKNCAKQRNCFELYGFDLMLDRKGKVILIEVNVSPSLHSNLDETIKGKLIADVFN...................... 558
40 0.000e+00UniRef50_A0BS32 Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0BS32_PARTE  ali  25  853..YFRVVKTKEEVYDIITRSFMRKQGWTELPHGRTSWNVLWTWSKPQ---IDLNKLLFFQKVNHFPFNKNLGRKDLLKKNIERCQKLGTKAQ---QIFDIIPSTFLLPKEYVQFME----------------KFYKDSESEGQQNIWIMKPTGKSRGRGITVLNDISDVM-----YAEPVVLQKYLKNPLLLK--GHKFDMRIYVLVTSPLEVFLYKEGFARLTTQPFTLDDLKNQLVHLTNFAVQKTHVQIQDLESQGCKISLRQLREKLIDR--NIDWNKIWEQVQDIVLKSLVACQSEIPNN---PNSFELFGYDIIIDTNQKCWLLEVNASPSLARDLDELIKQQLIDDIFDLIDSPNYDRQR........... 1194
41 0.000e+00UniRef50_A0A1I8HL02 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8HL02_9PLAT  ali  22  80..............PDIVREVCEDRNWVEFDPSENDWNLWWKIGRFRASDFE--KLQSWQRLNHHQSTSLITTKDGLHREMKILQGTFGKAT-----IDFVPSTYLMPR-----------------EERQFQQKFAENREKKAANYWIFKPADLSRGRGIFVFNDIGELR-----YSEKSVVQEYIANPYLI--GGYKFDLRLYAVVVSPLIVYICREGLVRFGTEKYDLKNLCNVYSHITNTSINVSGPSYDSAIGEGCKWSLSNLRNYLYSQG--VNDRLIFARVTAIIVLALMAQAKS--ATVSTGNCYELYGFDILLDAALKPWLLEVNFSPALNIDCDAQVKREMLNGVFDLL---CFTESDKLQSRGG.... 413
42 0.000e+00UniRef50_A0A016T479 Uncharacterized protein n=3 Tax=Ancylostoma ceylanicum TaxID=53326 RepID=A0A016T479_9BILA  ali  20  14....RLTWCHNSLLPIVMRHCLAASHFTIVD-ESLFYIGYWGRHLKSSQY---RTLKPHQKVNHYPGAFHIGRKDRLWMHIEKQQRRL-----GEHVYDIMPKTYLLPKDYDHMRNYL---------------------AASPSNHVIIKPPASARGTGISVTRKVKEI-----PEKTQLVAQQYVDRPLTI--NGAKFDLRLYAYVPSPLRIYIYEEGLVRFASVPYSVSTVSNKYMHLTNYSINKLAEQDGVSDSPVPKWRLTELWKYFENDGINSA--GIRERIEDVIIKAFIACEKPIRHIQHGFICHELFGVDILLDEDLKPWLLEVNISPSLHTPLDISVKAPLAKDVLNMIYVPPSPEEMATADYG..... 381
43 0.000e+00UniRef50_A0A2R5GQD2 Tubulin polyglutamylase TTLL5 n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GQD2_9STRA  ali  25  462....................................WNLLWTWSKPKINRET---LLRWQRVNHFRTARTLTRKDLLKKELQRYR---SMSKFLSHEFELLPDTFILPKEYLQFVDAFAKYGEQEPD----------------GNFWIMKPVGLSRGRGISLVSDIGDVC-----YGQSVIIQRYVSNPMLLD--GYKFDLRIYVLVTSPLEAWIYDEGFVRVCTHKYSSADIHNLFIHLTNSSIQKMGPNGAGDEAGGTKLSLSYLWRRLGAQGLD--VEKIQSAIKQLILKSLVCCDQSMDND---PNSFELFGYDVLLDENVRPWLIEVNSSPSLANQLDSKIKRKLIADTLRL..................... 769
44 0.000e+00UniRef50_I7LXN9 Tubulin-tyrosine ligase family protein n=2 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7LXN9_TETTS  ali  19  96.YYFKL----NNCNIKLVRGLLEENGFRET--IDKDWTIMWVVGSIKSEIY--QTMMAYQKVNHFPKSIEITRKDLMNRNISKMQIRCGLSNF-----NFVPKTYILPSEQSLLIEDFEK-------------------IKSTKQLFIVKPQNGSQGKNIFVTDKLNDILR--ANVGSGLVVSHYVANPLLI--NNLKFDLRIYVAITSPLRVYIYEDGLVRFATQEYDIDLLKDKYVHLTNYSINKNSNNFVSNKDKGSKWSLASLKDYLRVNGIN--VEQLFDKIEDMIVKTIISIEGQIMQVPYRNNCFEVLGFDVLIDDTLKPYLLEVNLNSSLNTPLDLRIKGEMLSDLFTLVIVPLDQR............. 438
45 0.000e+00UniRef50_H2ZKE5 Uncharacterized protein n=2 Tax=Ciona savignyi TaxID=51511 RepID=H2ZKE5_CIOSA  ali  22  40....ITANVTNCKY-ELVRSSVEAVNIHVLKEDAQAAYLFWYDSVVPMEK--FQELKNYQRINHFPSMGEICRKDYLARNMAKWVECAR-----PSEFNFVPRSWILPSEYNLLQIYAQDCR----------------KKKRKSPTFIQKPSNGAMGNGIQLFRNPEKIQAA-----EQTIVQEYLDKPLLLD--GYKIDLRLYCLVTDPLRAFLYKDGLVRLSTEKYTEQNMDQVFMHLTNYSVNKQNEKFHSDFDRGSKRSIKSLIAYLKNAGYDT--STLWRNICDLVVKTLIVASPHILHSYRMCRCFEILGFDIFLDRKLKPWLLEVNRAPSFGGDIDRDIKGGVIRDALRLVIRASDKKRNAEAQRRLF... 405
46 0.000e+00UniRef50_A7S719 Predicted protein (Fragment) n=2 Tax=Eumetazoa TaxID=6072 RepID=A7S719_NEMVE  ali  22  42....................VLRSKGWTEVREEG-DWDFYWCDVGWMREFFDHTYMDEHVKISHFRNHYEXXXXXXXXXXXXXXXXXXXXXKHEGTKCEFYPTTFELPMEYHIFVEEFKR---------------------NPGTTWIMKPVSKSQGKGIFLFRKLKDIMDWKKEDPETYIVQRYIENPFLV--GGRKFDLRIYVLVTSPLCVWLYREGFARFSNTRFSLDSIDDTYVHLTNVAIQKTAPDYDP-----------------------EKVEQVMRNIDQMIIKSLQAVQKVMINDK---HCFELYGYDIMFDSNLKPWLIEVNASPSLSSQTDYELKFRLLEDVVY-VIDMENR.............. 358
47 0.000e+00UniRef50_UPI000C87C2C6 protein monoglycylase TTLL8 n=1 Tax=Pteropus vampyrus TaxID=132908 RepID=UPI000C87C2C6  ali  27  608.................................................................................................................ISNSRSHYSQCQDLLNKISSVNPQTEIDGLQNIWIVKPAAKSRGRDIVCMNRVEEILDHLSTKDSKWVVQKYIETPLLI--GDTKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDNL-DSAIHLCNNSIQKHLKNAKDRLPCHNMWTSARFQEYLEKRGRGSLWSLIYPSMKRAIANTMKVAQEHVEARR---NSFELYGADFVLGRDFRPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVVL---DRRADRSCDVGSFELL 876
48 0.000e+00UniRef50_E3LRY3 CRE-TTLL-4 protein n=4 Tax=Caenorhabditis TaxID=6237 RepID=E3LRY3_CAERE  ali  22  135....RLTWCHNSLLPIVMRQTLSASHFTIVD-ESLFYIGYWGRHLKSAQY---RALQPHQKVNHFPGAFHIGRKDRLWMHIRNMQE------RFEGEFDIMPFTYVLPTDRPELMKYLETDANRHV---------------------IIKPPASARGTGITVTRKPKDF-----PITATLVAQHYIERPLTI--NRAKFDLRLYAYVPTPLRVYIYDQGLVRFASVPYNPSSISNKYMHLTNYSINKLAEADGVANKPVPKWTLEHLWDHFDQLG--VDRKKIQKQIEDVIVKAFICCEKPIREHMSRFICYELFGIDIILDEDYKPWLLEVNISPSLHTPLDISVKAPLAKDVLNLAGIYVPPSTDK.......... 469
49 0.000e+00UniRef50_A0A1D5PXD1 Tubulin tyrosine ligase like 9 n=8 Tax=Chordata TaxID=7711 RepID=A0A1D5PXD1_CHICK  ali  26  1....................................................................................................................................................MKPVGRSQGKGIFLFRKLKDIFDWKMDGGETYVVQRYIENPYLI--GGRKFDLRVYILVTSPLKAWLYRDGFARFSSMRFTLNSIDDHYVHLTNVAVQKTAPDY--DPEKGCKWMIQQLRQYLTARHGTGLVEVLFADMDNIFIKSLQSVQKVIISDKR---CFELYGYDILIDRDLKPWLLEVNASPSLSSQEDYELKCHLLEDTLHVV-DMEGRLTGKEKRVGGFDLI 237
50 0.000e+00UniRef50_A6PVC2 Protein monoglycylase TTLL8 n=85 Tax=Theria TaxID=722675 RepID=TTLL8_HUMAN  ali  23  300...............................................................................................EWEDLTQQYYSLVHGDAFISNSRNYFSQCQALLNRITSVNPQTDIDGLRNIWIIKPAAKSRGRDIVCMDRVEEILELAASRDNKWVVQKYIETPLLICD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDKL-DSAIHLCNNAVQKYLKNDVGRLPAHNMWTSTRFQEYLQRQGRGAVWSVIYPSMKKAIAHAMKVAQDHVEPRK---NSFELYGADFVLGRDFRPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVAVD-------RSCDIGNFELL 582
51 0.000e+00UniRef50_H2Z4P7 Uncharacterized protein n=1 Tax=Ciona savignyi TaxID=51511 RepID=H2Z4P7_CIOSA  ali  25  214..............................................................................................DDWEKLIYHYYKLVHEGAVIAHSGSYLQQCEQALFRIKERNPQFFTEGVKNTWIIKPGAKSRGRGIIVNNRLDDILKLVSGKDSRWVVQKYIERPLLVHS--TKFDIRQWFLVSDPLTVWIYKECYLRFSSRPFSLKNL-DQSIHLCNYSVQKNDSNRSPLLPAENMWSCTEFKEYLRSRNCHTLWDDLFPGMKKAIIHICQTAQDVVEYRKG---SFELYGADFMLDENYNPWLIEVNSSPTMSTAVTSRLCASVQEDTMKVIL---DRKRDRNCDIGLFEQI 501
52 0.000e+00UniRef50_A0A2D4BV62 Uncharacterized protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BV62_PYTIN  ali  20  750.....VRINVTLCRYEVVRKIARDRGWXLVSDEEDRCNVHWID--VPDFQGTFRLLQPFAKVNHFPGMTHLARKSKLARNFERMKKL------FPEDYDFCPRTWILPFDLYDFQQQFN-------------------ADGVSQRTFIVKPDHSCQGRGVFLTRNLHQI-----SRQDIMVAQQYVKAPLLID--GKKFDLRIYVLITSPLRVYLFKDGLVRMATADYNAENMELRYMHLTNYAVNKHSXNFEVNDGSGSKRSLRWFFSWLRESHADDVVDALWDKXGDICLKAILAVQPMLAQEYRTSSSFSILGMDVLVDEALKPWLLEVNHLPSFGSPLDWNIKERLISQTFDILKVSADDKDRYEAE....... 1149
53 0.000e+00UniRef50_Q7Q156 AGAP009960-PA (Fragment) n=7 Tax=Holometabola TaxID=33392 RepID=Q7Q156_ANOGA  ali  25  234........................................................................CKEYLDYCLHNDIDIEEDTKWDHDWDVFLTHHYLLTHEDNRIQAIEHYLAEAKSVLEQIKSHWPQYALDGYLNIWIVKPGNKCRGRGIHLMNNIKQIIAMVNPPKTRYVIQKYIERPLIIH--NTKFDIRQWFMITSPLNIWFYKESYLRFSSQQYNLMNYHE-SVHLTNHAIQKKYHNAVRDEPHENMWDCHTFQAYLRQIDKYEMWERIYPGMQKAIIGSLLACQDNMD---RRPNTFELYGADFMITEDFYPWLIEINSSPDLSTSVTARLCPQCVEDTIRVVI---DRRTDSNAPTGSFELI 550
54 0.000e+00UniRef50_A0CMI5 Uncharacterized protein n=3 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0CMI5_PARTE  ali  22  35................LRDQVVQILDWKPTPSEFE-CHIFWKDTYVTDEEY--RRLLPYQRINHFPGSYMLGKKNELCRNLNKMRKQY------PQDYDFYPKTWHLPYQSEELRN------------------------KQGTGIFIIKPEANCQGRGIFLTKKLDQFL------DKHYVVQEYISNPYLID--GLKFDLRIYVMLKSPLKIFMYQEGLARFSTKKYQKKNLSSVTMHLTNYAINKRSKDFVNKDDVGHKRSLSSVFKYLKDQ--DHDVDQLMSQIKSVIVKTIQSVQGDLAHLYRSQQCFELFGFDILLDSNLKPWLLEVNHTPSFSTPLDKIIKKN............................. 344
55 0.000e+00UniRef50_G3QT13 Tubulin tyrosine ligase like 8 n=14 Tax=Boreoeutheria TaxID=1437010 RepID=G3QT13_GORGO  ali  23  300...............................................................................................EWEGLTQQYYSLVHGDAFISNSRNYFSQCQALLNRITSVNPQTDIDGLRNIWIIKPAAKSRGRDIVCMDRVEEILELAASRDNKWVVQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDKL-DSAIHLCNNAVQKHLKNDVGRLPAHNMWTSARFQEYLQRQGRGAVWSVIYPSMKKAIAHAMKVAQDHVEPRK---NSFELYGADFVLGRDFRPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVAVD-------RSCDIGNFELL 582
56 0.000e+00UniRef50_L1IA12 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IA12_GUITH  ali  23  1........................MGWRHTSDDRAHYQLYWSDRSITRTR--MKKLACEQTANHFPGMVCLTSKSQLAANLAKMQRVC------PEEYDFVPRTWVLPDEYAAFRQDFKKMRSQENDEMMF----------------IVKPERGCQGKDIFLTKTADEIESAFWNLGDALVVQEYIQDPLLAD--GHKFDLRLYVLVTCPLRIYLYKDGLVRFCTEPYEIANQANKYMHLTNYSLNKNNSKDPQDAKQGSKRRLSIFFEHLREGGHD--VDALWLRLEELTVKALIAVQPLLAHFHQMCRSFELLGMDVLVDRNLKPWLLEFNHSPSFHCEVDQLVKEPLVSDTFRILNAKLEYR............. 342
57 0.000e+00UniRef50_A0A0S4JEF0 Tubulin tyrosine ligase, putative n=1 Tax=Bodo saltans TaxID=75058 RepID=A0A0S4JEF0_BODSA  ali  20  35....................VFRRLSWELCDDNSQ-WHFHWGHVRNVFSPESSTRLNDLQIINHFPNHYELTRKDLMYKNIKRYFRDPANSN----------EKVLNSRGDLRLWDCVPITYSVPSDMSLFVEEFKRH----PGSTWIVKPTNRSQGKGIFLVNKLTQMNRWLRDKQNPFIVSRYIDKPLLI--GGKKFDLRLYVLVTSPLVAYLHRQGFARFCATKYSHADEDDLGSHLTNVALQKGEDEYNELH--GGKWSVANLWLYIQATFGHQKADNLMDDICFVVTQTLKALQPAMLNDK---HCFELYGYDVLVDENLQPHLIEVNASPSLTTMNDRLMKEEVLHDVFSIVMPPGFPS............. 370
58 0.000e+00UniRef50_A0A1R2BSH1 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BSH1_9CILI  ali  22  1MNTKVICNISNTRYDLIREVLTTVLDWKISEDENDDWDVMWTDIAILPEK--LMKMKTYQRINHFPMMHMVSRKNFLADSLEKIRKL------FPKDYSFFPKTYIFPLDKDNI---------------------KQYIQDHGREFMIVKPEMSCQGKGIFFTNHIEEI-----NPSDKYVVQEYIKSPYLID--GLKFDLRIYVLVTSPLRVYVYDEGLAKFATHMYSIGNITDMFMHLTNYAVNRGNVKFVNNDGVGHKRSLAYVYRYLQEQGHDVF--ALKMRIEDSILKTLCAVQPYLAQCYIGCQCFEVLGFDIILDDKLNPYIVEVNQSPSFATPLDREIKKGIVAGALRL..................... 339
59 0.000e+00UniRef50_H3FTC6 Uncharacterized protein n=2 Tax=Pristionchus pacificus TaxID=54126 RepID=H3FTC6_PRIPA  ali  23  82....RLTWCHNSLLPIVMRHSLAASHFKVVEETNQ-WIGYWGRHLKSTDY---RNILPHQKVNHYPGAFHIGRKDRLWTHVSEQIDRFGSTEYG-----IVPYTYILPREMESLEEYLEENPEAHV---------------------IIKPPASARGTGIMVTRKMKDIKQ-----DSPLIAQQYIYRPMTI--NGTKFDLRLYAYVPCPLRVYLYEEGLVRFATVKYSMSTISNKYMHLTNYSINKFADRDGISSDPVPKWRLSELWTYFEERGIDS--KKILESIEEVIVKAFIACEKHIKQIHSGYVCHELFGFDILLDEKARPWLLEVNISPSLHTPLDSSVKAPLAKDVLNMA.................... 407
60 0.000e+00UniRef50_J9LXJ1 Glutathione peroxidase n=4 Tax=Macrosiphini TaxID=33386 RepID=J9LXJ1_ACYPI  ali  21  11...FIFRVNDNGTGPVLLIQVCQERGWKEYDGTDEYWNLWWKSTGFSLSHY--KQQKIWQFNNHIPSGSALCRKDNLWRYLKCMKNIFGTSLFG-----FSPDSYNLP-----------------LEYTKLAAECSHDTDVGEKSIWICKPVGQSQGKGISLISQIGDLV-----YDTNIVVQRYVKNPMLI--GGYKYDLRLYVLVPSPLTIYIYREGLTRFSTDKYSLNNLDNHFAHLTNSSINKLGPNYSETKE---KIGLVHVNHHIYAKPGVNDW-LLWQKISVLVSLTLASQCTGIPS---TSNCFELYGFDILVDSDLKPWLLEVNLSPALGCDVDNRVKRPLLHDMFDLLGLPM-------CNTGL.... 375
61 0.000e+00UniRef50_A0A1J4KAU0 Tubulin polyglutamylase TTLL6 n=2 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4KAU0_9EUKA  ali  22  12..KYVWANLTNTHYTSV-RQCVEEAGFKITESD-TKALLFWYDGGGQMD--IASSLEPWQFYNHFPAIWSISRKVELARNIERM------ARYMPEIYKFHPRTFLLPGQFNDLKGFM------------------LSIPKRKKRTFIIKPDAGAQGKGIILVQNPEQLEDYF----EAAVAQQYI-KPFLID--GYKFDLRIYALLTSPLRIYIHKEGMARFCSEKYVKSNLDQVFSHLTNYSLNKKNDHFNNDSDSGSKRSLSSVFNEIEKMGHST--KQLQDKIDDIIRLTIASVQPFLANNYHTSRCFEILGFDIMIDKKLNPWLIEVNCMPSLTCDFDSELKLSVISGTLKIIALNPNFKK............ 355
62 0.000e+00UniRef50_UPI00065B6B6C uncharacterized protein LOC101854318 isoform X1 n=3 Tax=Aplysia californica TaxID=6500 RepID=UPI00065B6B6C  ali  24  666........................................................................CEKFLASKEHEDIDVPGEIGQDGQWDDLIQWYYKLVHEDGNFRIPTALLGQCEILVRRLGGHWPQLEMDGVRNVWIVKPGAKSRGRGIVCYEKLEDMLKLVNSKDSKYVVQKYIERPLLVY--NTKFDIRQWFLVTDPLTLWFYQDSYLRFCSQQFTLDDF-DQSIHLSNNAIQKHYKNGPRELPPENMWTHEEFKDYLASKNKPNAWDDIYPGMKRAIVCSLLVTQDIVEYRKS---SFELYGADFMLTEDLQPWLIEINSSPSMSTAVTARLCAAVLDDTIKVVV---DRKFDRNSDTGRFEL. 975
63 0.000e+00UniRef50_A0A0V0QHP6 Uncharacterized protein n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0QHP6_PSEPJ  ali  23  211.NKKIIMNVAFADYNVVKYVGKKIFGWKLYEEESNNFDVMWTDKGINVD--SLSKLEHHQKINHFPGIYTLARKNNLCKNLYRLKRA------FPEEFRFIPQTWLLPTDLPQFRQQFENI------------------PKNKARTFIVKPEAGCQGRGIFLTRSINDFDS-----TQHYVVQRYLHRPHLID--GLKYDLRIYVLLADPLRIYMFEEGLARFATEEYELNNLDDLCMHLTNYAINKNNSKFEFNDDEGHKRSLTSIWELFKQNG--WPLGDVQQQIKDIIIKTICSGQPVIAHEYKTAQCFQILGFDVMLDNKFKPYLIEVNHLPSFATPLDAKIKKNAIRDALNLMNINIKKRRHTEKQTR..... 574
64 0.000e+00UniRef50_A0A0M0J5B5 Tubulin-tyrosine ligase family protein n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0J5B5_9EUKA  ali  20  2.......................................CWSDTSVALERI--MRMGRLQKINHFPGMLELVRKAGTARNLNKMLKACGK------DYKFFPKTFMLPADYTQLKAEW------------------APGQNHGNKTFIVKPSAGCQGKGIYLTRKLDEI-----DPQDNSVVQRYLHRPHLLE--GYKYDLRIYVLLSSPLRIFIFREGLVRVCTEKYQPKNLENVQMHLTNYAINKDSETFVEDHEQEHKRTITSLMNTLRAEGHD--VDRLWKDIGEVCVKTIISVQPHLEHTYFTCRCFELLGFDIMMDYKLRPSLLEINHSPSFTSPMDTAVKTAVIRGTMEMIFSREEYKLIKRCPARL.... 324
65 0.000e+00UniRef50_G4VGQ8 Tubulin tyrosine ligase-related n=2 Tax=Schistosoma TaxID=6181 RepID=G4VGQ8_SCHMA  ali  23  739.FRRLLKWRASSLTPIVVKQTLQRTGFKNVSEDSSDWIFYFGKHMRP---QIFRTIKMYQKVNHLPCSFQLGRKDRLWRNIVQMQ-----LKHGKEHFNFMPQTYCLPGDLDELKKVW--------------------DEEGENQRWIMKPPASARGIGVRLVTKWSQI-----PKKRPALIQKYLSRPYLINDS--KFDLRIYVYISSPLRLYIHEDGLVRFASQKYSNASLGNRYIHLTNYSINRLNSEYISNTDEGHKWSLRAFWTYLKTKGISPA--PIWSNIKDVVVKTIISTEAAFNSAVNIYHSFEIFGFDIFLDEDLQPWLLEVNVSPSMHSPLDAKIKGNVIKDMLNL..................... 1082
66 0.000e+00UniRef50_A0A1J4K402 Tubulin polyglutamylase TTLL7 n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4K402_9EUKA  ali  23  20....VFVNVSNTRF-SVVKHSVEEMGYKITESTSKN-LLFWCDSGGSFEF--TSQLSHWQFYNHFPGTWAIARKVDLSRNIEKMSRLL------PEFYDFHPKSFIIPSQFTEMEQFMN------------------SISKKSKKTFIVKPDRGSFGKGIVLIQSPDSIQDWIDSA----IAQQYIE-PYLID--GLKFDLRIYALVSSPLRIYLFHEGIGRFCTEPYSSKNLELSFAHLTNYALNKNNPNFREHADSGHKRSLTSVLEYMKANG--VDVDDLMSQIEDIIRLTVISIQPYLSTNYRTSRCFEVLGFDILIDKYHKPWLLEVNWSPSLATPFDKALKTDLIQGALKIINIPPNFKQKVNRRR...... 370
67 0.000e+00UniRef50_A0A1R2AZK0 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2AZK0_9CILI  ali  22  9....KIRIDLSKCQYEILEEVVSDLKWD--NDNFEKPDIIWQDSALNPMSLSL--LSPYQRINHFPGMYAISRKDYLAKHLKAMEQLHKSE------FEFFPETWVLPQEYISLKTHM---------------------ASNTNAYYICKPPNLSQGKGIFLTKWISDI-------PENCVVQKYLENPYLLD--GFKFDLRLYVLVTDPLRVYIHEQGIVRLATIPYTDTNIHNIYMHLTNYAINKNNPNFVHNDFVGHKRSFKSFLKALEEDGHNI--KKIMARIDDIVLKTLCTVQPFIVNLYRTSQCFQILGFDILLDYKLRPSLLEVNHTPSFTTPLDRKVKKAVIKDCLKMIAAKPECQKK........... 349
68 0.000e+00UniRef50_F4P746 Uncharacterized protein n=2 Tax=Batrachochytrium dendrobatidis TaxID=109871 RepID=F4P746_BATDJ  ali  22  57....LTINLTNCKYD-IVKECATLFGCKLV-EDPLSWHLFWIDTGVSMERVL--EMKLNQRINHFPGMHEICRKDHLARNFTRLSRI------FPKDYNFFPKTWILPNDWGEFNLFH--------------------KSKSRSGPYIAKPDHGCQGKGIFLFKTPDQLYESQSTSGSNLIVQSYLSQPCLID--GFKFDLRIYVLVTSPLRVFVYRDGLARFATDLYTDKNINNTRMHLTNYAINKHSEKFVVDDMNGSKRSLKAVLQFLAESRG-VDTDALWNRICDIIVKTILVVQPVISRGLKSSQCFEILGFDIFLDSKMKPWVLEVNHSPSFTSPLDREIKSGVITDALNLL.................... 449
69 0.000e+00UniRef50_A0A0A9WHT4 Putative tubulin polyglutamylase TTLL9 n=4 Tax=Panheteroptera TaxID=33351 RepID=A0A0A9WHT4_LYGHE  ali  19  48...............TIIPEVLLSRGWIQVDGKSEVWDLFWCDLAKL-GMVLEKRLQESQRVPHFRNHYEISRKNYLFRNMIRYKKQLIRDKNVEEYCDCIPLTFEIPNEYAMFCDYI---------------------KNNPKKTYIVKPACGCKGRGIFLFRKLRELNEWKSTKDEQYVVQVYVDNPYLI--AGRKFDLRFYVLVMSPLKVWIARDGFARICGALYNLNNIKDNLSHLTNTSLQ----LATDVDAKGFKWPLRRLRMFLTAKHGMRAVEELFQKMANLVITSLKSVQKVIMHNK---HCFELYGYDVLLTDNLEPWLLEVNASPSLTDSEDYELKYNLLSDMFT-VLDLENQLTGTELRVGGFDLL 411
70 0.000e+00UniRef50_UPI0006D9321F protein monoglycylase TTLL8 isoform X1 n=2 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0006D9321F  ali  26  336...............................................................................................EWENITQQYYRLINGCATIANTKEYLLNCQLILNRLKSTNPQLEIEGDRNIWIVKPGAKSRGRGIMCMDKLEDILKLTYGKDSKWVVQKYFERPLLIY--NTKFDIRQWFLVTDPMTIWFYNDCYLRFSTQPFTLKSLE-SSIHLCNNSIQRNYKNSSERHPENNMWSSAQFIKYLIKEGGDIWEDVICPSMKEAIICTMKTAQDTVETRRG---SFELYGADFLLGENFKPWLIEINSSPTMHTPVTANLCRQVQEDTIRVVI---DRKYDKNCDTGKFELL 620
71 0.000e+00UniRef50_H3H030 Uncharacterized protein n=12 Tax=Phytophthora TaxID=4783 RepID=H3H030_PHYRM  ali  23  154...YRTSWERNC-----VKNAFAAAGFFRTRKMWTAWHLAWAKPVPKTQFERFRGDHP-QVFNHFPDPWVIGRKDRL------MKTLANCRRRFGSSYDFFPEGFSLPDQLDAFRRALERNEFPSSVVTKGVDESARKKADTVGPLWITKPPASACGRGIRVLRKLSR-KPKNGKKPKACIVQKYVADPLLLGDGDRKFDLRLYVVVTSPLRIYLFQEGIARFCTAPYSLKNPRNRLAHLTNYAINKGSDGFVENADAGSKWSLSALLRALQAQQLLDDPETLMRQIRAIVCKTIIAAEAHLTPLLHQFSCYELFGFDLMLDAKLRPWLIEVNVSPSLGSPLDRRVKGLLLSDT........................ 523
72 0.000e+00UniRef50_A0A2U4CL42 LOW QUALITY PROTEIN: probable tubulin polyglutamylase TTLL9 n=4 Tax=Amniota TaxID=32524 RepID=A0A2U4CL42_TURTR  ali  20  1.............MNTLMDVLHHRPGWVEVTDEGE-WDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYENWSNTSLRAVS------------------------ILGNDCAALGFGGPLSKVQDEWNCRGTAAKKLTSLGAXPAPSAVNPSGS------HTTRSSDD--QKDDIPVENYVAQHYIENPYLI--GGRKFDLRVYVLVMSPLRAWLYRDGFARFSNTRFTLNSIDDQYVHLTNVAVQKTSPDYHPK--KGCKWMLQRFRQYLASKHGPTAVETLFSDMDNIFIRSLQSVQKVIISDK---HCFELYGYDILIDQDLKPWLLEVNASPSLSSQEDYELKTCLLEDTLHIV-DMEARLTGREKRVGGFDLM 328
73 0.000e+00UniRef50_A0A2B4SXR5 Putative tubulin polyglutamylase TTLL2 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SXR5_STYPI  ali  20  13..............PDILREVCLERGWEEYDESRDEWNLWWKTQGFTSGEFEHCR--PWQRLNHFPKSTNITKKDGLARNLRRMR-----TSYGGSMFEFFPQTFILP-----------------SEFKKFVAEFFKQDSGQRSKYWICKPTEQSCGRGIFIFQDLHDL-----TYDCAVVVQKYIIKPFLI--SGYKFDLRLYAIVTSPLLLYIYHEGLVRFSTERFDLSSLDNRFSHLTNTSINKTGPQYKESIGTGCKWTLSKLRHFFHK--HNIDDRLLWHQMQDI--------------PSNSSNCFELFGFDILIDEKLKPWLLEVNFSPALGNDCDEIVKKPLLNDILESLNFTELDIKRGERERG..... 347
74 0.000e+00UniRef50_B0WKD5 uncharacterized protein n=1 Tax=Culex quinquefasciatus TaxID=7176 RepID=B0WKD5_CULQU  ali  24  313........................................................................CKEYLDYCLHNDIDIEEDIKWDHDWDVFLTHHYLLTHENGRIQLLKEYVADAKSVLEQIKCYWPQYALDGFLNIWIVKPGNKCRGRGIHLMNNIKQIIAMVNPPKTRYVIQKYIERPLIIH--NTKFDIRQWFMITSPLIIWFYKESYLRFSSQQYNLMNYHE-SVHLTNHAIQKKYHNAVRDEPHENMWDCHTFQAYLRQIDKYEMWDRIYPGMQKAVIGSLLACQDNMD---RRQNTFELYGADFMITEDFYPWLIEINSSPDLSTSVTARLCPQCVEDTIRVVI---DRRHDPNANTGSFEMI 628
75 0.000e+00UniRef50_S9TTN4 Tubulin--tyrsoine ligase-like protein n=1 Tax=Angomonas deanei TaxID=59799 RepID=S9TTN4_9TRYP  ali  23  340.....IVNVSLSKY-SLVRKVAAEMGFTEAELNNYKFNLCWSDTVLPLTRIT--RFGNWQRSNHFPSMFLLCRKGHLGTTLGKMRRGL------PSHFQFYPYTWTM-----------------RTERAQFMRYYAALRQKKLVKYFIVKPNSGCQGRGIVVTRDP----YGTVEDLDNYIVQEYLPRPLLIE--GRKFDLRVYVLLTSP-SIFLFNDGLVRMCTEPYTESNVKNTCKHLTNYAVNKHSAEYVFNTDVGNKRNFKFFNQFLKNEGHD--VDLFWSQVGFLVVKTIFAAQPQIRQVYDSCSCFEILGVDILVDHKLRPWLMEVNHTPSLATPLDLDIKGRLLRETWDIIDRPEDYAVNRQKEREEFQK. 702
76 0.000e+00UniRef50_K6VA57 Tubulin-tyrosine ligase (Fragment) n=1 Tax=Plasmodium cynomolgi strain B TaxID=1120755 RepID=K6VA57_9APIC  ali  22  24...YYKIHLANTRYEIIKRVVEESEKWIEANPDSTDWDVIWLDTSISDDR--FRKLKKFQKINHFIGMKGITRKDELCKNL------KKMKKKFPQCYNFFPLTWILPNEISDFKNYFKK--------------------ESGSKTYIVKLKNSCQGKGIYLTKSLDNINKY-----DSCVIQKYIHKPLLI--NGLKFDIRLYVLVTDPLRIFLHEDGLVRFSIEKYKLKNLKQVNMHLTNFSINKKSDKFENSLDPGHKRSWKAFLQKLKEEGLP--MDSVMKRIEHMIVKTICSIQPELKHYYNSAHCFEVLGFDILLDYKLKPWLLEVNHSPSFATSVDEKVKYAVIRDTLNMLYMHSKYR............. 368
77 0.000e+00UniRef50_K0S2R6 Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0S2R6_THAOC  ali  22  193...........CCY-SVTRRSAQALGWTLVESRKRNCHVVWIDRSF-VSDKLFLSIQPWQRINHFPGMINICRKARLAQSLEVMRRQ------FPKEFSFYPNTYVLPHAYASFKTLFSSSGSCKD-------------------TFIVKPDGAAQGKGIFLTRRIEDVENL----GTVCVAQQYIRNPLLID--RKKFDLRIYVLVTSPLRMYLFRDGLVRLCTEEYSTSNIKDRCMHLTNYSVNKRSDKYERDEESGSKRSICWLLSWLSQKKGPGAAKRLWSRIGDISVLTVLSILPTLQREYSCSRCFELLGIDIMIDSSMNPSLIEVNHLPSWATPVDEEIKSRVITQALRAINVDANDRRRYEQAKRK.... 566
78 0.000e+00UniRef50_Q57U80 Tubulin tyrosine ligase, putative n=14 Tax=Trypanosoma TaxID=5690 RepID=Q57U80_TRYB2  ali  21  155...................................DWHFFWMSVGRVRSLFSSYRLSDSQIINHFPNHYELTRKDLMYKNIKKYIKDPNNVQL--RMPYSLPEQLANGGDYLRFADCVPITYNIPNDLAMFEEEFRRQ----PGSTWIVKPTSRSQGRGIFLINRLSQLKKWLKERKESFVVSKYIRDPLLI--GGKKFDLRLYVLVTSPLVAYLHDQGFARFCATRYVANALSDLCSHLTNVALQKGEKEYNASH--GGKWTLANLLLFIQGRFGAAAADWLMHGIEFVIYHSLRALESVMFNDR---HCFELYGYDILVDSQLRPHLIEVNSSPSLSTTTDRLLKEEVLQDVLQVVFPPDFPSNN........... 495
79 0.000e+00UniRef50_A0A226EQL1 Putative tubulin polyglutamylase TTLL9 n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226EQL1_FOLCA  ali  23  33....................AMRRRGWQQSPEPSSDWSLFFCDRDAMINVTNYRPLLDYQRLGHFRNCQEISRKNNLVKNLKRFRGRLERAKATGDKCLFMPETFILPSEHSKFLAEF---------------------RTNSDTLWIIKPAAGAQGRGIFIFKSPTDYLTWRTTFDDTYVVQKYITDPYLI--GGRKFDIRFYVLVTSPLRCYIYREGFARFSAGQFSLDALQDVYIHLTNVAIQKTSEDY--NPEKGSKWSLQSLREYLSARHGREKVQGLFNTIDMIVIRTLQSAVGLVSGD---PHCFEVYGFDVLIDRMLKPWLLEVNASPAFSNEEDYVLKLGLIDDTAT-VLDLEGRLTTLEIRIGGYDLL 420
80 0.000e+00UniRef50_A0A078BA45 Tubulin-tyrosine ligase family protein n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078BA45_STYLE  ali  20  4....LFKANLDSQYNIIKEVAKGQFNWRVICQKDPDWDIQWTDTAPSIDK--FSKIKPYQKINHFPAMFQIARKNYLAKNLKKMQKN------FKDDYKFFPKTWLLPQD-----------------LSELKQIIAQNSQRSIKQVYIVKPESLSQGKGIFITKRVDQI-----DPTEHLVVQKYLKYPYLID--GLKFDLRIYVLVTNPLRIFIHKEGLARFASEQYQHKSYSNPFIHLTNYAINKDNQNFTQNGETGHKRSLKSVYQTLQKDGIDI--EKLQDRIDDIIVKTLISIQPDLVHNYRTCQCFEILGFDIILNKKGVPQLLEVNHAPSFNTNLDRIVKSQLLTDTFRLLNVTLPEKNKVLEQIRL.... 358
81 0.000e+00UniRef50_A0A1I7VRV7 Uncharacterized protein n=1 Tax=Loa loa TaxID=7209 RepID=A0A1I7VRV7_LOALO  ali  21  374..KYHLRFKMIKCNQALVKTILHSYGFEQCSSKNSNCNIIWTGSHLKPH--VLRSMASWQRVNHFPKSFLLTRKDKLYECLGRAQTL------FGTSYDIIPEFFVTPKDYQKFVDHFNGQSHGLK-------------------PFIVKPVASSRGNGIFIIQSPGDI-----PLGSPMLVSRYIENPYLL--NGHKFDLRLYVLVTSPLVAYMYSEGLARFASERYSSKSYEQRFSHLTNYSLNKNNGKFIRNEDSGHKWTLGALLRKLQTNGIDT--NLLMVRVEDVVLKALFSVQGQIAAASHSKCCFELFGFDILIDTGLKPWLLEVNLSPSLSTPLDLQLKSSLVCNVLTLAAVPL................ 743
82 0.000e+00UniRef50_A0A0L0HT60 Uncharacterized protein n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0HT60_SPIPN  ali  24  134.....LRWKISGFTPKVVRAALLRANFSLVRK-GKNWIGYWGKHPCSPCR--FKRVQSWQKINHFPMSFQIGRKDKLWGNYVKCRGV-----WGHEHFNFIPDTYLLPAHLPSLLRTFSI-----------------------HPLWIIKPPASARGHGIKVINTPKRL-----PKKKKAVISKYITKPFLI--GGRKFDIRLYVLVTSPLRVYLASEGIVRFAGQRYSPKSASNRFIHLTNYSINKRSKD--SSHPRENERSFSALQEYFSLIGIDFV--PVYKEIQRIVVNTIICGHASNASGMRRTSCYELFGFDILLDSALKPWLMEVNISPSLSCDLDWKIKSSVVTDILNLV.................... 464
83 0.000e+00UniRef50_A0A087ZY20 Uncharacterized protein n=6 Tax=Apis TaxID=7459 RepID=A0A087ZY20_APIME  ali  23  93..TKHLKWHLSTITPLIVRRTLINSGFQLMKR-CQEWCGTWGKHMKSSCFRAVKES---QKINHFPGTFQIGRKDCLWVNLSKM-----MLKHEVKEFDFVPRTYVLPRD-----------------LTCFRQVWKKFGSKGK---WIVKPPASARGTGIKVVHRWSQI-----PRKRAVIVQQYLSRPKLI--SGAKFDLRLYVLVTSPLKIYLYPDGLVRFASVKYNDDILSDRFMHLTNYSINKTNSTYTSNDCTGHKWALRTLWSYLEKEH--VNVSKLWATMKDIVVKTMIAGESNITPLTRRYCCYELFGFDILLDENLKPWLLEVNISLQSSSPLDTAIKGPLIKTVFNIA.................... 425
84 0.000e+00UniRef50_A0A1J4KTD3 Tubulin-tyrosine ligase family protein n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4KTD3_9EUKA  ali  21  20......VNLENCGYASV-ERCLKEMGYKIT--GDRYYNLFWCDTNVSIEFPLA--LQKWQFINHFPGTFAISKKIDLARNIERMQKM------FPELYTFHPKSFVVPTQSLDLKMY----------------------LSKYKKTFIIKPDLGSQGRGIFLVQD----SEGVNECVEPAIAQEYIS-PFLL--GGLKFDLRIYVLLASPLRIYIFDEGMARFCTEPYTIENLNEIYRHLTNYSVNKHNDHFKQNDKTEHKRSMSSVFKEIEENGGD--VEELQKEIDEVITLTILSVQPFLAHNYKKSRCFEILGFDILIDENLKPWVLEVNHSPSLSSPFDTELKDAVITGALKIINIDPNFIEKIQK........ 363
85 0.000e+00UniRef50_A0A125YP25 Tubulin-tyrosine ligase family protein n=15 Tax=Eukaryota TaxID=2759 RepID=A0A125YP25_TOXGV  ali  23  1.......................................................MRPYQKINHFVGTNAISRKNYLARNLLRMKAYY------PQEYKFFPHTWSLPADLADFRCQFT---------------------GRRRKTYIIKPDASSQGRGIFLTRNIEDI-----NPTEHLVAQRYLHKPFLID--GLKFDLRIYVLLANPLRLFVHQDGLVRFATSPYSKKNLRDKTMHLTNYAINKSSSNFTPNKDPGHKRSLFHVLDHLKSEGHD--VDALLKEIDECLCKTIIAIQPSLAHIYGSCKCFEILGIDIMIDHKLTPWLIEVNHSPSFTTDLDTIVKFKVIRDALVLLGLSSENRRK........... 296
86 0.000e+00UniRef50_A0A1Y1IJF3 Putative tubulin-tyrosine ligase n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1IJF3_KLENI  ali  21  438...KIVPAGNNS-----VKAAFKDAGFRRVTAEANKWDMLWSGKALKVDDFKG--LNKNQKVNHFPGTWELGRKDHL------YKHLVAAARRHPQQYDFLPSVFLLPEDH---------------------AEWVEDSKRDPQQLYILKPRSSSRGRGVRLLRKPAELTKLRPS-----LVQKYVSNPHLI--NGYKYDLRLYVVVTSPLRVYVYKEGLVRFASEKYGLDNLRKRCAHITNTSINNKGVSSEDGATVAAKWSLSALEAYFESEGLS--FSDIWEEIRGVVLKTLIAVEGRVAHLPHRNNGFELYGFDVLLDADLKPWLLEVNTGPALHCPLDKEIKFKLIRDTLHLVGFSPYDRDKEEEESRRMRLL 783
87 0.000e+00UniRef50_A0A1A8VYA9 Tubulin--tyrosine ligase, putative n=59 Tax=Plasmodium TaxID=5820 RepID=A0A1A8VYA9_PLAMA  ali  22  31...FYKIHLANTRYDIIRRVVEDSVNWVQVSSDCTDWDVIWLDTSISDDR--FRKLKKFQKINHFLGMKGITRKDELCKNLKKMKKN------FPQSYNFFPPTWVLPNEISDFKIYFKKKK----------------NKNGSKTTYIVKLKNSCQGKGIYLTKSLDNINKY-----ESCVIQKYIHKPLLI--NDLKFDIRLYVLVTDPLRIFLHEDGLVRFSIEKYKLKNLKQVNMHLTNFSINKKSDKFEDDATRGHKRSWKAFLQKLKEEGLP--MDSLMKKIEHMIVKTICSIQPELKHYYNSSHCFEVLGFDILLDYKLKPWLLEVNHSPSFSTLVDEKVKYAVIRDTLNILYMHSKYR............. 379
88 0.000e+00UniRef50_A0A0X3PD59 Tubulin monoglycylase TTLL3 n=7 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0X3PD59_SCHSO  ali  21  506.....................IQRPNMRETDDDTSTYDVWNSQCEGSVSDSSSGTISATKAI-----TMALRCCDWYLRSMRHEDLDESSTSTFSQWNQFIQFFYGTAKDPSPFEEGEPIYQRCQFLCDKINSVNPQFELDGCRNIWIVKPGAKSRGRGITCHRKLDSILALISSLDNRFVVQKYIEKPLLI--FKTKFDIRQWFLVTDPLTVWWYQDCYLRFCSHEFTLDHFSEA-AHLSNNAISHKYTNGPRSLPSENMWYLDEFKQYLLANGHGKTWERILPGMRKAIINALLCAQESIDPRK---HCFELYGADFMISEDLRPWLIEINASPCMSTSVTMDLAAKVLEDTLKVVL---DRRTDKNCDTGRFEMI 864
89 0.000e+00UniRef50_A0A183I5C7 Uncharacterized protein n=1 Tax=Onchocerca flexuosa TaxID=387005 RepID=A0A183I5C7_9BILA  ali  22  92....KLMWCKNSLLPIVMRQSLTTSHFTIVD-ESKFWIGYWGRHLKSVQYRTI---KPYQKINHFPGAFHMGRKDRLWQHIYEMIVL-----WGSDEYHIMPITYVLPRDMKRLKAYLHDNPPHKNCLH-----------DNSSHIVILKPPASARGTGISFATKLKQI-----PKKMSLVAQHYIDRPLIV--NSTKFDLRLYVYLTDPLRIYLYNDGLVRFASVPYSLSSMSNKFMHLTNYSINKLAQSAGERTTPVPKWKLSDFWEHIAEH---VDVDVVKSKITDIIIKAVLACESHIKHSLYTFTSHELYGMDILLDDTLRPWLLEVNISPSLHTPTDIAVKTTLAKDVLNL..................... 425
90 0.000e+00UniRef50_A0A085N264 Uncharacterized protein n=4 Tax=Trichuris TaxID=36086 RepID=A0A085N264_9BILA  ali  21  80..RKKLLWSSSTLFPKIVKKMLIEHGFSIVPATEP-WLGYWGQRHKVSEF---ANLMPFQKVNHFPGNFLLGRKDRLCLSLEQMAKRWKKEEF-----SFAPETYILPRQRRALLARMKRN-------------------SGNCGVFILKPPSSSRGKGIRLTNK-----TWNIPEHKPLIVQRYITNPFLI--NGFKFDLRLYVLVSCPLRAYIYEEGIVRFASCKYTADSLNNQYVHLTNFSVNKNAADDVDLDSSELKWTLSQFWNYLAEKGIDN--SALVVKILDLVIKALISCESPINALMSNFMAYELYGFDILVDSELRPWLIEVNISPSCSNEVDYAVKTSLVQDVLNI..................... 410
91 0.000e+00UniRef50_A0A090KZN0 Tubulin polyglutamylase TTLL5 n=4 Tax=Strongyloididae TaxID=6246 RepID=A0A090KZN0_STRRB  ali  23  101..............NKLIRTIFYNHGFTECSPANTKVNILWSRVHIRP--LQLRNLQPWQKVNHFPKSSELTRKDRMSENLLKSKYTHG------DAYNIFPKTFIFPRDTEKLKEDM---------------------CKNSNYMYIVKPPASSRGRGIHIVNSLDEIDS-----NENLVISRYIKNPYLI--NGLKFDLRFYVLITSPLICYLYEDGLTRFASEKYSNDTIKQPFVHLTNYSLNKDNQKNNGQEGQGHKWTISAMLRHLKNVDG-VDTDLLMARIEDLVIKSLLSVQSVISAAYHPQNCFELLGYDIMIDENLKPWLIEVNLTPSLDSPLDTGLKSKLIIDTLNIA.................... 421
92 0.000e+00UniRef50_G4LVY4 Tubulin tyrosine ligase-related n=7 Tax=Bilateria TaxID=33213 RepID=G4LVY4_SCHMA  ali  23  1..............................................MKELFDHGLMGNIIKICHFRNHFELTRKNLMXXXXXXXXXXXXXXXXXXXXXDFFPTTFELP-----------------MEYHMFIEEFRRC----PGSIWIMKPVAKSQGKGIFLFRKLKDIEAWKRELPETYVVSRYVTNPYLL--CGRKFDLRVYVLVTSPLKVWVYRDGFARFSNTRFSLDSIDDQYIHLTNIAVQKTAPDY--DAEKGCKWSIGRLRRQLLAKYGYQKVAELFHQVDVIFIGSLLSVQKIIINDKR---CFELYGYDILIDNNLKPWLLEINASPSLSSKEDYILKTNLLDDMLDVV-DLEGRLTGFEKRVGDFDLI 325
93 0.000e+00UniRef50_A0A2C6KZG1 Tubulin-tyrosine ligase family protein n=2 Tax=Sarcocystidae TaxID=5809 RepID=A0A2C6KZG1_9APIC  ali  21  1.......................................................MRPYQKINHFVGTNAISRKNYLARNLLRMKAYY------PKEYKFFPHTWSLPADLADFRCQFT---------------------SKRRKTFIIKPDASSQGRGIFLTRNIEDIDPL-----EHLVAQRYLHKPFLID--GLKFDLRIYVLLANPLRLFVHQDGLVRFATSKYTGKNLGDKTMHLTNYAINKSSSNFTPNRDPGHKRSLFHVLDRLRQEGHD--VDALCREIDECLCKTIIAIQPSLAHIYGSCKCFEVLGIDIMIDHKLTPWLIEVNHSPSFSTDLDFLVKFRVIRDALVLLGVSSENRRRYHAQQR..... 302
94 0.000e+00UniRef50_UPI000D17849B tubulin polyglutamylase ttll6-like isoform X1 n=7 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=UPI000D17849B  ali  23  65.....LVDLSNCKY-EVLRIVLEKNGWEEGQEDDKRCHLIWTDLSVGPDK--LMKLNKGQKINHFHGMLAICRKKSLFCSLSTMRKL------FPADYMFFPQAFILPNQLSNLLNCFSRSKV---------------------KTFILKPDNGSQGRGVVLAQSVRDVRQAMDGPGSNLVAQKYITKPMLI--NGFKFDLRIYVLILSPLRLYLYREGIARFCTERYQPENLSKNCMHLTNYAVNKYNPNFENETSKGHKWTLTSLFKTLSIQGFDT--TILHQKICHIVVMTILAIVPLLQHNYKTYSCFELLGMDVLIDHRCIPWLLEVNHSPSFSTPLDLKVKESLITDTLKLVMDPQGISKLRQQDKKG.... 420
95 0.000e+00UniRef50_J9K7Z3 Uncharacterized protein n=6 Tax=Aphidinae TaxID=133076 RepID=J9K7Z3_ACYPI  ali  21  52...FKLLNVDS----KLVLTLLANHGFREVNSDSNDFNLLWSNNHI--NTNIISSLRSYQRINHFPRSCELTRKDKLYKNIETMSHRNGIKKF-----SFVPETYIMPKDYNRFISNQYRH----------------------RGLWIVKPFDLSRGRGITIID--YSFKDTQSALKENVVVAKYIDNPLLV--NGYKWDLRLYVLVTSPLVVYLYEEGLVRFATVKYDRSRINNRRMHLCNYSVNKSSPSYIRNSDPGHKWSMSALLNHLREEYL-INTETLMAEIEDIVVKTIMSATAQMLPAPHNQNCFELYGFDILVDDKLKPWLLEVNLSPSLGIDLDSRIKSSMLCDLFTLIIPIVDP.............. 391
96 0.000e+00UniRef50_UPI0008F9E189 tubulin polyglutamylase TTLL4-like isoform X1 n=3 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9E189  ali  23  507...KLLKWKLSTITPVIVRYTILNSGFKLVRKSNE-WTGTWGKHMKSVCFKT---LKDYQKLNHFPGSFQIGRKDRLWKNFSRL-----MNKFGKKEFGFSPKTYVLPQDTKLLRSAWERH--------------------CGKEKWIIKPPASARGTGIKVINKWGHI-----PRKVPLVVQKYIDKPYLI--NSTKFDLRLYVLVTSPLKAYMYDNGLVRFASVKYSSDTLNERYMHLTNYSINKESCQYTQNQDEGHKWTLKTLWSYLEREHK-VDVSTLWASLVDVVIKTLICGESSIANLPSRYCSYELFGIDILFDQVLKPWLLEVNISLHSSSPLDLAVKGPLVKDLMNIV.................... 839
97 0.000e+00UniRef50_J9JX30 Uncharacterized protein n=7 Tax=Aphidinae TaxID=133076 RepID=J9JX30_ACYPI  ali  22  27............CTYSIVHEVATTMGMHIVKPD-ESWDLWWC--NVPMDFKKAKNLKKYQKTNHFLGMSEICRKDSLARNLNTM------SNSFPDDYNFYPMTWYLPSDYIKFQTYMNQHKSAA---------------------YILKPTTGSQGTGIYITKSPKKINQY-----KQMICQLYISKPLLLD--GYKFDMRLYTLIASPLKIYVYNDGLVRLATEPYTYDNVNDRFMHLTNYSVNKCNKMYIDNELFGSKRRITALGDWLHTEGYD--VKKIWNEIDDVIIKTMILAYPFVNRSYQTCPCFEILGFDILLDENCKPYLLEVNHSPDFHTDIDKIVKRELLIDTFKLL.................... 348
98 0.000e+00UniRef50_G0QSB6 Tubulin-tyrosine ligase family protein, putative n=1 Tax=Ichthyophthirius multifiliis (strain G5) TaxID=857967 RepID=G0QSB6_ICHMG  ali  26  1.......................................................MSSHQKINHFPGMYTLARKNDLAKNLKKMKKQ------FPDQYDFFPQTWLLPADYNELRIEFEKIS------------------KGKCKTFIVKPEASCQGRGIFLTRTLDDL-----NYNDHYVVQRYLHKPLLID--GLKFDFRIYVLLTDPLRIYIFKEGLARLSTEKYNRENLDNLCMHLTNYAINKDNPNFQFNEDEGNKRSMTSVMLLLQQQGHDIF--KLWEQIKVIITKTIVSAQPTLSHHYKSCQCFEILGFDIFLDANLKPYLLEINHTPSFTTPLDSLIKRNCIKDALILMNISQKTRN............ 298
99 0.000e+00UniRef50_I7M4C7 Tubulin-tyrosine ligase family protein n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7M4C7_TETTS  ali  22  112....LVMNVADTQYPVVKFVGKKIFKWKLCYDENTDCDITWTDNAVQPE--QLGKMQPHQKINHFPGMFVLARKNHLARNLKKMKKQ------FPDHYKFFPQTWLLPAEYNELRTEFDKIS------------------KGKCKTFIVKPEASCQGRGIFLTRNLDDL-----NSTDHYVVQRYLHKPYLID--GLKFDFRIYVLLADPMRIYIFKEGLARLATEEYEADNLDNLCMHLTNYAINKDNPNFEFNEDEGHKRSLTSVMELLKNQGHDI--QKLWDQIKDIIIKTIISAQPTLSHHYKSCQCFEILGFDVFLDAHLKPWLLEINHTPSFTTPLDSLIKKNCIRDALTLMNSTVKARN............ 459
100 0.000e+00UniRef50_A0A1J4JGX3 Tubulin-tyrosine ligase family protein n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4JGX3_9EUKA  ali  22  18....IFFNVENTQYPSIPR-CGKRLGWKTTESTVKN-ILFWCDNNVGVEFCL--NMQPWQFVNHFPGTFSISRKVELARNIEKMQKL------FPKLYNFHPLSFTLPMQALDLKQYMQTCPQ-------------------SKRTFIIKPDLGAQGKGIFLVMDPE----VVDEYTESAIAQRYIS-PCLLE--GLKFDFRIYALMSSPLRVYIFTEGMTRFCTEPYKPSNLKDVYRHLTNYSVNKKNENFQKNPDSGHKRSLTSVFHELELNGFDVKYAQ--SQIDQLIVLTILSAQRYIAHNYRTSRCFEILGFDVMLGKNLKPWLLEVNHSPSLESPFDKELKDNLITGALKIMFDPSFKKKVTNHQR...... 368
101 0.000e+00UniRef50_L1ITD2 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1ITD2_GUITH  ali  22  1.................VRNAFRRAGF--LPTSSNNFNVLWGKPLKIAEY---KELCEYQKVNHFPGTYLLGRKDNLARVCNKFRRV-----FGSDSFQYLPKTFVLPGERTELL----------QDYEEWKGKLKKNDCDIS---YIVKPPAGCRGIGIRLISDPNQIKEKAV-----CVVSRYISDPFLI--NETKFDLRIYVAITSPLRVYVHENGLARFCTVKYSRKTRKNRFRHLTNYSLNKQNPNFVKNDDEGHKWGLKAVWKWMRERQMD--VSTVMGKIDDLILKTLLSIEVQINTNMQRNNCFELFGFDVMLDSNLHPWLIEVNTALSLASPLDKSIKNQLVTEVLNMV.................... 324
102 0.000e+00UniRef50_A0A1R2C8G9 Uncharacterized protein n=7 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2C8G9_9CILI  ali  22  5....VIVSVANTQYDVITEVTNEMKWKVNNDTGDMNFDIFWQDNALTPD--QLSQLKSYQRINHFPGMYAVARKDHLGKNLKAMKYA------FPNTYNYFPPTWVLPKDLADLKNQFNKTFICKPELPKDLADLKNQFNEKRAKTFICKPEASSQGKGIFLTRKLEEI-------PERCVVQRYLHKPYLID--GLKFDLRVYVLILDPLRLFIHKEGLVRLATEPYTTSNLGEMCMHLTNYAINKNSSKFQSDDYTGHKRSLSKFIEKLKEKGENT--EALWADISDMIVKTMCVAQPLLAHLYRSSQCFQILGFDIFLDNTLKPYLLEVNHTPSFTTPLDLQVKKAVIGDTLRML.................... 379
103 0.000e+00UniRef50_UPI000947E5A9 uncharacterized protein LOC109476679 n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947E5A9  ali  24  641................................................................................................WNTFIQQYYTLVHDCGTLSDSDVDIDRCVDTLEQFKEAWPQCQIDGTTNMWIVKPGAKSRGREIKVMNKLEDICKLVESKEGKWVVQKYIEDPLLIH--NTKFDIRQWFLVTDPLTIWFYKDCYLRFCSQEFSLENFHEA-IHLSNNSVQKNYSPRASNIPANLMWHSKTFKEYLRSDGNGDMWESLYPGMRQAVIYAMEASQDMIEGRKG---SFELYGADFMLDTDLNPWLIEINSSPCMSTTITAEMCASVLEDTMKVVL---DRRSDKNCDTGRFEL. 923
104 0.000e+00UniRef50_A0A2T7NTD7 Uncharacterized protein n=8 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NTD7_POMCA  ali  26  571...............................................................................................QWEDFIKWYYVMAHEDGMIPAISQRTLTCVESLNRLRTKCPQFEMDGTHNVWIVKPGAKSRGRGIFCYNRLEEMLKLVNSKDGKYVVQKYMERPLLIY--NTKFDIRQWFLVTSPLTVWFYQESYLRFCSRQFTLENF-DQSIHLSNNAIQKYCRNGPRSLPDENMWTHEQFKDYLRQHKKKAWDEIIYPGMKQAIICSLLCAQDLVECRKS---SFELYGADFMLTEDFQPWLIEINSSPSMSTSVTAKLCHKVLDDTIKVVI---DRRSDKNCDVGSFEL. 857
105 0.000e+00UniRef50_A0A077ZPA9 Tubulin-tyrosine ligase family protein n=2 Tax=Oxytrichidae TaxID=57506 RepID=A0A077ZPA9_STYLE  ali  21  81...........TQYDVVKEVGKMIFNYHLTKNDQKDWDIAWFDGAISL--KLLQRMWPHQRTNHFPGMYNLARKNCLGRHLMRMQK------WFPTDYDFFPQTYMCPTDYKEFKSQIT---------------------AKRNKTFIVKPEASCQGKGIFLTRNFEDL-----DPNEHYVVQRYMHKPYLID--GYKFDLRIYVNLANPLRIYIYKDGLARFATVPYTPQNLSNLFMHLTNYAINKDSENFVVNDDVGSKRSFTSVLRKIAEEFGEEKCEEVFEGIKDLIIKTLCIAQPYLQHLYHSCQCCQVLGFDVMLDHTLKPQLLEVNQSPSFTTPLDYKIKKALITDTIKLWNLSIKRKLRTKGNKR..... 426
106 0.000e+00UniRef50_A0A1R2CJU1 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CJU1_9CILI  ali  23  101...YRVFNTEN----KLVRTILENSGFKYT--ESHIWNVLWIG--KSAQAYLYEDLNPYQRINHFPNSFEITRKDKMCLNLMAMK------AKFPNDYDFFPDTYIIPKVIGDF-TLKFYEQDCQ---------------------WIVKPCNSSQGKGIFILESLNAL-----DLDGGCIVSKYIENPLLI--NNLKSDLRLYVLVSSPLKIYIYEEGLARFACEDYTADS-SNKFIFLTNYSINKKSDKFIPNDNIGHKWSFSAFLKEMAKLGYDT--DLVIKRIYDLIIKTIISIENLVVDSVRKFNCFDIFGFDVLLDQELKPWLLEVNLCPSMNTPLDLYIKSNLIADAFNLIGIRAFDRKKESVSK...... 437
107 0.000e+00UniRef50_A0A2D0RX62 tubulin monoglycylase TTLL3-like isoform X1 n=22 Tax=Euteleostomi TaxID=117571 RepID=A0A2D0RX62_ICTPU  ali  23  284...............................................................................................QWANFIHSYYLVIHDGVVLEGCSEYSERCQSMLERMRKVCSQLEIDGVNNIWIIKPGAKSRGRGIVCMNRLDEILGLVNSKDSKWVVQKYVERPLLIH--GTKFDLRQWFLVTDPLTVWFYRDSYLRFSTQLYSTHRL-DSSVHLCNNSIQKYFQPSAGRDPSESMWSSAEFRSWLAASGRGGLWEDVLPGMRRALIQTLLTAQDSVEPRK---ASFELYGADFLLGCDLQPWLLEVNVSPTMSTAVTARLCPAVQEDTLRVVL---DRRYDRNTDTGGFQLI 570
108 0.000e+00UniRef50_H3BCC6 Tubulin tyrosine ligase like 1 n=2 Tax=Sarcopterygii TaxID=8287 RepID=H3BCC6_LATCH  ali  24  1.......................................................LSDDQLVNHFPNHYELTRKDLMVKNIKRYRKELEKEGNPLAEKDENGKYVHXXXDHLVQVDFVPVTFMLPADYNLFVEEFRK----NPSSTWIMKPCGKAQGKGIFLINKLSQIKKWSRSSKEAYVISLYIDNPLLI--GGKKFDLRLYVLVTTPLKCYMYKLGFCRFCTVKYTPSTLDNMFVHLTNVAIQKHGDDY--NHIHGGKWTVSNLRLYLESTRGKEVTNKLFDDIHWIIVQSLKAVAPVINNDK---HSFECYGYDIIIDDKLKPWLIEVNASPSLSSSTDRILKYNLINDTLNIV.................... 348
109 0.000e+00UniRef50_A0A146X7B4 ARPC4-TTLL3 readthrough n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146X7B4_FUNHE  ali  23  122..............................................................................................EQWAEFINSYYLVAHGGAHIERSEHLVSSCKAMLQRLEKVSPQLGIDGAQNIWIIKPGAMSRGRGIKCAKRLDHILRLVDTKESKWVVQKYIEKPLLIH--GTKFDVRQWFLVTDPLTVWFYKKCYLRFSTQLYSLDTL-DSSVHLCNNSIQKHLRPSQQRHPADNMWLDDQFKAFLASQGKEALWETVVPGMKTTIIHAVQTAQDLMESRK---NTFELYGADFMLDLSLHPWLIEINASPTMSTSVTAQLCAAVQEDTLRVVL---DRRVDRAANTGDFQLI 409
110 0.000e+00UniRef50_A0A1X0NV49 Putative tubulin-tyrsoine ligase-like protein n=1 Tax=Trypanosoma theileri TaxID=67003 RepID=A0A1X0NV49_9TRYP  ali  23  306....KVVNLFLCKY-SLLRTIAEEHGFKETEEDLEKFNLVWSDTVLPLTRLV--RLANWQRTNHFPSMHLLCRKGHLGTTLGRMRKLL------PTHYLFYPRTW-----------------SLRSERAQFMRFITALRAKKMSKFFIMKPNSGCQGRGIVVTRDPLNAVDDL----DNYIIQEYIRKPLLLE--GRKFDLRVYVLLTSIPSIFLFNDGLVRLCAEIYTDSNVRNACKHLTNYAVNKQSPEYVFNDDAGNKRNFKFFNEWLESSGQDP--DEFWERVAHVICKTILVAQPQIANVYNSCNCFEILGFDILIDSKMKPWLMEVNHTPSLATPLDYNIKHALVTEVWNILIKTTDRKRDEKKVRDEFVQ. 669
111 0.000e+00UniRef50_UPI000D09C486 protein monoglycylase TTLL8 n=3 Tax=Simiiformes TaxID=314293 RepID=UPI000D09C486  ali  23  300...............................................................................................EWEDLTQQYYSLVHGDAFISNSRNYFSQCQALLNRITSVNPQTDIDGLRNIWIIKPAAKSRGRDIVCMDRVEEILELAASRDNKWVVQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDKL-DSAIHLCNNAVQKHLKNDVGRLPAHNMWTSARFQEYLQRQGRGAVWSVIYPSMKKAIAHTMKVAQDHVEPRK---NSFELYGADFVLGRDFRPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVAVD-------RSCDIGNFELL 582
112 0.000e+00UniRef50_A0A2A2KRA2 Uncharacterized protein n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2KRA2_9BILA  ali  20  76..KFKMTFKLSKCDIKLVRTLMNCHGFTQCSTKRLDVNFIWT--AGPYKLQHMRMLKPWQRLNQFPRSLELTRKDKMCDNIARMQRM------FPKNYNFIPEFYVLPRDAEKFRLCTE-------------EMQANGSGDAQDKLFIVKPCNSSRGQGIFFASQYSDV-----PPDSPLLVSRYLSHPYLID--GHKFDLRIYVAVTSPLVTYVFYDGLTRLASAKYDPSSSHDEFVHLTNYSINKNNKQFIRNEDLGHKWTLGAFLRYMEREGKDP--KLLMLRIEDVIIKSLLSVQGKIASICRTATNFELFGFDILVDQNLKPWLLEVNLSSSMACPLDSLVKSQLMADLLNLAIPLIDRK............. 424
113 0.000e+00UniRef50_F0X1X2 Tubulintyrosine ligase family putative n=3 Tax=Albugo TaxID=65356 RepID=F0X1X2_9STRA  ali  24  483...............EIVVAALRKLGWEEHPSGKTTWNLLWTWSKPNVERKT---LLSWQRVNHFHNSRALTRKDYLKKSIAKYIVMGGKLR--AEYKNLMPKTFLLPQEYVAFIDA----------YHKMHRKCESNAQSPEANIWIMKPVASSRGRGISLVNDLNQLV-----YGENVVIQRYVHRPLLI--NGYKFDLRLYVLVTSPLEAFLYQKGFVRLCTRLYDTDNLLDLFIHLTNSSVQKTNSHDEVHHDGGTKKPLDYLWNWLAQSGAN--VQNVKDSITRVVLLSLLCGEDHITH---QVNSFDLYGFDILLDEDLKPWLIEINSSPSMANDLDFQVKDSVMYDTIKLVNPLRFDRHR........... 831
114 0.000e+00UniRef50_UPI000DC9FFB7 tubulin polyglutamylase TTLL5 isoform X1 n=3 Tax=Sipha flava TaxID=143950 RepID=UPI000DC9FFB7  ali  21  52...FKLLNVDS----KLVLTLLANHGFREVNSDSNDYNLLWSNNHV--NTKIISSLRSYQRVNHFPRSCELTRKDKLYKNIEIMSHRNGIKNF-----SFVPETYIMPKDYNRFISNQYRH----------------------RGLWIIKPFDLSRGRGITIMD--YSFKDTQSSLKENVVVAKYIDNPLLV--NGFKWDLRLYVLVTSPLVVYLYEEGLVRFATVKYDRSRINNRRMHLCNYSVNKSSPSYIRNSDPGHKWSMSALLNHLRKEYL-INTETLMREIEDIVIKTIMSATAQMLPAPHNQNCFELYGFDILVDNKLKPWLLEVNLSPSLGIDLDSRIKSSMLCDLFTLIIPIVDP.............. 391
115 0.000e+00UniRef50_A0A1B6H008 Uncharacterized protein n=2 Tax=Hemiptera TaxID=7524 RepID=A0A1B6H008_9HEMI  ali  23  329............................................................................................WDHQWDQFLTWYYQLAHEHANFLPATDTQRKCKMTIESMRPHWPQMQLDGTSNLWIVKPGAKSRGRGIQVMRKLEDIVSRIGSKDPRYVIQKYIERPLLIY--NTKFDIRQWFLVTSPLTIWMYKESYLRFCSQLFSLSNMHE-SVHLSNNAVQCKYKNAKRDLPDENMWDCYTFQTYLRAIGQADLWETIYPGMRESITGTLLAAQEHMEHRK---NCFELYGADFMLTDDMVPWLIEINSSPCMSTSVTARMCSQCLEDVIKVVI---DRRHNKHADTGMFEMV 620
116 0.000e+00UniRef50_A0A0L0DLS4 Uncharacterized protein n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DLS4_THETB  ali  20  142............KTPHVVKRAMMRAGVQVVKRTSRAWLGTWGPRRK---DGIHRKVSQFTRINHLPGSSAIGRKDRLYLTLRRM-----ASAHPGGDYAFFPLTYLLPQGEASLR--------------------RKMRTLKGGTPWIVKPRASARGNGIQVISRASEV-----PSGKSCIVQRYIKSPLLI--NGTKFDIRLYVAVMSPLTVYLFDDGLVRFATVKYAPDSWSNRFMHLTNYSVNKHNTEYKSDESQAHKWSLAALKQYFAEHGIGG--DEVWERVDDLVVKTIIAMESEVAGVRHRSTCYELFGFDVFLDSKLKPWLIEVNISPSLHTSLDRRIKDAMVCDLFNLA.................... 478
117 0.000e+00UniRef50_V8PDX0 Putative tubulin polyglutamylase TTLL2 (Fragment) n=2 Tax=Sauria TaxID=32561 RepID=V8PDX0_OPHHA  ali  24  4....................................................HQSIKPWQRLNHYPETIRITRKDYLARHLKRMKGIYGTT-----LYEFSPVAFIMPNDYIKFITEYSKERQIP---------------GKKLSYWICKPVDRSRGRGILIFQDIKDFV-----YDCMVIVQKYISNPLLI--SGYKWDLRIYVCVTSPLTIYIYEEGLVRFATEKFDLRSLDNIYAHLTNSSINKFGPSYRKDKDSGCKWTFSRFRAYLRSCHVDDL--LLWKRINHIVILTLLAISTSVP---FTSNCFELFGFDILVDEKMKPWLLEVNHSPGLRLDCDVAVKRKLLHDIVDLLNDTLRKSRGTNRRISCF... 305
118 0.000e+00UniRef50_I3KSK7 Uncharacterized protein n=48 Tax=Euteleosteomorpha TaxID=1489388 RepID=I3KSK7_ORENI  ali  25  285...............................................................................................QWAEFLKHYYMVVHKGKVIRGSSVFVERCQDMLTRLQAVCPQLDTDGLNNIWIIKPGAKSRGRGIMCMNRLDEILALVDTKESKWVVQKYLERPLLVH--GTKFDLRQWFLVTDPLTVWFYKECYLRFSTQPYSTKTL-DCSVHLCNNSIQKHFQPSRNRHPGDNMWSCSQFRSFLQREGRETEWESVIPGMQQAVVHALQTAQDLVEPRK---ASFELYGADFMLGRDLRPWLLEINASPTMSSTVTARLCPAVQVDTLRVVL---DWRTDPSAYTGGFKLI 571
119 0.000e+00UniRef50_W4YUS2 Uncharacterized protein n=6 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4YUS2_STRPU  ali  24  581..............................................................................................EQWDKFITEYYQLTSERGSIDDVTMHYVYCESLLNRLRSILPQLDMQGLRNIWIVKPGAKSRGRGIMCMNKLDEILKLVGKKEGKWIVQKYIERPLLIYQ--TKFDIRQWFLVTDPLTIWWYDACYLRFCTQPFSLDDLA-QSIHLSNQSIQKNYDNAVERDENDNMWDSDTFRKYLDDRGFEGLWESIVPGMKKAIVDSMLCAQDAMEARK---NSFELYGADFMLTDDFLPWMLEINASPAMSTPVTEEMCASVIEDTMKVVL---DRRHDKNCDTGKFQVL 867
120 0.000e+00UniRef50_A0A078AR45 Tubulin-tyrosine ligase family protein n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078AR45_STYLE  ali  20  237....LTMNVSQTKYYVVRYVAKNIYNMRLTHNDEEDWDICWQDGAVQCER--LYKMKPYQRINHFAGMYALARKNHLARNLGRMQK------KFPDDYKFFPQTFLLPSEYSDFRNLFQNKK-------------------KMNKTFIVKPEASCQGRGIFLTRNLDDVNPY-----DHYVIQRYLHKPFLIE--GLKFDLRIYVFLVDPLRILMYKEGLSRFATETYQPPNNNNLYMHLTNYAINKTSSKFIQNDDVGHKRSLTYVWRYLEELGHD--VEQVQKDVRQTIIKTICAVQPQLAHIYKSCQCYEILGFDIFFDANLKPWILEVNHSPSFSTPLDFKIKKNLISDTIRLL.................... 574
121 0.000e+00UniRef50_A0A1S3CU55 tubulin polyglutamylase TTLL4-like isoform X1 n=3 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S3CU55_DIACI  ali  22  378...KHLKWKLSPITPVVVRKTILNTGYRLVRSESPEWCGTWGKHMKSLSF---RTLKESQKINHFPGTFQIGRKDRLWKNLLKC-----MMKYGDKEFGFTPRTYVLPGDDKRLRASWER--------------------NCGNIKWIVKPPASARGIGIKVVHKWNQI-----PRKMPLVVQKYLDDPYLI--NDTKFDLRLYVLVTSPLRIYLYDNGLVRFASVKYSANSLQDRYMHLTNYSINKMSSSYTQNEDHGHKWTLKSLWSYLETEHH-VDVAALQDSIVDVVIKTMICGEHSIANQQSRYCSYELFGIDILLDSKLKPWLLEVNISLHSSSPLDLAVKGPLVQDLFNIV.................... 726
122 0.000e+00UniRef50_A0A0R3W0Y3 Uncharacterized protein n=1 Tax=Taenia asiatica TaxID=60517 RepID=A0A0R3W0Y3_TAEAS  ali  19  95.FRKLLHWRPSLVTPVVVKQALKKAHFRATDDESSDWIYYFGKHLKPDVFLTIR---DYQKVNHFPCSFHLGRKDRLWRNISAMQKRFGMENF-----NFTPLTFCIPADLEKFKAVW--------------------DTEGAEHQWILKPPASARGLGVRVINKWSQI-----PKKRPLIVQRYLNNPYLI--NNSKFDLRIYVFIYSPLIVYVHEDGLVRFASHIYTNSPRGNRYVHLTNYSINCQNVDYISNASDGHKWSLRAFWAYLRS--HSVEPEPVWSSIKDVIAKTCIAIEPHFKNCKSPYSVQELFGFDIFLDANLKPWVLEVNVSPSMHSPLDSKVKSIMIKDMLNLTFNLPSPRDISNRNTR..... 455
123 0.000e+00UniRef50_A0A0R3WHX1 Uncharacterized protein n=1 Tax=Hydatigena taeniaeformis TaxID=6205 RepID=A0A0R3WHX1_HYDTA  ali  23  27.....................FQNRNWVEVDP-SDHWNIFWASTG---SALVIGYLK---KINHFSNHYELTRKDLMVKNIKQYRKQLFKAQNPVDEHDFIPTTYLLPQD-----------------YTLFTEEFRR----NPRATWIIKPSARSRGVGIFIVNRLSQIKKWAREGHTPHVA--YIENPLLI--GGKKFDLRMYVLVTSPLKCYVNKLGFCRFCTVRYDRKDLGNMFVHLTNISIQKHAADYNSRH--GGKWSIFNLRLWLEGTRGKEVADKLFNEIYWMMYHSLQSVANVINNDR---HCFECYGYDIIIDDTLKPWLIEINASPSLSTQLDRIMKYKLVDDVLNIVIPIPDTRISKPTKDGDFEVL 369
124 0.000e+00UniRef50_A0A0L0D867 Tubulin-tyrosine ligase family protein n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D867_THETB  ali  25  598LFYRISSAGHEEVYTIVAESLATMSGWAELPEDSGLWNLLWTWGRPKAD--VWSHLVAWQRINHFPNTSALTRKDLLKKSIERQARLGGR---MARVFDIVPTTYILPSEYAKFVEDFARS----------------GAKNKSGNVWIMKPAGLSRGRGIFLFNDIAQVR-----HGEPVVVQKYIPDPLLLH--GRKFDLRIYVLVTSPLEAFVYKEGFARVASQLYSPDTIANNVMHLTNTSIQSEASTSYSAEWGGSKCSLKFLAKELASSG--VAFETLWKGICSVVLKSLFAVKDTIDS---QPNSFEVFGYDIMFDSSLKPWLIEVNSSPSMTCPLDVRIKGSMISDTLKLVNPLRFNRSRLK......... 950
125 0.000e+00UniRef50_UPI0009B43CB2 tubulin monoglycylase TTLL3-like isoform X1 n=2 Tax=Percomorphaceae TaxID=1489872 RepID=UPI0009B43CB2  ali  22  330..............................................................................................EEWAKFIDNYYLVVHGGAELENSEHFVKCCETMLQRLEQVSPQLDIDGIHNIWIIKPGAKSRGRGIKCARRLDQILRLVNSKDSKWVVQKYLERPFLVH--GTKFDVRQWFLVTDPLTVWFYKKCYLRFSTQPYSLDTL-DSSVHLCNNSIQKHLGPSQQRHPAHNMWSDDQFRTFLSNRGCKVQWETVVPGMKKAVIHALQTTQDLIESRK---NTFELYGADFMLGRDLRPWLIEINCSPTMSTPVTARLCSAVQKDTLRVIL---DRRINRTANTGDFELI 617
126 0.000e+00UniRef50_A0A1I8D0C9 Uncharacterized protein n=1 Tax=Rhabditophanes sp. KR3021 TaxID=114890 RepID=A0A1I8D0C9_9BILA  ali  22  306..........SNVRNGLIKSIFYSHGYTECSSTNNRVNIFWSRTHVKPHH--LRSLLPWQKVNHFPKSAELTRKDRMSENMTKAVYTHGPA------YNVFPATYCLPRDLDSLKLKME---------------------QDPESIYIVKPPASSRGRGIHLINSADGI-----PSEKDSVVSLYLKNPYLIK--GLKFDLRFYVLVTSPLICYLFDEGLTRFASQPYNLDDLDKIFVHLTNYSLNKDSESFEKNEDQGHKWTISAMLRYLKEQDG-VDTSLLMARIEDLIIKALLSVQNTISAAYHPQNCFELLGFDVMIDEDLKPWLLEVNLTPSLDSPLDTKIKSKLVVDSLNIA.................... 631
127 0.000e+00UniRef50_G5BX86 Tubulin monoglycylase TTLL3 n=2 Tax=Sarcopterygii TaxID=8287 RepID=G5BX86_HETGA  ali  24  413................................................................................................WALFLRRYYQVVHEGAELKYLDTQVQRCEDILQQLRAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVDVKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQLFSLKNLDN-SVHLCNNSIQKHLENSSHRDPMDNMWSSQKFQAHLRAMGAPDAWSTIVPGMKAAVIHALQTSQDTVQDRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTPVTAQLCAGVQADTLRVVI---DRRLDRTCDTGAFELI 698
128 0.000e+00UniRef50_A0A0A1WFU5 Tubulin polyglutamylase TTLL6 n=2 Tax=Schizophora TaxID=43738 RepID=A0A0A1WFU5_ZEUCU  ali  24  123........VSNSRYSMIGR-VSKTLGFKVV-KEAKLWNILWTDT--LPGVELYKSMKRFQQINHYPGMMEICRKDLLSRNLNRMLKL------FPRDYKIFPKTWIFPADYGD------------------ALNYANNNYKNKARTFIIKPDSGAMGRGIWLTNDLKSI-----NPSERMICQTYINKPLLID--GYKFDLRVYTLITSPLRIFVYNEGLARFATSKYTTENSCDLFMHLTNYSVNKRSSQYDDNDDCGSKRKFCAINNWLRRR--NYEVDEFWGKIDDIIIKTVLSAWPMLKHNYHACACFEILGFDILVDSKMKPYVLEVNHSPSYHTHVDRQVKKALIRDTLLMVSPLADKKTD........... 462
129 0.000e+00UniRef50_A0A2A6C1P0 Ttll-5 n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6C1P0_PRIPA  ali  24  173...............KLIKTILYSTGFTQVSARNPNFNILWT-----------------QRVNHFPRTGELTRKDRLYENIARSKALFGATPGGP--FSFIPEFFVTPRDMDRLTRAM---------------EDRRSRSSGHDASFIVKPVAGSRGKGIFLAKKPDEI-----PLASPLLVSRYISAPLTV--NDHKFDLRVYVAVTSPLIAYVYTEGLTRLASEKYSRHKEDDEYVHLTNYSVNKNSKNFVRNEDVGHKWTLGALLRRLEEKGIDE--RLLMLRIEDLVTKSLLSVQSTVSAACRSSVCFELFGFDVLVDEQLKPWLLEVNLSPSLTCPLDSLVKTKLICDLFNLT.................... 487
130 0.000e+00UniRef50_G4VAE4 Tubulin tyrosine ligase-related n=1 Tax=Schistosoma mansoni TaxID=6183 RepID=G4VAE4_SCHMA  ali  22  299.YRYQLLWRPSAITPNVVKRILKRSNFRITLKSNE-WIGYYGNHLKPFGFRPIRE---YQKINHFPGSFQLGRKDKLWINLNQLR-----SRFGKKSIDFVPRTFCLPGDLKSLKEFWTHHENTSKKSSNDEALFHFRPR------WIMKPPASARGIGVKLIRGWSDI-----PKQRRVIVQSYINQPYLID--GKKFDIRLYVFVASPLRAYVYREGLVRFASQKYSTSQLRNRFVHLTNYSVNKYNKT-EETFASNHKWKLSTLWSYLTERGADVL--NLWSRIVDIIFKTLSSVVSCIANCRRRASVYELFGFDIILDADLKPWLLEVNVSPSLHTNLDDEVKTAVVKDMFNI..................... 640
131 0.000e+00UniRef50_UPI0009E58CE6 LOW QUALITY PROTEIN: tubulin polyglutamylase ttll6-like n=2 Tax=Scleractinia TaxID=6125 RepID=UPI0009E58CE6  ali  21  4.....VVFRLCEKSPDILREVCLERGWEEYNEDDGNWNLWWKTQGFTSGEFEHCR--PWQRLNHFPKSTHITKKDGLARNLRRMR-----TSYGGSMFEFFPLTFILP-----------------NEYKKFVAEFSKQDGAQQSNYWICKPTEQSCGRGIFIFQDLHDL-----TYDCAVVVQKYIIKPFLI--SGYKFDLRLYAIVTSPFRLYIYHEGLVRFSTERFDLSSLDNRFSHLTNTSINKTGPQYKESIGTGCKWTLGKLRHYLHK--HDIDDRLLWHRITSIIIITLLSQVQEIPSN--SSNCFELFGFDILIDEKLKPWLLEVNFSPALGNDCDELVKKPLLNDILELNFTEVDVKRGKKEKENN.... 349
132 0.000e+00UniRef50_A0A0A9ZGF3 Tubulin polyglutamylase TTLL6 n=1 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9ZGF3_LYGHE  ali  22  67........CTTSCCYDVVRRVASEFGLVE---NPEQWHVYWTDMFISVEKFMG--MKYFQRVNHFPGMVEICRKDLLAK------KLVSMANRFPSDFNFFPKTWCLPNELIQAVNFSKLY---------------------KNKMFIVKPCYGSKGRGIQVISDLKLIKNL-----DRMICQVYIHKPFLID--GYKLDFRVYALVTSPLRLYVYNEGIARFATRKYNESNFSDRFMHLTNYSVNRRNSLFNADGDEGSKRKLSTVNEWMKSHGYD--VDHIWASIDDSIIKTILMVVPTLRYCYKVCACFELLGFDFILNRRLKPYLLEVNHSPSFHTPVDHEVKEPLLRDTFKILDLNKDNARMPE......... 401
133 0.000e+00UniRef50_UPI000D71F281 tubulin monoglycylase TTLL3 n=1 Tax=Alligator sinensis TaxID=38654 RepID=UPI000D71F281  ali  27  153................................................................................................WEEFLRGYYCVVHEGAPLELSPAHXXXXXXXXXXXXXXXXXXXXXGDRNIWIVKPGAKSRGRGIVCMARLEEMLRLVNCKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTIWFYRDSYLRFSTQPFSLHNL-DAAVHLCNNSIQKHYEASLQRHPPGNMWSSQQFQEHLQQAGAGAAWQDVMPGMKVAIIHAVQSAQDVVELHKG---SFELYGADFIFGEDFKPWLLEVNASPTMSTAVTSRLCAGVQADTLRVVI---DRRHDRTCPTGAFELI 438
134 0.000e+00UniRef50_A0A1W2W2E6 tubulin polyglutamylase TTLL7-like n=4 Tax=Ciona TaxID=7718 RepID=A0A1W2W2E6_CIOIN  ali  21  65....ITANVTNCKYD-LVRSSLEAVNIFILKEESQAAYLFWFDSVVPMEK--FQEMKAYQRINHFPSMGEICRKDYLARNMAKMHRAR------PTEFNFVPRSWILPSEYNLLQ---VYAQDCRKKKRKF-------------PTFIQKPANGAMGNGIQLFRNAEKI-----QPCEQTIVQEYLDKPLLLD--GYKIDLRLYCLVTDPLRAFLYKDGLVRLSTEKYTEQNMDQMFMHLTNYSVNKQNEKFHSDYDRGSKRSIKSLLIYLKNSGYDTAT--LWRNICDLVVKTLIVVSPHILHSYRMCRCFEILGFDIFLDRKLKPWLLEVNRAPSFGGDIDRDIKGGVIRDALRLVNIRASDKKRNLANQ...... 420
135 0.000e+00UniRef50_J9K3V9 Uncharacterized protein n=60 Tax=Opisthokonta TaxID=33154 RepID=J9K3V9_ACYPI  ali  23  19.....................FEKRGWMHVGPEDE-WHFYWTSCRSLFNADKNYRLKDDQIINHFPNHYELGRKDLLIRNIRRYRRELLKSGTSIAKCDFIPSTYVLPVD-----------------YNLFLEEYRRNP-----GTWIVKPCGKSRGSGIFLIDKLSQLKKWSKEKKDTYIISRYIENPLLI--SGKKFDLRLYVLVTSPLKAYLFKFGFCRFCSVKYNLTDINCLFAHLTNVSVQKEGDDY--NNIHGGKWSTENLKLYLTSTRGEKRTRKLFDDISWIIVHSLKAARSVMSHD---THCFECYGYDIIVDEDLKPWLIEVNSSPSLTTSSDHILKSKLIDSIVSVVLPIPNCRWDKNPS....... 367
136 0.000e+00UniRef50_Q1ECV4 Tubulin monoglycylase TTLL3 n=15 Tax=Osteoglossocephalai TaxID=1489341 RepID=TTLL3_DANRE  ali  24  285...............................................................................................QWKVFLQNYYLVVHEGINIEGCEYYLERCKCMLEQMRQVCPQMENDGICNIWIIKPGAKSRGRGIMCMNKLDDMLGLVDGKDSKWVVQKYIERPLLVHD--TKFDVRQWFLVTDPLTVWFYRECYLRFSTQPYSTHTL-DSSVHLCNNSIQKHYQPSPDRLPAECMWSCSQFRSWLAASGRAALWKAVVPGMQKAVIQTLLTAQDSVEPRK---ASFELYGADFMLGRDLRPWLLEINASPTMSTGVTARLCPAVQEDTLRVVL---DRRSERNTDTGGFQLI 571
137 0.000e+00UniRef50_A0A267DUK3 Uncharacterized protein n=4 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267DUK3_9PLAT  ali  20  56.....VGANLSATKFDIIYLAVERLGFSVCPDEDTPY-LIWSDLGVPPDRIS--ELRAHQRINHFPGMSEISRKDLLSRNMAKLARVL------PKEYKFTPRTWCLPG-----------------EYSSFLQHSRELRKVGKLRSFIYKPANGAMGHGIRIYKNGEQVPNGGFDTTGPAIVQEYIAKPLLID--GFKCDLRIYVLVTSPLRVYFYNDGLLRLSTEKYDPQESDTLYMHLTNYSVNKRSENYAKGDDDGSKRSIRFLNEYLQKR--DYDVPLMWRNIIDLLVKTIIAVQPHLLQHYRMCRCFEILGFDVLLDHKLKPWLVEVNRSPSFGAPIDRRVKLGVLDEALRLLIRASDRARHANAQK...... 422
138 0.000e+00UniRef50_A0A225V5E3 Tubulin-tyrosine ligase n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225V5E3_9STRA  ali  24  57...............EIVTEALHHGGWEEHPSGKTTWNLLWTWSKPRVERQT---LLVWQKVNHFQHAKALTRKDCLKKHIGKYIAAGGRLR---QAFDIIPPTFLLPKEYVAFVQAFQERS----------ERLKQSGASETKNIWIMKPVALSRGRGISLINDLSQVI-----YGEQMVIQEYIAAPRLLD--GFKFDLRLYVLVTSPLEAYLYNEGFVRLCTQPYEDNDINNIFVHLTNSSIQKDNENSNNDNESGTKTTLAYLWRRLAAEG--VDVEQVKRNIEEVVIKALLCGEDHIPY---QVNSFDLLGYDILLDADLRPWLIEINSSPSMARDLDYQVKDAMMVDTLRVVDPLHFDRAK........... 415
139 0.000e+00UniRef50_K3W7H2 Uncharacterized protein n=16 Tax=Oomycetes TaxID=4762 RepID=K3W7H2_PYTUL  ali  20  12...KKVRINMTLCKYEVVRKIARDRGWQMITDESDKCNIHWID--VPDFVNTFKILLPYQKVNHFPGMSNLARKSKLARNFERMKKL------FPDEYNFCPKTWILPFDFHDFQTHFN-------------------ADGVSQKTFIIKPDHSCQGRGVFLTRNMSQI-----NRSDILVAQQYIARPLLI--AGKKFDLRIYVLVSSPLRVYLFKDGLVRMCTADYNAENMEQRFMHLTNYAVNKHSNNFESNDGNGSKRSLRWFFAWLKETYEEYRVDALWEKIGDICLKSILAVQPTLAQEYHMYNSNDILGMDVLVDESLKAWLLEVNHLPSFGSPLDWNIKERLISQTFDILNISAEDKDRYDAEQ...... 416
140 0.000e+00UniRef50_A0A0G4J143 Uncharacterized protein n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4J143_PLABS  ali  21  5..............NRILRALLHQAGFTRTYRGHQ-WDLHWTGRAVVRNE-VYRHLRAGQKISRFPNVEQLTRKDSLFMNIARMQRLHAAGNPF----CFIPETFLLPMDADKLDRAY-------------------HSLANRSSLWIVKPHAASQGRGIFVTRQLTDI-----PHNAHLIVSRYIAHPYLI--NGRKFDIRLYVAVTSPLRIYVHEEGLLRFATEPYDIKSLDNPFVHLTNYSINKNSAAFIRNHDAGHKWSLTALRRHLRARGLND--RSVFNDIHQIILKTIVSIEDQVNAAVHRDSCFCLLGFDVLLDATLRPWLLEVNGHPSLSSPLDYRIKSTILADLLTML.................... 354
141 0.000e+00UniRef50_A0A074T1C1 Tubulin-tyrosine ligase family protein n=3 Tax=Sarcocystidae TaxID=5809 RepID=A0A074T1C1_HAMHA  ali  22  1.......................................................MRPYQKINHFVGTNAISRKNYLARNLLRMKAYY------PQEYKFFPHTWSLPADLADFRCQFT---------------------GRRRKTYIIKPDASSQGRGIFLTRNIEDI-----NPTEHLVAQRYLHKPFLID--GLKFDLRIYVLLANPLRLFVHQDGLVRFATSPYTGKNLRDKTMHLTNYAINKSSSNFTPNKDPGHKRSLFHVLDHLKNEGHD--VDALLKEIDECLCKTIIAIQPSLAHIYGSCKCFEILGIDIMIDHKLTPWLIEVNHSPSFTTDLDTIVKFKVIRDALVLLGLSSENRRNYHAQQRL.... 303
142 0.000e+00UniRef50_L1J165 Uncharacterized protein n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1J165_GUITH  ali  24  12......IKFKSLLSNTIHEVCTKRPGWKETDRD--DWDFIWADKDWIRMHFDEMRLSNTARVNHFRNHYELTRKDHMVKNFKRMISSLRREDRASEQYDFFPVTYLLPQDYGVFVEDFKRQSD--------------------RPIWIAKPTGKAQGRGIFLFTELKD---------------RYITNPYLV--GGKKFDLRIYVLVTSPLTVWLYRSGFARFSGFRYNRNQLKDTHLHLTNVAVQKTAPGYDR--EAGCKWLIDCLKRYMVSVHGQDAINQLFYEIQSLIIRSLQAVQKVIMNDK---HCFELYGYDIMLDDTLKPWLLEVNASPSLTADTDHELKCGMLD-DLLDVIDLEERRTGDEIQVGGFDLI 348
143 0.000e+00UniRef50_A0A0G2K2F9 Uncharacterized protein n=2 Tax=Murinae TaxID=39107 RepID=A0A0G2K2F9_RAT  ali  23  72..............................................................................................EEWNDLTQQYYLLVHGNASITDSRSYFAQCQALLSKISSVNPQTEIDGIRNIWIIKPAAKSRGRDIVCMDRVENILDLVTTKDNKWVVQKYIETPMLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDKL-DSAIHLCNNSIQRRLKNDKERLPCHNMWTSTRFQEYLQKRGGGTWGSIIYPSMKRAVTNAMRVAQDHVEARK---NSFELYGADFILGRDFKPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVVV---DRKLDRNCDIGNFELL 359
144 0.000e+00UniRef50_A0A0N4T312 Uncharacterized protein n=3 Tax=Chromadorea TaxID=119089 RepID=A0A0N4T312_BRUPA  ali  22  114..KYHLRFKMIKCNQALVKTILHSYGFEQCSSRNSNCNIIWTGSHLKPH--VLRSMASWQRVNHFPRSFLLTRKDKLYEYG------------IIKLSDFIPEFFVTPKDYQKFVDHFNAQSHGLK-------------------PFIVKPVASSRGNGIFIIQSPGGI-----PLGSPMLVSRYIENPYLV--NGYKFDLRLYVLVTSPLVAYMYSEGLARFASEKYSNKSYEQHFSHLTNYSLNKNNGKFIRNEDTGHKWTLGALLRKLQSNGIDT--NLLMVRVEDVVLKALFSVQGQIANVVHSKCCFELFGFDILIDSSLKPWLLEVNLSPSLSTPLDLQLKSSLVCNV........................ 439
145 0.000e+00UniRef50_A0A2Y9H227 protein monoglycylase TTLL8 n=10 Tax=Amniota TaxID=32524 RepID=A0A2Y9H227_NEOSC  ali  25  295..............................................................................................DEWKDLTEQYYSLLHGEAFISDSRNHFSQCQALLNKITSVNPQTEIDGLRNIWIIKPAAKSRGRGIVCMNRVEEILELVSAKDNKWVVQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLENL-DSAIHLCNNSIQKHLKNDKGRLPYHNMWTSTRFREYLQKRGRRAMWSVIYPAMKRAIANTMRVAQDHVEPRK---NSFELYGADFILGRDFQPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVVV---DRKIDRNCDIGNFELL 582
146 0.000e+00UniRef50_A0A1B6KRF3 Uncharacterized protein (Fragment) n=2 Tax=Hemiptera TaxID=7524 RepID=A0A1B6KRF3_9HEMI  ali  23  333............................................................................................WDHQWDQYLTWYYQVAHEHANFLPATDTQRKCKMTIESMRPHWPQMQLDGTSNLWIVKPGAKSRGRGIQVMRKLEDIVSRIGSKDPRYVIQKYIERPLLIY--NTKFDIRQWFLVTSPLTIWMYKESYLRFCSQLFSLSNMHE-SVHLSNNAVQCKYKNAKRDLPDENMWDCYTFQTYLRAIGQADLWETIYPGMRESITGTLLAAQEHMEHRK---NCFELYGADFMLTDDMVPWLIEINSSPCMSTSVTARMCSQCLEDVIKVVI---DRRHNKHADTGMFEMV 624
147 0.000e+00UniRef50_A0A2Y9S387 LOW QUALITY PROTEIN: tubulin polyglutamylase TTLL13-like n=1 Tax=Physeter catodon TaxID=9755 RepID=A0A2Y9S387_PHYCD  ali  23  90......INLTNCKYESVRRAA-QMCGLKEV-GEDXKWTVYWTDCSVSLER--VMDMKRFQKINHFPGMTEICRKDLLARNLNRMQKLY------PTECNIFPCTWCLPADYRDFQSYV---------------------RQRKTRTYICKPDRGSQGCGIFITQNPQEI-----KPGEHMMCQQYISKPFLID--GFKFDMRIYVLITSPLRISMYEEGLARFATMPYSHSNLDDICMHLTNYAINKHNENFVRDDAVGSKSYRTCFPQYLSG---------------------------------GTCACFEILGFDILLDHKQKPWLLKVNRSPSFTTNLDREVKDALLCDAMTLVLRGCEKRKLVEEDKQR.... 394
148 0.000e+00UniRef50_L1J4B8 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1J4B8_GUITH  ali  28  8....IYFKCSETRVPPVIRRVLLRKGWVEWDKDEELWSLHWKSGRFKLSDWDRC--LSHQRINHCPKSSNITKKDNLHRNIKRL------AGSYGPIFNFVPTTFVLPNEYVAFMREY-------------------AEREEEKPLWICKPSDSSRGRGIFLISDMSQLV-----YDQQYVVQEYIANPLLV--GGFKFDLRLYVLVTSPIRCYLYREGLVRFATEKYSKDSIANLFAHLTNSSINKFSPEHKDTVGSGCKWTLTRLRKYLSSAG--VDDSLLFERIKHIIILTTLALWPKIP---RQTSGFELFGFDVMVDSELKPWLIEVNSSPALATD..................................... 315
149 0.000e+00UniRef50_A0A1J1I438 CLUMA_CG007878, isoform B n=2 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1I438_9DIPT  ali  20  441.....LKWKLTTITPLLVRKVLLNTGFRLMKKPN-DWVGTWGKHMKSPCFKT---LHSYQKFNHLPGSFQIGRKDRCWRNL-----QTLMSKHGKKEFGFMPRTFIIPQDLNLLRQTWHKYSQ-------------------KNTKWIIKPPASARGTGIRVVNSWSQI-----PKRKPLIVQRYIERPLLI--NGSKFDLRLYVLVTSPLRCYLHTDGLARFASVKYSERNLNDRYMHLTNYSINKMSNSYDKNDDKGMKWTIKSLWSFL--NGRGVNTERLWGAMRNLVLRTIIAGEGPINNLQNKYNCFELFGIDVLLDSELIPWLLEVNISPSLHSALDMAVKGPLVTALLNTALYQIPPK............. 778
150 0.000e+00UniRef50_A0A226DC76 Tubulin polyglutamylase TTLL4 n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226DC76_FOLCA  ali  22  334...KHLKWRLSNITPVVVKKTLTNSGFSLLRKTVE-WGGHWGRHMKAALFKT--SIKDFQKLNHLPGTFQIGRKDRLWRNIQRF-----MNKFGKEEFGFMPKTFILPMEIKQLKAAWD-------------------SSDTKNQLWIVKPPALARGTGIRVVNKWNQI-----NKKKPIIVQSYIGNPYLI--NDRKFDLRIYVLVTNPLKVYIYNDGLVRFAPVKYSSDTASDRFMHLTNYSINKNCELYTQNEDEGHKWTLKTLWRHFVKDGKD--VTKLWSQIEEIVIKTLICAEEPIVSSPNLYNGYELFGFDIILDAEFKPWLLEVNISLHSSSPLDLAVKGPMIKELLNIV.................... 667
151 0.000e+00UniRef50_A0A084VK39 Uncharacterized protein n=7 Tax=Anopheles TaxID=44484 RepID=A0A084VK39_ANOSI  ali  25  320........................................................................CKEYLDYCLHNDIDLEEDAKWDHDWDVFLTHHYLLTHEDNRIQAIDQYLAEAKSVLEQIKGYWPQYALDGYLNIWIVKPGNKCRGRGIHLMNNIKQIIAMVNPPKTRYVIQKYIERPLIIH--NTKFDIRQWFMITSPLNIWFYKESYLRFSSQQYNLMNYHE-SVHLTNHAIQKKYHNAVRDEPHENMWDCHTFQAYLRQIDKYEMWERIYPGMQKAIIGSLLACQDNMD---RRPNTFELYGADFMITEDFYPWLIEINSSPDLSTSVTARLCPQCVEDTIRVVI---DRRSDPNALTGSFELI 636
152 0.000e+00UniRef50_Q4RY08 Chromosome 11 SCAF14979, whole genome shotgun sequence n=2 Tax=Eupercaria TaxID=1489922 RepID=Q4RY08_TETNG  ali  23  194........................................................................CQHYLGVLEHRDIDVTMETDGEVSWGAFLQDYYKVVHEGASVRGGGVFVERCQAMLHKLQEVCPQLGTDGLNNIWIIKPGAMSRGRGIVCKDRLDEILAVVDNKEKKWVVQKYLERPLLVH--GTKFDLRQWFLVTDPLTVWFYRECYLRFSTQPFSTKIL-DSSIHLCNNSIQKHFEPARNRHPADNMWSCSQFRAFLHQQGRSAEWDVVTPGMQKAIIRALQTAQEQVEPRRG---SFELYGADFMLGRDLRPWLLEINICPTMSSVVTAHLCPAVQIDTLRVVL---DRRSDPSAHTGGFQLI 503
153 0.000e+00UniRef50_A4VDD4 Tubulin-tyrosine ligase family protein n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=A4VDD4_TETTS  ali  23  363..KKIIIDLSFTRYDVIRDVCEEVFCWQIQANNRTDYNIQWIDSYI--HEDDFRRMLPFQKVNHFPGSQQLGKKNLLGQNLLKMR------NIFPQNYNFYPITWVLPLQYEDLKMYH-------------------YQNIKRKPYYIVKPEASCQGRGIYLTSRIDQLQS-----TEHYVVQEYIKNPYLID--NLKFDLRLYVLIKSPLKIFLYQDGLARFATVPYNKHNITNLMMHLTNYALNKKSPDFIQNEDSGHKRSFSSILKHLHDQGHD--VQTLLMEIRQIIVKTIISAQPQMSHIYRTCQCFEVLGFDIMLDEDLKPYLIEVNHTPSFDSPLDLQVKKNLIIDTLNIVNVTNQTKRK........... 713
154 0.000e+00UniRef50_I3M922 Uncharacterized protein n=5 Tax=Boreoeutheria TaxID=1437010 RepID=I3M922_ICTTR  ali  24  144................................................................................................WNDLTQQYYSLVHGDAFISSSRNYFSQCQALLNKITSVNPQTEIDGLRNIWIIKPAAKSRGRDIVCMDRVEDILELAAEKDNKWVVQKYIETPMLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDNL-DSAIHLCNHSIQKRLRNDQGRLPGHNMWSSSRFQEYLQKRGRGAMWSVIYPSMKRAITNAMKVAQDHVEARK---NSFELYGADFILGRDFKPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVVV---DRKVDRNCDIGNFELL 428
155 0.000e+00UniRef50_A0A2T6IZZ5 Tubulin-tyrosine ligase family protein n=1 Tax=Toxoplasma gondii TgCATBr9 TaxID=943120 RepID=A0A2T6IZZ5_TOXGO  ali  23  278..YFKVEKSRPEVYRIVSSAFQKVGGWKETPHWEYAWNLLWTWHRPRIDY---NRLLSFQKVNHFPESRQLTRKDNLKRCIERFQKAAGRR---AEHFRIIPKTFLLPKEYTAMVSEMCEMSDCP---------------TKQKRVWICKPKDSSRGRGIFLTNSVEDIR-----YTDNLVVQEYIANPLLL--NGRKFDLRLYVLVTSPLEAFVYKQGFARVARVPFTLDHLDNRFMHLTNAAIQSEWQEDNDFSSEDCKILLDELRQRLEQNG--VDWDAVWQKVLFVILKSLSCCGDSIPH---HPNAFELFGYDVLIDTDLRPWLIEVNSSPSMGQEHDRKVKPGLIEDTLRLVNPISYDRLKLNNSR...... 628
156 0.000e+00UniRef50_UPI000640E1D3 uncharacterized protein LOC105847710 n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI000640E1D3  ali  25  81.YKFI----KTEC--KLVRNILSAHGFKEICS-SNNFNLLWMGSYPKPN--VLHGLTDYQKVNHFPCSNELTRKDKLCKNIQKMQYL-----KGYQHFNFIPKSFILPTELNEF-------------YNEFM---------KDQGPWIIKPYASSRGRGIFLINNKNDI-----PLGDGVIACKYIKNPLLI--SGFKFDCRLYVAVTSPLRVYLFEEGLTRFSTVKYDMSNLQNQRMHLTNYSINKSSKKFVRCEDPGSKWSFSGMLRFLKCQ--EVDTQALMARIEDLIIKTIISVEMVISTACRMFNCFELYGFDILIDENLKPWLLEVNLSPSLASPLDMKIKSILMTDMFNLA.................... 408
157 0.000e+00UniRef50_UPI0006D4E9E0 tubulin polyglutamylase TTLL6-like isoform X1 n=6 Tax=Halyomorpha halys TaxID=286706 RepID=UPI0006D4E9E0  ali  21  171...........HCRYDIVRQIASKFGMRESQEN---WNILWSD--YIVTCERIKNLRRYQKINHFPGMAEICRKDLLARNLNRM------SKLFPKDYDFSPRTWLLPIDLGEVTEYSKRH---------------------KSTTYILKPDVGCKGKGIQLTKTVKDLVSL-----DRTICQVYVPKPYLID--GFKFDLRVYVLITSPLRLYVYNEGLVRFATKRYNRTNMCNMYMHLTNYSVNKFSRTYIADPEEGSKRKLSTLNDYLRRQFHD--VSKLWDDIDDVIIKTVLLALPTLQHNYKRQACFELLGFDLILDNNLKPYLLEVNHSPSFHTPIDREVKEALIIDTFKILNLPKNIK............. 498
158 0.000e+00UniRef50_A0A2U3Z450 protein monoglycylase TTLL8 n=3 Tax=Eutheria TaxID=9347 RepID=A0A2U3Z450_LEPWE  ali  25  24.................................................................................................................ISDSRNHFSQCQALLNKITSVNPQTEIDGLRNIWIIKPGAKSRGRDIMCMNRVEEILELVSAKDNKWVVQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLENL-DSAIHLCNNSIQKHLKNDKGRLPYHNMWTSTRFREYLRKRGRGAMWSVIYPAMKRAIANTMRVAQDHVEPRK---NSFELYGADFILGRDFQPWLIEINSSPTMHTPVTAQLCAQVQEDTIKVVV---DRKIDRNCDIGNFELL 292
159 0.000e+00UniRef50_F6S4V6 Uncharacterized protein n=2 Tax=Ciona TaxID=7718 RepID=F6S4V6_CIOIN  ali  25  274..............................................................................................DDWEKLLHHYYKLVHEGAVIAHSCSYLQQCEQTLARLKERNPQFFTEGVKNTWIIKPGAKSRGRGIIVINRLEEILKLVAGKDSRWVVQKYIERPLLIH--GTKFDIRQWFLVSDPLTVWIYKECYLRFSSRPFSLKNL-DPSIHLCNYSVQKNVDMDVNRLPVENMWSCTEFKTYLRSRDCHTLWDDLFPGMKKAIIHICQTAQDVVEYRKG---SFELYGADFMLDENYNPWLIEVNSSPTMSTAVTSRLCAAVQEDTMKVIL---DRKRDRNCDIGLFELI 561
160 0.000e+00UniRef50_A0A1I8CQS2 Uncharacterized protein n=1 Tax=Rhabditophanes sp. KR3021 TaxID=114890 RepID=A0A1I8CQS2_9BILA  ali  22  3.FKIIKSWISSCETNTIHEVLTNRPNWHSTQSES--WNFYWVNREWMNTIYDKHKFKDGQLINHFKNDYELTRKDNLIKNLKKGKKIPELANGL----NFVPVSYVLPVEWHLFVEEFRKY--------------------NSNTIWIMKPVAGAQGKGIFLFKKLKEIIEWKKKDPHPYVVQMYISHPCLI--GGKKFDIRLYVLVTSPLTVWVHREGFARFSHAKYDLSTYENAYVHLTNVAIAKTAGDF--DPERGLKWSLHKLLRYLTAIHGDEIVTGVMNDIAWIFINSLRSVQPLIIQDK---HCFELYGYDILIDSNLKAWLLEVNASPSLSSQDDFEMKYRVLNHMLN-VLDLEKRLNGGESQIDGFDIL 365
161 0.000e+00UniRef50_W4G9I2 Uncharacterized protein n=7 Tax=Saprolegniaceae TaxID=4764 RepID=W4G9I2_9STRA  ali  22  150...FKSYWERNC-----IKNAFFRAGLVRVHA-GKKWTAAWVKHMPRSKFKL---LQPHQRINHFPDPWVIGRKDRL------MKALVAMKRKFGADYSFIPDGYVLPSQRDMF-------------LRCLDRDAMSATSSFSQSLWIVKPPASACGRGIKVIH-ASQVDTLKKAKK--LVVQRYVSSPYLI--NGFKFDLRIYVLVTSPLRIYLFQEGLARFCTVKYTPAQLKNRLAHLTNFSVNKASTTFKETDTDGSKWSWTALMAYLEDQGHDVDV--LRSKMKAIICKTLIAAEAHITPVKHRNVCYELFGFDLMVDSALEPWLIEVNVSPSLSSPLDKRIKGLLMSDIFHLV.................... 485
162 0.000e+00UniRef50_A0A2K1KH36 Uncharacterized protein (Fragment) n=5 Tax=Physcomitrella patens subsp. patens TaxID=3218 RepID=A0A2K1KH36_PHYPA  ali  24  52.....LVDLSNCKY-EVLRIVLEKNGWEEGQEDDKRCHLIWTDLSVGPDK--LMKLNKGQKINHFHGMLAICRKKSLFCSLSTMRKL------FPADYMFFPQAFILPNQLSNLLNCFSRSKV---------------------KTFILKPDNGSQGRGVVLAQSVRDVRQAMDGPGSNLVAQKYITKPMLI--NGFKFDLRIYVLILSPLRLYLYREGIARFCTERYQPENLSKNCMHLTNYAVNKYNPNFENETSKGHKWTLTSLFKTLSIQGFDT--TILHQKICHIVVMTILAIVPLLQHNYKTYSCFELLGMDVLIDHRCIPWLLEVNHSPSFSTPLDLKVKESLITDTLKLV.................... 390
163 0.000e+00UniRef50_A0A067BKP9 Uncharacterized protein n=8 Tax=Oomycetes TaxID=4762 RepID=A0A067BKP9_SAPPC  ali  22  18..RKVVVDVSLCRYAIIKR-CLKARDFRLVREKNANWDIWWSDRGELL--KDARRLHAFQKVNHFPSMEDICRKDFLATHLNAMRKAL------PDAYDYYPRSFLLPADRIELQQAMEH--------------------DARGATYIIKPRTLCQGKGIKLVQSFGKI-----PVTEPCVAQRYVANPLLID--GFKFDLRIYVLVTSPLRVHIFRNGLARFCTTPFTKANLNAARMHLTNYAINKKAKDFVKDDTKGSKRSLAFVMAHIAHHGLDP--SAVWAEMCDIILKTLLAIQPRLQASYRNFAAFEILGFDIMLDDKGKSWLFEVNHAPSFAAKLDREIKTPLIEQALDLINVTNKRKR............ 368
164 0.000e+00UniRef50_A8B5A2 Tubulin tyrosine ligase n=6 Tax=Giardia intestinalis TaxID=5741 RepID=A8B5A2_GIAIC  ali  19  5..KYRID----CEKYAVISN-FEKRGWQRTSG--SDWNIYWAPVAKMFAIGSKSRPTDAQIVNHFPNHYELTRKDLIVRNMRKYRKDLEAKNSGKAYIDFIPLTYLLPSESTMFAEEL---------------------KGNKKTPFILKPAGSAQGRGIELISRMAQFKKWQVSQANSYLASKYINRPLLV--GNKKFDIRMYVLVTSPLKAYIYQHAFCRFCTVEYSLDDLSNPFVHLTNVAVQKHGEAYNSRH--GGKWDIENLKLYISAHYGYEAVNKCFEKILFTLIHSLKAVQSSMVFSKS---SFECYGYDILIDERLHPWLLEVNASPSLSTDADRLMKCKLLDDVLKIIIPRNFPPPEGSEDTGDFSLL 379
165 0.000e+00UniRef50_Q384Y9 Tubulin-tyrsoine ligase-like protein, putative n=5 Tax=Trypanosoma TaxID=5690 RepID=Q384Y9_TRYB2  ali  23  266...YKIVNLALCKYP-LLRIIAQENGFKELEDDRNNFNIVWSDTVLPLTRLV--RLANWQRTNHFPSMYLLCRKGHLGITLGRMRKVM------PSHYIFYPRTW-----------------SLRSERHQFARFLMALRSKKLSKFFIMKPNSGCQGRGIMITRDPLNAVEDL----DNYIVQEYITRPLLLE--GRKFDLRVYVLLTSP-SIFLFNDGLVRQCAELYTDANVKNTCKHLTNYAVNKHNPEYVFNDDPGNKRNFKFFNEWLESCGKS--VEQFWARVAHVICKTILVAQPQIANVYNSCSCFEVLGFDILVDNKMKPWLMEVNHTPSLDTPLDYEVKHALISEVWDILVKVTDRKRDERKERDEFIQ. 630
166 0.000e+00UniRef50_T1GNY0 Uncharacterized protein n=1 Tax=Megaselia scalaris TaxID=36166 RepID=T1GNY0_MEGSC  ali  23  66........SNLSKGPDVPHEIFKVLKFRVTKVKTNDWIGVWGKHLKSPCFRTIR---PYQKINHLPGSFKIGRKDSCWKNLQK-----QMTRHGKNEFGFMPKTYILPQD-----------------LTTLRKYWPKYSQKNYK--WIIKPPASARGTGIKVVNRWAQI-----PKRKPIIVQKYIERPLLI--NGSKFDLRLYVLVTSPLRVYMYHNGLVRFASVKYSSKSLNDRCMHLTNYSINKFSSNYSKNEDHGHKWTLKSLWTYLENR--NVDTSGLWSAMRNLVLRTILAGENSILNVESKYSTFELFGFDVLLDSELVPWLLEVNISPSLHSPLDAHVKAPLVQAVFNTAL................... 399
167 0.000e+00UniRef50_UPI000A2886EF tubulin monoglycylase TTLL3-like isoform X3 n=3 Tax=Amniota TaxID=32524 RepID=UPI000A2886EF  ali  24  476...............................................................................................DWTLFLQRYYQVVHEGAELKKVDSQIQRCEDILQQLRAVVPQLDMEGDRNIWIVKPGAKSRGRGIMCMDHLGEMLKLVDCKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLRNL-DSSVHLCNNSIQKHFENSNTRHPPDNMWCSQKFQAHLQEVGAPEAWADVMPGMKAAVIHVLQTSQDTVQSRKG---SFELYGADFIFGEDFHPWLIEINASPTMSTAVTTRLCAGVLADTLRVVI---DRRQDRNCDTGAFELI 762
168 0.000e+00UniRef50_H2TW77 Uncharacterized protein n=22 Tax=Euteleostomi TaxID=117571 RepID=H2TW77_TAKRU  ali  23  253........................................................................CQQYLSVLEHCDIDITIETPRDVNWGAFLQDYYKVVHDGVSIRGGGVFVERCQAMLRKLWEVCPQLGTDGLNNIWIIKPGAMSRGRGIMCKDRLDEILAVVDNKERKWVVQKYLERPLLIH--GTKFDLRQWFLVTDPLTVWFYKECYLRFSTQPFSTKIL-DSSVHLCNNSIQKHFEPARDRHPEDNMWSCSQFRAFLHQQGRSAEWDSVTPGMQKAIIRALQTAQEQVEPRKG---SFELYGADFMLGRDLRPWLLEINVCPTMSTAVTAHLCPAVQIDTLKVVL---DRRTDANAHTGGFQLI 562
169 0.000e+00UniRef50_A0A267H1G7 Uncharacterized protein n=3 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267H1G7_9PLAT  ali  21  492......................................................................ITQCEQLIQNRNHDDWDTASCMSESDWYSFLQSYYRVAHHGAQIRDAKSLKSRCRQLCTELRSEYPQFDIDGCRNAWIVKPGAKSRGRGIFCVRTLESVLELLRQPPNKLVVQKYIERPLLVH--RTKFDIRQWFVVTDPLTIWWYKDCYVRFCSQHFTLNDF-NEAVHLSNNSIQYKYANRHPDLPDDNIWDCITLQTHLSSIGQNVYYDVIYPGMQKAVINSMLCSQDHVEMRK---NCFELYGADFMIDENFRPWLLEINCSPTMSTEVTTRLCRNVQDDILKVVV---DRRQNRACNTGRFELI 807
170 0.000e+00UniRef50_K3WYI8 Uncharacterized protein n=1 Tax=Pythium ultimum DAOM BR144 TaxID=431595 RepID=K3WYI8_PYTUL  ali  21  61..........TACRYAVIRRCLRERGFRLVKDTKPKWDIWWSDRGDLL--KDLPRLNAFQKINHFPAMEEICRKDFLANNLNAICKVL------PNDFDFYPRSFLMPAEGVELQKYMGRAP--------------------KSTTFIAKPKTLCQGKGISLVQSFSKV------PNEPCVVQHYVDNPLLID--GFKFDLRIYVLVFSPLRIYIFKNGLARFCTSAFTRCNLNQKRMHLTNYAVNKCSKNFQGDENKASKRSLTAIMAYLDATGHYSSRN-VWTQICDIVVKTLLCVQPKLSSTYKSFKCFEVLGFDIMLDANGKAWLFEVNHAPSFASPLDREIKSTLISSTLALIDVTNEKKR............ 405
171 0.000e+00UniRef50_A0A1R2AZ22 Uncharacterized protein n=6 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2AZ22_9CILI  ali  20  13....ITCNIAFTRYEIVKHVGEKIFGWKLSDEEDEKWDILWTDCAVPPEKLA--KMHPYQKINHFPGMYAISRKNYLAMNLSKLKK------KFPNEYNFFPRSWLYPCDLNDLKLFMQNKKNCYL---------------------IVKPEASCQGRGIFLTKKLDSI-----DPNGRFVVQEYLNKPYLIE--NLKFDLRIYVLVADPLRIFVHEDGLTRFATEEYSKNNFEDMCMHLTNYAVNKNNPNFVHNDDSGHKRSLQSTYDHLSEMGYD--VEALKKSIDDSIIKTLCSIQPTLAHHYRSCQCFEVLGFDVILDSKGRPYVLEVNHTPSFTTPLDWKIKKHVIRDALVLMNITSRERK............ 357
172 0.000e+00UniRef50_K3W656 Uncharacterized protein n=1 Tax=Pythium ultimum DAOM BR144 TaxID=431595 RepID=K3W656_PYTUL  ali  24  696.HYRINSTTRREVSDIVIHALDKLGDWEEHPSGKTTWNLLWTWSKPRVERKT---LLAWQKVNHFQHAKALTRKDCLKKN---MGKYLAMGGKMKAAYDVIPLTFILPQEYIAFVQA----------YQDKSARLANKDGSTHKNIWIMKPVALSRGRGISLVNDLSQVV-----YGEQVVIQEYIANPLLLD--GYKFDLRLYVLVTSPLEAFFYDEGFVRMCTRQYEDSDLSNLFVHLTNSSIQKENQEAIKTSNNGTKMTLAYLWRRLEAMGAD--VEKVKNEIIEVILKSLMCGEDHIP---FQVNSFDLYGYDILLDDTFRPWLIEINSSPSMANELDYQVKDALILDTIKLVNPLRFDRTK........... 1051
173 0.000e+00UniRef50_A0A0L0SXT3 Uncharacterized protein n=2 Tax=Allomyces macrogynus ATCC 38327 TaxID=578462 RepID=A0A0L0SXT3_ALLMA  ali  21  89..................................TDWTIQWQDGVVTVD--QLLHMRPWQRINHFPAMHHLCHKDYLARNLTKMRNE------FPREYAFWPRTWCMRTDAVAFKAYXXXXXXXX------------XXXXXPPRWYIAKPDSKSRGIGIYLFSDPAE---FQTNPEYEMVVQQYIERPLLIE--GYKFDMRVYALITDPLRLFVYKEGLARFATEPYALDNQSQICMHLTNYSVNKRSTKFVGGADGGSKRTLTWALEYLDSLGHDGS-GAIWTSIKDIIAKSILTVQPELARVFRTCACFELLGFDVILDHKLRPFVLEINHSPSLSTAVDHKLKQGLLENIFRLLNPTSLRRDRKQAKQRLY... 425
174 0.000e+00UniRef50_F7GGM0 Uncharacterized protein n=2 Tax=Metatheria TaxID=9263 RepID=F7GGM0_MONDO  ali  24  143...............................................................................................EWTELIQQYYNLVHGDAYIPASKTYFAQCQTILNKIMSVNPQSEIDGMRNIWILKPGAKSRGRDIICMDRVEEIMKLVTSKDNKWVVQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDSL-DSAIHLCNNSIQKHFKNAKDRLPCYNMWTSTKFQEYLQKRGGNVWHNIIYPSMKKAITHTMKVAQDHVEARK---NSFELYGADFILGKDFKPWLIEINSSPTMSTPVTAQLCAQVQEDTIKVVV---DRKTDRNCDIGNFELL 429
175 0.000e+00UniRef50_UPI000B91357E tubulin monoglycylase TTLL3-like isoform X1 n=2 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B91357E  ali  24  633..............................................................................................KQWDDFIRQYCQLIFDGGLIAESSNHSAMCESLLNRVRAVLPQLDMDGLRNIWIIKPGAKSRGRGIICMNRLEEILKLVGNKEGKWVVQKYIERPLLIY--NTKFDIRQWFLVTDPLTIWWYQSSYLRFCTQPFSLDNLE-SAIHLSNFSVQKNFENAATRLPDENMWTSEEFQQYLRGRGGNVWQDCIYPGMKRAVIAALQCTQDVVEMRK---NSFELYGADFMLTEDFQPWLLEINSSPAMTTEITEQLCHDVIEDTMKVVL---DRRHDKNCDTGRFEL. 918
176 0.000e+00UniRef50_A0A024TKR8 Uncharacterized protein n=2 Tax=Aphanomyces TaxID=100860 RepID=A0A024TKR8_9STRA  ali  24  24..RKVVVDVSLCRYAIIKR-CLKDRGFRRTKKSDVEWDIWWSDRGELL--KDARRLNAFQKVNHFPSMEDICRKDFLANNLNAMRKLL------PDDYDFFPRSFLIPAERMELQQCME--------------------ADKRGATYIVKPRTLCQGKGISLIQSFQKL-----STKDPCVVQKYIHNPLLID--GFKFDLRIYVLVYSPLHVYIFRNGLARFCTTPFKRSNLHQTRMHLTNYAINKKSKDFVRSADEGSKRSLAFVMQHLQDDHG-MDPNAVWADICDVVLKTLLAIQPRLAASYRNFAAFEILGFDVMLDERGKAWMVEVNHAPSFASTLDKQIKTPLIAQALDIL.................... 366
177 0.000e+00UniRef50_A0A1I8IQ12 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8IQ12_9PLAT  ali  21  263......................................................................ITQCEQLIQNRNHDDWDTASCMSESDWYSFLQSYYRVAHHGAQIRDAKSLKSRCRQLCTELRSEYPQFDIDGCRNAWIVKPGAKSRGRGIFCVRTLESVLELLRQPPNKLVVQKYIERPLLVH--RTKFDIRQWFVVTDPLTIWWYKDCYVRFCSQHFTLNDF-NEAVHLSNNSIQYKYANRHPDLPDDNIWDCITLQTHLSSIGQNVYYDVIYPGMQKAVINSMLCSQDHVEMRK---NCFELYGADFMIDENFRPWLLEINCSPTMSTEVTTRLCRNVQDDILKVVV---DRRQNRACNTGRFELI 578
178 0.000e+00UniRef50_G0UBN5 Putative tubulin-tyrsoine ligase-like protein (Fragment) n=9 Tax=Trypanosoma TaxID=5690 RepID=G0UBN5_TRYVY  ali  23  110....KIVNLSLCKY-SLLRVIAEENGFKETEDDLEKFNIVWSDTVLPLTKLV--RLGNWQRTNHFPSMHLLCRKGHLGITLGRIRKVL------PSHYLFYPRTW-----------------SLRSERHQFNRFFMALRSRKLTKFFIMKPNSGCQGRGIVITRDP----LNAVEDTDNYIVQEYITRPLLLEE--RKFDLRVYVLVTSP-SIFMFNDGLVRLCAEVYSDSNVKNTCKHLTNYAVNKHSPEYVFNEDAGNKRNFKFFNEWLRESGK--CVETFWDRVAHVVCKTILVAQPQIANVYNSCTCFEVLGFDILVDHKMKPWLMEVNHTPSFATPLDYEIKHALISEVWDILIRATDRRRDVRKERDEFIQ. 473
179 0.000e+00UniRef50_A0A0X3NSL1 Tubulin polyglutamylase TTLL4 n=2 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0X3NSL1_SCHSO  ali  19  671.FRRLLHYRPSLMTPIIVRQVLSRSAFRVTEDESSDWIYYFGKHMRPAVFLSIR---DYQKVNHLPCSFQLGRKDRLWRNLSAMQQ-----KFGTKHFGFFPQTFCIPTEIDKLKEAWDGEPSPHQ--------------------WILKPPASARGIGIRLLSKWSYV-----PKKRPYIVQKYLHNPFLI--NNSKFDLRIYVFVYSPLCVFVHEDGLARFASQKYSNSPVGNRFIHLTNYSVNRLNVEYIVNNSEGHKWSLKALWSYLRSQGIDT--DKVWADIKDVVVKTCLATESLLKAAVDTYCTFELFGFDIFLDENLKPWLLEVNVSPSMHSPLDVKVKGTMIKDMLNLTIRLPEYKDINNPTVR..... 1031
180 0.000e+00UniRef50_A0A078BAU4 Tubulin-tyrosine ligase family protein n=2 Tax=Oxytrichidae TaxID=57506 RepID=A0A078BAU4_STYLE  ali  18  263.YYFKLHK----CDVKIIRYTLEDNGFREVPPEVKDWSVLWSCSALKP--IVYQQMTKYQKVNHFPQSFYITRKDLMYKQVSRMREIHGQKHF-----NFIPKTFLLPNEFVYLEAEMEK---------------------DKEKLWIAKPAASSQGKGIIVTNKLAEIPQ----KGTPHIVSEYINNPLLFD--GYKFDLRVYVAITSPLRLYIYEDGLTRFATSKYTNDLHGNKYTHLTNYSLNKYNPNFIANNDAGSKWSLVALKKAFREQGIDE--QMIFKKIEDVVIKTILSAESVIFNAVSRTNCFELLGFDILIDNSLNPWLLEVNLSPSLNSPLDQRIKGNLIADLLTLSISPLDQRKQTN......... 611
181 0.000e+00UniRef50_UPI0004434187 protein monoglycylase TTLL8 n=1 Tax=Monodelphis domestica TaxID=13616 RepID=UPI0004434187  ali  24  567...............................................................................................EWTELIQQYYNLVHGDAYIPASKTYFAQCQTILNKIMSVNPQSEIDGMRNIWILKPGAKSRGRDIICMDRVEEIMKLVTSKDNKWVVQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDSL-DSAIHLCNNSIQKHFKNAKDRLPCYNMWTSTKFQEYLQKRGGNVWHNIIYPSMKKAITHTMKVAQDHVEARK---NSFELYGADFILGKDFKPWLIEINSSPTMSTPVTAQLCAQVQEDTIKVVV---DRKTDRNCDIGNFELL 853
182 0.000e+00UniRef50_UPI000DCA0E6C tubulin polyglutamylase TTLL4-like n=1 Tax=Sipha flava TaxID=143950 RepID=UPI000DCA0E6C  ali  21  280..KVLLKWEINCMTPIVVRHTIQNSDFKLV-GKSNDWFGTWGKHMKSLNFKT---LRDQQKFNHFPGTFEIGRKDRLWKNLHRL-----MLIYGNDQFGIIPTSYILPRDVRSLKQVW-----------------------KKNDKWIVKPPASARGTGICVISKLSQI-----PNNEHLVVQRYIDNPYLI--NDTKFDLRLYILITSPLRLYLYDNGLVRFASVKYSSDTISDRYMHLTNYSINRLSSQYTQNEDQGHKWTLRSLWTYMEKERK-IDVKKLWDSLADLVVKTVISGELPMSQMCNRYNAYELFGIDVLFDENLKPWILEVNISPSLHTPLDVAVKGPLIKDLMNVV.................... 610
183 0.000e+00UniRef50_A0A091ERE9 Tubulin monoglycylase TTLL3 n=41 Tax=Euteleostomi TaxID=117571 RepID=A0A091ERE9_FUKDA  ali  25  426................................................................................................WALFLQRYYQVVHKGAELKHLDTQVQHCEDILQQLRAVVPQIDMEGVCNIWIVKPGAKSRGRGILCMDRLEEMLKLVDCKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRESYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSSHRHPPDNMWSSQKFQAHLRETGAPDAWSAIVPGMKAAVIHALQTSQDTVQDRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTPVTARLCAGVQADTLRVVI---DHRLDRSCDTGAFELI 711
184 0.000e+00UniRef50_A0A0L0DEL3 Tubulin-tyrosine ligase n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DEL3_THETB  ali  22  189....................................WSLQWSGCHIRPG--AMRRMASYQRINHFPRAFEVTRKDRLYHNVARM------AARFGESYGFMPATFALPRELDAFTAH--------------------YRAQRRRRMFIVKPTTLSRGRGIFLVSDLRQVDAAVL--EHACVASEYIANPYLID--GLKFDLRIYVVVTSPLRVYVYEEGLARFCTEQYSADQCDNLFMHLTNYSVNKSSAKFVANDGVGSKWSLSALYARLAADR--VDVDAVASAIDDLIVKTFVAVEGPMGNAERSFNCFELYGLDILLDEGLKPWLIEVNLTPSLASPLDLKIKGELVADMFNLV.................... 492
185 0.000e+00UniRef50_A0A1W3JNI7 tubulin monoglycylase TTLL3-like n=2 Tax=Ciona intestinalis TaxID=7719 RepID=A0A1W3JNI7_CIOIN  ali  25  500..............................................................................................DDWEKLLHHYYKLVHEGAVIAHSCSYLQQCEQTLARLKERNPQFFTEGVKNTWIIKPGAKSRGRGIIVINRLEEILKLVAGKDSRWVVQKYIERPLLIH--GTKFDIRQWFLVSDPLTVWIYKECYLRFSSRPFSLKNL-DPSIHLCNYSVQKNVDMDVNRNPVENMWSCTEFKTYLRSRDCHTLWDDLFPGMKKAIIHICQTAQDVVEYRKG---SFELYGADFMLDENYNPWLIEVNSSPTMSTAVTSRLCAAVQEDTMKVIL---DRKRDRNCDIGLFELI 787
186 0.000e+00UniRef50_A0A267E5U6 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267E5U6_9PLAT  ali  22  67..RKRISINLSACKFAAVQLAAERAGSVRCHDDDSSAMLVWSDAPVPVDRIS--ELKGYQRVNHFPGMGEISRKDSLGRNMAR------AARLQPLEFNFVPQTWCLP-----------------QESAQFQQFLRDSKSAGKRPVFISKPANGAMGHGIRVYRSGEQVP---VTPESSSIVQRYLDKPFLVD--GFKCDLRIYVLVTSPLRIFFYNDGLLRLSTEKYEDPRTDRPCMHLTNYSINKRSGQYEKDDSTGSKRSIRFLNEYLQQRDHDVA--KLWRSIIDLIIKTVLVAYPQVLLQYRLCRCFEILGFDIMLDHKLKPWLLEVNRSPSFGIPIDRKVKLGMLEEALSLLIRLSDRRRNQAVQK...... 425
187 0.000e+00UniRef50_A0A1D2MJM3 Tubulin polyglutamylase TTLL4 n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2MJM3_ORCCI  ali  22  290..RKLLKWRLSPITPIVVKRTVANSGYRLLRKTVE-WEGQWGKHMKSNMFRA--SLKDFQKLNHIPGTFQVGRKDRLWRNLHRF-----MTKFGKDEFGFLPRTFILPQEIKQLKTAWDST-------------------DSKNTPWIVKPPAAARGTGIRVVNKWSQV-----PKKKPVIVQSYVANPYLI--NDRKFDLRLYVLVTDPLKIYMYNDGLVRFAPVKYSHDSVGDRFMHLTNYSVNKNCELYTHNEDEGHKWTLKTLWRYLKDR--DVNTSTLWDKMEEIVVKTLLSAEELITSNTHRYSGYELFGFDIIIDQELKPWLLEVNISLHSSSPLDLAVKGPLIKEVFNIV.................... 623
188 0.000e+00UniRef50_R1D0G6 Tubulin tyrosine ligase (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=R1D0G6_EMIHU  ali  24  14.........RNTIYD-----VFRARGWRETESD-TDWDVAWVDVGWIRDNMDAMHFDEHQRINHFRNHYELTRXXXXXXXXXXXXXXXXXXXXXDEKYDFFPTTYVLPVDYGPFVE----------EFKQQARATLPPCCAQANAIWIMKPIGKAQGKGIFLFNKLSQINEWRKDQTETYVVQRYIENPLLV--GGKKFDLRIYALVTSPLVCYLYCSGFARFTGFRYSSKKLGESYMHLTNVAIQKTAPGY--DADAGCKWPLRQLKLYL--------IGKLFAEMQEMIIASLLAVQKVMIQDK---HAFEMYGYDIMVDDQLKPWLIEVNSSPSLSTPTDYELK............................... 337
189 0.000e+00UniRef50_UPI0006C9548D probable tubulin polyglutamylase TTLL9 n=1 Tax=Trichogramma pretiosum TaxID=7493 RepID=UPI0006C9548D  ali  22  42...................KVLQSRGWRIHDSQDSSWDLWWCDTSDLRQALDAQRLRPQQRVSHFRNHCELTRKNYLYRNLKRYRRLLLKAGKTKE---------------AELCDAMPISFELPSEYRMLIEEHRK----KHGTTWIVKPSQGSQGRGIFLFQRLRDLVEWKQPSQMNYLVQKYIDDPYLID--GCKFDLRLYVLVTSPLKVWLAREGFARLSGEQFSLERIDDNRVHLTNMSIQLRDKDCVNEVKLGRKWPLSCLKKYLSDRHGEQVIDQLIHNIAGIIMASLQAVQSIIIPGK---NSFELYGYDVILDERLKPWLLEVNASPSLSTDHDFRLKFDLIDDVLNI-LDFERLLTGRETRVGGFDLL 419
190 0.000e+00UniRef50_U4UAS3 Uncharacterized protein n=1 Tax=Dendroctonus ponderosae TaxID=77166 RepID=U4UAS3_DENPD  ali  20  12....................VCIERGWREYNPNENHWNLWWKTSGFSNGH--HKNIYAFQFLNHIPKGSTICRKDNLIRYLRCMRKVYG------SVYDFSPHGYNLPLEYTKLAAECSRSRPPSYRDENLR-------LPEEKPIWICKPVAQSQGRGIFLFKKLSEL-----NYDTNTIVQRYIEKPLLI--GGYKFDLRLYVCVPSPLVVYMYKEGLARFGTDKFSLNDLKNPFRHLTNSSINKLGPGYKDRVGSGCKWTLRQLRRYFQQASIPDW--LIWQKITSLVVLTILSQLHQIPP---TVNCFEFFGFDILIDSALRPWLLEVNLSPALSNDCDADVKKPMLHDMFDLLGLPLY............... 358
191 0.000e+00UniRef50_Q564U4 Tubulin Tyrosine Ligase Like n=16 Tax=Chromadorea TaxID=119089 RepID=Q564U4_CAEEL  ali  22  26..KKILFKC--ALTNTISDVLTNREGWAQTQGD--DWQFFWVTREWMTTCYDKHKFSEKQMICHFRNDFELTRKDFLIKNYKKARKAKEKSGIDVSEFNFLPSSYVLPT-----------------EYHLFVEEFRKYPND---TIWIMKPVAGAQGKGIFLFRKLKHVQEWKKKDSSPYVVQCYVHNPYLV--GGKKFDVRIYVLVTSPLNAWVHREGFARFSHSRYSTDSVDDAFVHLTNVAVAKTAADY--DPERGLKWSLPKLFRFFKSVHGQSKLSKTMNDLTNVIIESLKSVQNLIIQD---NHCFELYGYDILFDENLKPWLLEVNASPSLSSQEDFELKYRILNHMID-VLDIEKKLIGNENEVGGFDLL 379
192 0.000e+00UniRef50_A0A0M8ZYT4 Putative tubulin polyglutamylase TTLL9 n=2 Tax=Apidae TaxID=7458 RepID=A0A0M8ZYT4_9HYME  ali  25  203...........................KVTEPNDPNWHLWWCEVNDVRQALDLK-LAPHQRIPHFRNHYELTRKNYLYRNLKRYKKLLLKSNK---------------TDEAELCDGMPLTYELPNDFRLFAEEYHKQ----PGSTWIVKPAGRSQGKGIFLFRKLKDLSEWCSSPPETFIVQKYVENPYLL--AGRKFDLRIYTLVTSPLKVWLAREGFARLSSELFDLENIDDSRVHLTNMAIQLKASDDKQEPKKGCKWALTKVREYLTARHGPDAVEALFQRIAGVIMASLLAVQPVIMPGK---NSFELYGYDTLLDEDLTPWLLEVNASPALTTDTDYRLKFDLVDDALN-VLDLEARFSGRETRIGGLDLL 542
193 0.000e+00UniRef50_A0A1R2B1L9 Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2B1L9_9CILI  ali  21  108..............AKLVRSILERSGF--CYTDSHDWNVMWLSCNAKLYLYEG--LNASQRINHFPNSYEITRKDRMCYNLMNMQKKYGPAEFG-----FFPETYIMPNEYNEFC---------------------MKYRNDKDTKWIVKPANSSQGRGIYLLDNFSSLRT-----SDASVVSRFIHNPLLI--NDLKFDLRIYVLVTSPLKIYVFDEGLARFASEKYSNFSRANKFSFLTNYSINKNNENFIQNEDCGHKWSLSALVKYLQS--ANIDTSIVILKIYDLIIKTVITAENTVVNNLSRNNCFDLFGFDILLDSSLKPWLLEVNLSPSLATPLDLNIKGHLVAELFNIILRNYDRRAESAKSSR..... 442
194 0.000e+00UniRef50_F0WHK2 Tubulin polyglutamylase putative n=2 Tax=Albugo TaxID=65356 RepID=F0WHK2_9STRA  ali  22  20.NTKISINLTLCKY-EVVRKIARARGWKLITDEQDKCNLHWID--VPEFCDTFRRLQPYQKVNHFPGMSNLARKSKLARNFERMKKLY------PKDYDFCPKTWILPFDFRDFSLQFN-------------------TEGKSQKTFIIKPDHMCQGRGVFLTKQLHQLQTA-----DIVVAQQYISKPLLID--NKKFDLRIYVLVTSPLRVYLFQDGLVRLCTAEYNVGNIDQRFMHLTNYAVNKHSSDFNQQDGSGSKRSLRWFFKWLKQQYDAEWVDHLWDQIGDICLKALLAVQPLLAQEYRSSSCFAILGMDVLVDEALKPWLLEVNHLPSFGSPLDWDIKERLISQVFDVLGVSPDRKKARSSRTRLY... 433
195 0.000e+00UniRef50_H2KQ85 Tubulin polyglutamylase TTLL4 n=2 Tax=Opisthorchiidae TaxID=6196 RepID=H2KQ85_CLOSI  ali  21  720.FRRLLRWRASVLTPVVVKQVLMRSGFRVTEDESSDWIFYFGKHMRPQVFRSIRE---YQKVNHLPCSFHLGRKDRLWKNLVHMQ-----AKFGKENFSFMPETFCLPGDLEALKKVW--------------------DEEGDNQRWILKPPAAARGIGVRLITKWAQV-----PKKRPAIVQKYLARPFLINES--KFDLRIYVFISSPLRVYIHEDGLVRFASQKYTTRCLGNRFIHLTNYSINRLNSEYVSNSSDGHKWSLRALWVYFRSQGIAPA--PVWSSIKDLVVKTAISTETAFNTAMHSYCNHEVFGFDIFLDEDLKPWLLEVNVSPSMHSPLDAKIKGNMVKDMLNIAGLRIPEPSDTNSHT...... 1078
196 0.000e+00UniRef50_A0A078B2S1 Tubulin-tyrosine ligase family protein n=2 Tax=Oxytrichidae TaxID=57506 RepID=A0A078B2S1_STYLE  ali  21  72....LLINVSYTQY-EVLKDVAEDLNFNLSYEEEEDWDIYWIDGPVAPAFLL--KMQAYQRASHFPGMFALARKNLLAKNLQAMKKV------FSQEFNFFPKTWLIPQDAKDFKAQFN---------------------NKKAKTFIIKPEASCQGKGIFLTRNFDWLQA-----GEHYVAQRYLHKPYLID--NLKFDLRIYVLLTNPLRAFIYREGLARFATEEYNSSNLNNLCMHLTNYAINKDSDQFVSKDDVGHKRGLKPIWTHIDNNRKPEGKTQVWQDIKEVIVKTLITGQPHIAHLYRSSKCFQILGFDIFIDNKCKPWLIEVNQSPSFTTPLDFNIKKALICDTVEMLNLSWKRKNK........... 419
197 0.000e+00UniRef50_UPI000854741A tubulin polyglutamylase TTLL5 n=1 Tax=Nanorana parkeri TaxID=125878 RepID=UPI000854741A  ali  22  37.........................................TGSHIKPH--LLRNLSSFQRVNHFPRSYELTRKDRLYKNMQRMQQTHGARNF-----NLLPQTFLLPGEYQDFCHAFS----------------------KDRGPWIVKPVASSRGRGVYLVNSVCHPNTSACPCPPLCV-----SSPL-----GFKFDVRLYVLITSPLLIYLYEEGLTRFATVRYDAKNIKNQFMHLTNYSVNKKSGEYVSCDDPGNKWSMSAMLRYLKQEGKDTA--GLMSQVEDLIIKTIISGELPIAAACKSFNCFELYGFDVLIDSKMKPWLLEVNLSPSLACPLDLKVKASMISDMLTLVLECQDPLQRP.......... 339
198 0.000e+00UniRef50_A0A0G4EKS8 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EKS8_VITBC  ali  25  696..YYRVVQHRTEVYDIVTRALHQKDGWEELPHGGPCWNLLWTWGRPRVDY---SRLLQWQKVNHYPHSRHLTRKDYLKRCIERYVKMGGKAG---EAFRIMPLTFTLPKEYVPFVEAFSGT----------------PDEERDHRLWILKPAGSSRGRGIQIINDLSGV-----TYGEQMVIQEYIRRPLLLE--GFKFDLRVYVLVTSPLEAFVYKRGFARIATVLYSADDIHNRFIHLTNSSIQRHNMPDATQHDEGTKISLDDLTTRLEARGID--WADLWRRLCDVVLKSLCCCQDFIPHQRSA---FELFGYDILIDERLKPWLLEVNASPSLGQELDEKVKLPLISDTIDLVAPLAFDRQK........... 1058
199 0.000e+00UniRef50_B3S4S4 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3S4S4_TRIAD  ali  22  59....ISINLSGTKYDIVKEVTLERFGMIQSKDEDLSSFLFWCDTALPAERIA--EFKPYQRVNHFPGMGEICRKDSLARNLQK--------------------------------------------YNAYQGYCRELKKRKKTRTFICKPSNGAMGNGITLTRNSENI-----PWNENYVVQEYMEKPLLID--GLKFDLRIYVLVTSPLRIFLFDDGLVRLSTQPYTVHNIDKLFMHLTNYSINKHSENFDDEHDRGTKRSIKFFNTWLREHGYS--VTQLWNNIADVIIKTIIAAAPHLLHIYRTCSCFEILGFDVILDRKLRPWLLEVNRSPSFGTDIDYDIKSRLLTDTLRLVNIKLSDRRK........... 385
200 0.000e+00UniRef50_A0A068YBJ9 Tubulin polyglutamylase ttll4 n=2 Tax=Echinococcus TaxID=6209 RepID=A0A068YBJ9_ECHMU  ali  20  212.FRKLLHWRPSLVTPIVVKQALARAHFRASNVESSDWIYYFGKHLKPDAFLTIR---DYQKVNHFPCSFHLGRKDHLWRNISAMQR-----RFGAENFNFAPLTFCMPTDLEKFKDFW--------------------HTEGAEHQWILKPPASARGLGVRVINKWSQI-----PKKRPLIVQRYLNNPYLI--NNSKFDLRIYVFIYSPLIVYVHEDGLVRFASHIYTNSPVGNRYVHLTNYSINRQNADYISNASDGHKWSLRAFWAYLRSHG--VKPEPVWSSIKDVIAKTCIAIEPHLKNCKSPYSVQELFGFDIFLDANLKPWVLEVNVSPSMHSPLDSKVKGTMIKDMLNLTFNLPSPKDILKGNTKKFPML 577
201 0.000e+00UniRef50_F1SQE5 Uncharacterized protein n=98 Tax=Theria TaxID=722675 RepID=F1SQE5_PIG  ali  24  410................................................................................................WSLFLQRYYQVVHEGAELRHLDTQVQRCEDILQQLRAVVPQMDMEGDCNIWIVKPGAKSRGRGIVCMDHLEEMLKLVDSKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQRHLENSCHRHPSDNMWSSKKFQAHLQEIGAPNAWSTIIPGMKAAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRRLDRSCDTGAFELI 695
202 0.000e+00UniRef50_A0A1I7TUV2 Uncharacterized protein n=1 Tax=Caenorhabditis tropicalis TaxID=1561998 RepID=A0A1I7TUV2_9PELO  ali  22  31..KKILFKC--ALTNTISDVLTNRDGWAQTQGD--DWQFFWVTREWMTTCYDKHKFSEKQLICHFRNDFELTRKDFLIKNYKKARKVKEKSGVDSQEFNFIPSSYVLPT-----------------EYHLFVEEFRKYPTD---TIWIMKPVAGAQGKGIFLFRKLKHVQEWKKKDSTPYVVQSYISNPYLV--GGKKFDVRIYVLVTSPMNAWVHREGFARFSHSRYSTDSVDDAFVHLTNVAVAKTAADY--DPERGLKWSLPKLFRFFKSMHGQSKVSKTMNELAKVIIESLKSVQNLIIQD---SHCFELYGYDILFDENLKPWLLEVNASPSLSSQEDFELKYRVLNHMID-VLDVEKKLLGNENEIGGFDIL 384
203 0.000e+00UniRef50_A0A078B4C4 Tubulin-tyrosine ligase family protein n=5 Tax=Oxytrichidae TaxID=57506 RepID=A0A078B4C4_STYLE  ali  25  944..YYRVVKNRSEVYDIISRAFSRKRRWNELPDLRNSWNLLWTWSKIK---IDITKLIVWQKCNHFSGAKNVSRKDFLKRNIERAQKMSSKAN---QVFNMLPLTFILPKEYVGFLESFSEFED----------------KEGRLNYWIMKPAAKSRGRGISLVNDLTQI-----TYGEPIVVQRYIKNPLLI--NGYKFDMRIYVLVTSPLEVFLYKEGFGRFSTMPFSLDDKNNKYIHLTNVSIQKYNVNNSEQDPTGTKISIQTLKKRVQQAANVNWDDQIWPQIRDVVLKSMVACQNDIQFN---PCCFELFGFDILIDQDMKCWLIEINSSPSLATLLDDMIKQRLIDDIIDLVDPIDFDRKR........... 1290
204 0.000e+00UniRef50_A0A0V0QLL2 Uncharacterized protein n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0QLL2_PSEPJ  ali  21  165.YHYTVINGTG---NRVLKGTMEANGFTET--NNNDWSIMWSCNTIKSEIY--NSLMPYQKVNHFPKSIEITRKDLMNRNLSKMQIQYGLANF-----NFFPKTYILPSENHIFQDESEKA---------------------KGQWYICKPSGSSQGKGIFITDKPQEILQKLQG-GNQYVVSHYIMNPLLI--NNLKFDLRVYVVVTSPLRIYVYEDGLTRFATQEYNVGDQKNRFAHLTNYSINKNGTNFVKNDAEGSKWSLSALKDFLRIN--NLNSEQIFDRMDDLIIKTIISIEQQINHVPFRNNCFQLFGFDILIDNNYKPWLIEVNLAPSLNSPLDLKIKGGLLADIFTLIGVVPKDQR............ 507
205 0.000e+00UniRef50_A0A1R2BI72 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BI72_9CILI  ali  21  20..KKITINTALTQYEIITK-LSQSLGWRSIENEDDDSDIIWTDCAVQPER--LCKMRPYQKINHFPNMHEIARKNYLAKNLNKMHKLY------PEDFNFYPKTWLYPAEFPSLKS-----------------------TNTTKKIYIVKPEASCQGKGIFLTKTLE-----GFEENERYVIQEYIKNPLLID--GLKFDMRIYVLIADPLKVFLHKEGLGRFATEAYTSKNLSNSCMHLTNYAINKNNDNFVFNSDSGHKRSLTATLKKIKDLGFDT--EKIWKEISEIIVKTLCTIQPSLAHVYRACQCFEVLGFDIILDDIGKPWLLEVNHSPSFNSPLDFKIKFQVLREALILLNLTSDNKREYEERKKKQILL 376
206 0.000e+00UniRef50_A0A024U6I4 Uncharacterized protein n=2 Tax=Aphanomyces TaxID=100860 RepID=A0A024U6I4_9STRA  ali  21  30...KKVKINMTLAKYEVIKKIARDRGWKQITDETDKCNLHWID--IPDFVNTFKSMQPYQKVNHFPGMSNLARKSKLARNFQRMMKL------FPNEYDFCPKTWILPFDYTDFAQQFN-------------------SDGTSNRAFIIKPDHSCQGRGVFLTKNLKEV-----NKTDIFVAQRYVAHPLLL--GGKKFDLRIYIMIASPLRVYLFQDGLVRMCTAAYTPPNAENKFMHLTNYAINKLSNNFEKNDGEGSKRSLKWFMSWLREKYDDAAVDLLWHQIGDICLKSILSVQPTLSQEYQSSSCFAILGMDVLIDDNLKPWLLEVNHLPSFGSPLDWNVKERLINQALDIM.................... 406
207 0.000e+00UniRef50_T1IKF4 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1IKF4_STRMM  ali  21  75........CTSGCRYDIIHEVARSMELKEVQLDDP-WIIHWTDTGVP--FDKIMEMKRYQKINHYPGMTEICRKDLLARNMNRMFKM------FPLEYSIFPLTWCLPQEYADLHHY----------------------VGHKKRTLICKPDAGCQGKGIYLVRSLKEI-----TPTDRQVVQQYINKPFLID--GYKFDLRIYVLLTQDFRIYVYKEGLARFATVQYTSKNLNNMYMHLTNYAVNRHSSHYIEDDIAGSKRKLSALTKWWED--HDYNTTEIWQRIDDSIVKTFISAAGILRHNYRSCACFEILGFDVLLDHKLNPFVLEVNLSPSYHTDLDREVKEGLIRNTLELLDDSCNPKQCKREERRK.... 417
208 0.000e+00UniRef50_A0A2R5G1J8 Tubulin polyglutamylase TTLL6 n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5G1J8_9STRA  ali  21  96......INLNQTRYQ-VVRDCAENLGWGLSDTGRGAWSIAWHDCGGITAESSISTLNPLQKINHFPGMSKICQKCKLGLTIGRL------AGSMPELFDFHPKTWSLPKEKESLRKWFQLEFASRKQRPVL----------------IVKPDGGCQGNGIFLSNELKDLDDLQGLSA----VQQYLPNPFLI--NGFKFDLRIYVVVTSPLRAFQHSQGLVRFCTVKYERENLANRFMHLTNYAVNKHNANYKDNNETGSKWSLEQLYDYLAERGHD--VEHVQRNVQDIIVKTLLSIQPSLAQDYRACRCFELLGFDIMLDAGLQPWVIEVNHSPSLHCPLDRRVKEQVVRE--SLVLGCVD............... 462
209 0.000e+00UniRef50_D2VQ09 Uncharacterized protein n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2VQ09_NAEGR  ali  22  71....IIVDLTNCKYN-VVRDACLASGWKIRKPTSNDFTVFWMDQSSAPDR--VMKLRTFQKINHFPAMGGICRKIPLARNMKRLKKS------FPDEFSFLPSSWVLPQEYCKFKSSKKII----------------------GKTYIIKPTAGCQGKGIVITQDPTDAERYGD-----CVVQLYVDRPFLID--GYKFDLRVYALVLCPLKIFMYQDGLVRICTEKYTQTNIKTECMHLTNYSVNKKSDGFENNFSVGSKRNFAFLNDYLEGKGYSP--EKVWGDVGDIINKTVLSIYPQLVSQYKTFVCFEILGFDVLLDEKMNPWLLEVNHSPSFNTPLDRHVKFNLLTETMKLAIDPNDR.............. 411
210 0.000e+00UniRef50_M7BGL2 Tubulin polyglutamylase TTLL7 n=5 Tax=Amniota TaxID=32524 RepID=M7BGL2_CHEMY  ali  22  1........................MGFVKTRDEDETANLIWSDSAVQQDKIA--ELRNYQRINHFPGMGEICRKDFLARNMTKMIKSQ------PQDYSFIPRTWIFPAEYMQFQNYV-----------------KELKKKRRQKTFIVKPANGAMGHGISLIRNGEKLQA-----QDHLIVQEYLDKPFLME--GYKFDLRVYILVTSPLKIFLYHDGLVRMGTEKYNDSNLSQLYMHLTNYSVNKHNEHFERDEDKGSKRSIKWFTEFLQTNHLD--VSKFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKKGVLLNALKLLIYPPDDK............. 330
211 0.000e+00UniRef50_A0A1R2CHP8 Uncharacterized protein n=4 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CHP8_9CILI  ali  24  120...............KLVRSILEQAGF--SYTDSHDWNLLWLGCPPQLYFYDG--LNEYQRVNHFPNSYEITRKDRMSVHLKSMQLKHGLENYG-----FFPETYVIPDEYTEF--------------------YTKYYSEKGVQ-WIVKPCNSSQGKGIFILDSLASL-----PTVEGCVVSRYIHNPLLI--NDLKFDMRIYVLVTSPLKIYIYDEGLARFASEPYSASNRASKFSFLTNYSINKKNEKFVQNKDEGHKWSISALFKTLEA--FSVDTSLLLSKIYDLIIKTIISVEPLVSQTAKRNNCFDLLGFDVIIDSNLKPWLLEVNLSPSLATPLDLFIKSNLIADTLNLVGLRFYDRKK........... 446
212 0.000e+00UniRef50_A0A077ZVB0 Tubulin-tyrosine ligase family protein n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A077ZVB0_STYLE  ali  21  185..........NGVEARLIRSLLEDNGFREATKRDQEFTVMWACSNIKSQVY--QSLTKYQKVNHFPKSTEITRKDCMYRLLARMREIH-----GPKHYGFVPLTFILPNELNELHEAMQADLSKQ---------------------WIVKPSSSSQGKGIFLTNTINDI-----PPKQSMIASQYIANPLCIDD--YKFDLRIYVAITSPLRVYIYDEGLTRFATVKYNTSKKQSRYVHLTNYSLNKYNANFINNDDQGSKWSLTALRRKFTQLGIDH--EQLFKKIDDIILKTIIAGENVINNATEMFNCFELLGFDVLIDDNLEPWLLEVNLSPSLNSPLDQKIKSNLIADLFNL..................... 509
213 0.000e+00UniRef50_A0A1S8X1A3 Tubulin-tyrosine ligase family protein (Fragment) n=2 Tax=Opisthorchis viverrini TaxID=6198 RepID=A0A1S8X1A3_9TREM  ali  21  283.YRDRLKWRPSLITPNVVKRALRRSHFMLTMKSSE-WLGYFGNHLKPLGF---RPIKEYQKVNHFPGSFQLGRKDKLWINLNQLR-----SHFGRRAVDFVPRTFCLPADTRQLREMLMRQERANHDGSA------NILGDAVVPRWIIKPPASARGIGVHVVQNITDL-----PKSRQIIVQSYISRPFLI--NNTKFDLRLYVYVTCPFKAYLHREGLVRFASQQYSLSDINNRFVHLTNYSVNRHNKHGTTGVQN-NKWKLETLWRYLLDRG--VNVDGLWMQLKDIVFKTLASVINPIDQNCRRRACHELFGFDILLDENLKPWLLEVNVSPSLHTNLDNEVKAEVVTDMLNIA.................... 625
214 0.000e+00UniRef50_UPI000DC67848 tubulin polyglutamylase TTLL13P-like isoform X4 n=2 Tax=Canis lupus dingo TaxID=286419 RepID=UPI000DC67848  ali  23  86......INLTNCKYESVRRAA-QMCGLKEV-GEDEEWTVYWTDCSVSLER--VMDMKRFQKINHFPGMTEICRKDLLARNLNRMQKLY------PTEYNIFPRTWCLPADYGDFQSY---------------------GRQRKTRTYICKPDSGCQGRGIFITRNPREI-----KPGEHMICQQYISKPFLID--GFKFDMRIYVLITSPLRIFMYEEGLARFATMPYSHNNLDDVCMHLTNYAINKHNENFVQDDAVGSKRKLSTLNAWLREHSYNP--EELWGDIEDIIIKTIISAHSVLRHNYRTCACFEILGFDILLDHKLKPWLLE............................................... 385
215 0.000e+00UniRef50_UPI000C6DF981 tubulin polyglutamylase TTLL4-like isoform X1 n=2 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6DF981  ali  23  177.....LLWKLSTITPKLITQTISRSGFRLT--EDIRWIATWGKHMRCNEFRFIRN---TQKINHFPGSFNLGRKDHLWLNIVRMQCIHN-----EEEFSFMPDTYVLPEDLIKL---------------------RQVWREENKILWIVKPPASARGIGVDVIYKWAHV-----PKTHPAVVQKYISRPFLI--NGNKFDLRIYVLVTSPLRIYVFKEGLVRFASVQYSRSYIGEKFRHLTNYSINRKNSSYKVSEDEGHKWSLKCLWDYLKTR--DINTEQLWSSIIDIVIKTLLSAYDPISYIKSRYCCYELFGFDIIFDEKLKPWLLEVNISPSLHSNLDIDVKSQLIKDMFNTVFQIPDD.............. 511
216 0.000e+00UniRef50_A4Q9E5-3 Isoform 3 of Tubulin monoglycylase TTLL3 n=26 Tax=Theria TaxID=722675 RepID=A4Q9E5-3  ali  23  198..............................................................................................DDWSQFLQRYYQIVHEGAELRYLEVQVQRCEDILQQLQNVVPQLDMEGDRNIWIVKPGAKSRGRGIMCMNRLDEMLKLVDCKDGKWIVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQRHLEASCHRHPPDNMWSSQRFQAHLQEVDAPKAWSSIVPGMKAAVIHALQTSQDNVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRRLDRSCDTGAFELI 485
217 0.000e+00UniRef50_A0A267E3V8 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267E3V8_9PLAT  ali  21  239......................................................................ITQCEQLIQNRNHDDWDTASCMSESDWYSFLQSYYRVAHHGAQIRDAKSLKSRCRQLCTELRSEYPQFDIDGCRNAWIVKPGAKSRGRGIFCVRTLESVLELLRQPPNKLVVQKYIERPLLVH--RTKFDIRQWFVVTDPLTIWWYKDCYVRFCSQHFTLNDF-NEAVHLSNNSIQYKYANRHPDLPDDNIWDCITLQTHLSSIGQNVYYDVIYPGMQKAVINSMLCSQDHVEMRK---NCFELYGADFMIDENFRPWLLEINCSPTMSTEVTTRLCRNVQDDILKVVV---DRRQNRACNTGRFELI 554
218 0.000e+00UniRef50_A0CC74 Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0CC74_PARTE  ali  21  26....LIVNVSSSQYPVIRHVGKKILNWKIQKDENTNWDVWWTDGAV--FSDLLGRMSSHQKVNHFPGMYSLARKNHLGRNLMKMHKQ------FPQAYNYFPYTWLLPAELSDFRANI-----------------------GKNRTFIIKPEASCQGKGIMLVKDAEGLSIH-----EHYVAQRYLSKPYLID--GLKFDLRIYVLLADPLRIYIFKEGLARFATEQYKKDNLDNICMHLTNYAVNKDNENFIKQMDVGHKRSMTSVFELLRSRGEN--VDLLWNTIKKMMIKTFCAVQPILAHQYKSCQCFEVLGMDVILDHKLKPYLLEVNHSPSFTTPLDAAIKRQLISQSL-ILMNCTQKAKQESINQEK.... 375
219 0.000e+00UniRef50_J9GDB1 Tubulin tyrosine ligase-like family, member 5 n=2 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9GDB1_9SPIT  ali  20  129...............RLVKFLFESNGLVCT--DRHDWDVLWTHTQGKTYFYE--RLNQTQKINHFPNSTELTKKDRMAFNIRKMQNKYSRTYF-----NFIPETFILPDQFQEFQESFELQERSVYQSTQGQGEGSLNQKPIRKNYWIVKPPSSSRGRGIFIIDNLSQV-----PRHENLVISRYIDNPLLL--FGHKFDLRIYVVVTSPLRIYLYREGLVRFASEKYDITKFNDKYSHLTNYSINKNNENFVQNDDSGFKWSFSALCEHFQDQGID--VNLMWSKIYDVIIKSSLSIDDHVNSQIRRNNCYELFGYDIILDNNLNPWLLEVNLSPSLASPLDLKIKGNLLKDTFNLI.................... 472
220 0.000e+00UniRef50_M3WNJ6 Uncharacterized protein n=64 Tax=Theria TaxID=722675 RepID=M3WNJ6_FELCA  ali  24  434................................................................................................WSLFLQRYYQVVHEGAELRHLDTQIQRCEDILQQLRAVVPQIDMEGDRNVWIVKPGAKSRGRGIMCMDHLEEMLKLVDGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPSDNMWSSQKFQAHLQEMGAPNAWSTIIPGMKAAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRRLDRNCDTGAFELI 719
221 0.000e+00UniRef50_T2MJG8 Tubulin polyglutamylase TTLL13 (Fragment) n=6 Tax=Metazoa TaxID=33208 RepID=T2MJG8_HYDVU  ali  23  48............................................................KINHFPGMSEICRKDLLARNMNRLWKQ------FPKDFVIFPRTWCIPADFGDFLTFC---------------------RAKKNKTFIFKPDSGSQGKGIYLAKNLKNF-----KPESNLICQQYLSRPFLID--GFKFDLRIYVVVTSPLRIFVYKDGLARFATVKYAKNNLNNVFMHLTNYAIQKNSVGYCRDNETGSKRKLSTINRWFQENGYD--VKKIWKNIDDIIIKTLITAHPVLKHNYLTCACFEILGFDVILDRNLKPWILEVNHSPSFTTDLDREIKDAVVYDTLVLANFSLNDKRKCLEDERK.... 339
222 0.000e+00UniRef50_T2MC20 Probable tubulin polyglutamylase TTLL9 (Fragment) n=3 Tax=Eumetazoa TaxID=6072 RepID=T2MC20_HYDVU  ali  20  1.................................DGDWDFIWSDKCGIHEIYDNQYLDEHVKLNHFRNHYELTRKNLMAKNLKRLKKHIEREKMEANSCDFFPATFELPGEYHMFVEEFKR---------------------NPGKLWIMKPIAKSQGKGIFLFKKLKDITDWRKEQPEAYIVQRYIDNPYLI--NGRKFDLRVYVLVTSPMKAWLYREGFARLTNSRYNLNSIDDQFVHLTNVAIQKTAPDY---DPEGSKWSIHQLRLYLTAKHGVQVVKDLFRLMDIIFIKSLQSVQRVMINDK---HCFELYGYDILIDADLKPWLCEINASPSLSNQTDYNIKVAMLSDVLNVL.................... 330
223 0.000e+00UniRef50_E4XRE6 Uncharacterized protein n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4XRE6_OIKDI  ali  22  1..............................................MHERFDTIYFEEHMRVNHFPRFYELTRKNLLAKNLKRFIKLKKSSKQIDQIMSFFPTTYDLPDQWHMFVEEFKK---------------ERNHNRADKPIWIMKPVSKSQGRGIFLFRDLKDIQDWKRDEAETYIVQRYIEQPLLI--GGKKFDMRIYVLVTSPLRAWVYREGFVRFSGTRYSLDQIEDTFVHLTNVAIQKTAPDY--NPDRGAKWPLMNLRRYMETSRGIQVSNAAFRRINEMFWYSLLAVQDKVINDK---HCFELYGYDVLFDESLNVWLIEVNASPSFSSEDDKSLKLRVLDDTFNVV-DMEKKLTGAETRIGGFDLL 330
224 0.000e+00UniRef50_A0A1I7Z5J0 Uncharacterized protein n=1 Tax=Steinernema glaseri TaxID=37863 RepID=A0A1I7Z5J0_9BILA  ali  23  91................LIKTLLHSYGFTQCSSRNPNFNVLWTGTHLPAH--TMRSLAPWQRINHFPRSFELTRKDRCYLNIDRAKKFFSSTAF-----DFIPEFYVTPNHTEQL-------------RKVFAEEEGQG-----KAPFIVKPARSSRGRGISIAEKIDEVPLNS----HMMLVSRYIDDPLLVK--GHKFDLRIYVLVTSPLIVYVYNDGLARFASEKYQSGSYGQTFSHLTNYSLNKFSKDFEKNDDAGHKWTLGGLLKRLHKDGIDT--ELMMVRIEDLIVKTLLSVQNRIAAACRSKCCFELFGFDVLIDSDLKPWLLEVNLSPSLACPLDSVLKTRLVCDAFNVACIPL................ 418
225 0.000e+00UniRef50_J9EYW7 Putative beta-tubulin polyglutamylase n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9EYW7_9SPIT  ali  20  28....ITFNAFNTQYSIIKDIARKEFGWRVISQKDPDWDIQWTDLAPPLEKFP--KIKPYQKINHFPGMFNIARKNYLARNLKKMKKQ------FPADYKFFPKTWLLP-----------------YELMELKNVSQNYSKKNVKVNFIVKPECMSQGKGIFITRKVEQI-----NPDEHLVVQKYMRNPYLID--GYKFDLRIYVLVTNPLRIFMHHEGLARFASEKYKLKAFNNPFIHLTNYAINKDNENFTADEETGHKRSLQSIFTQLEKDGLDI--PILKEKMHEIIVKTLISIQPDLVHQYRTSQCFEILGFDIILDQKGRPQLLEVNHAPSFNTPLDKQVKRNLLIDTFRLL.................... 366
226 0.000e+00UniRef50_A0A2C9KA21 Uncharacterized protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9KA21_BIOGL  ali  21  818..RKLLKWKLSPITPIVVKTAIGRIGFRITKKNYE-WMGCFGKHMKAQCF---KQLRDFQKLNHFPGSFNIGRKDKLWRNLSRMQ-----AHFGKKEFNFFPQTFVLPTDNKLLKRIWE--------------------EGSGKQKWIVKPPASARGQGIRVISKWSQV-----PRKRPVIVQKYIHSPYLI--NGSKFDMRIYVYVSSPLRLYVYNDGLARFASSKYSSSTKSNRFIHLTNYSVNKKNTQYVSNSNEGHKWSLKSLWDYLKQRG--VNTTAVWNTIKDLIIKTIISGDSSINNVHSRYCCHELFGFDVLLDENCKPWILEVNISPSLHSNLDVDIKSGLIKDMMNIALRLPDARDTHPNST...... 1165
227 0.000e+00UniRef50_UPI00094E511E tubulin polyglutamylase ttll6-like isoform X1 n=2 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094E511E  ali  22  46......INLTNCRYDSVRRAA-EKLGIKEAKA-GEDWTLFWSD--ARPCEDKFKEMKPYQKINHLPSMTEICHKNSLATNWKHM------LKFFPKDYNIFPRTWTFPIEYGLFKSYARDKDKC----------------------YICKPNTGSQGKGISIFTSWEKV-----QPEQDMICQEYIDKPLLID--GFKFDMRIYVLVTSPWRIYMYNEGLARFCTIKYTDENVNNKFMHLTNFTINKDSETFINDEQTGSKRKLSTLKKQLRSNYRNT--EKIWSNIEDGIVKTLVLAHSRIQHGYITSACFQILGFDVLLDEHFRPWVLEVNHSPDFSTPLDQDVKDALLYDTLVLILAPFDRCRMIKEEKRKVE.. 390
228 0.000e+00UniRef50_UPI0008FA15A0 tubulin polyglutamylase TTLL7-like n=1 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FA15A0  ali  22  4.................VRIVIEEMTFHKARDDDEMANLTWNDSAVQHEKIA--ELRNYQRINHFPGMGEICRKDCLARNMAKMIKSQ------PQEYSFIPKTWIFPAECTQFQNYV-----------------KELKRKRKQKTFIVKPANGAMGHGISLIRNCEKL-----PVQDHFIVQEYLDKPFLME--GYKFDLRFYILVTSPLRVFLYNDGLVRMGTEKYNESNLNQLYMHLTNYSVNKHNENFERDEDKGSKRSIGWFTEFLRTNDYDVA--KFWGDVSELVVKTLIVAEPHVLHAYRMCRCFEVLGFDIILDRKLKPWLLEINRAPSFGTDIDYDVKKGVLLNTLKLLIRASDKRRN........... 339
229 0.000e+00UniRef50_U6PC61 Uncharacterized protein n=1 Tax=Haemonchus contortus TaxID=6289 RepID=U6PC61_HAECO  ali  24  647...FKLVNSDT----KLVKTVLHSHGFTQCSRKNPLFNILWCGSAMRAT--LMRNIKPWQRLNQFPKSTELTRKDKLYDNIAR------SAGLFGDAFDFIPEFFVTPRDLLLLEKAVKQLTAD--------------------STFIVKPVSSSRGQGIFFASTIEEI-----PKADTLLVSRYVENPLLVY--GHKFDLRIYVAVTSPLIVYVYSEGLTRVASEKYCSGDSRDAFIHLTNYSINKNNSNFVRNEDFGHKWTLGALLRHLEKDRIDSKM--LMLRIEDIIIKTLLSVQTRITSACRTSTNFELFGFDILVDAKLKPWLLEVNLSPSLSCPLDSLVKTRLICDLFNLAVPLVNRK............. 983
230 0.000e+00UniRef50_T1HAB9 Uncharacterized protein n=1 Tax=Rhodnius prolixus TaxID=13249 RepID=T1HAB9_RHOPR  ali  22  485.....................FEKRGWAQVGPD-EDWNFYWQTCRALFSLDSGYRMNDHQMINHFPNHYELTRKDLLVKNIKRYRKELEREGNNYIYLDFIPVTYVLPAD-----------------YNMFVEEYRK----NPQSTWIMKPVGKSQGAGIFLINKLSKLKRWSREAKETYVISRYIDNPLLI--GGKKFDLRLYVLVTSPLKAYLFKLGFCRFCTVKYSMQDLDNIFVHLTNVSVQRHGGDYNSMH--GGKLSIENLRLYLESTRGKEVTDKLFKNIIWLIIHSLRSVSYIMANDK---HCFECYGYDIIIDNNLKPWLIEVNASPSLTSTTDRILKHKLIDNILSVVVPP................. 826
231 0.000e+00UniRef50_UPI0009A2A8DA LOW QUALITY PROTEIN: probable tubulin polyglutamylase TTLL2 n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A2A8DA  ali  23  11..TKSLVFRLHEGTPEIVRHVLLERGWVEFNEDENDWNLYWRSGFSNAEYENIM---PWQRLIHYPKIMGITRKDNLARNLKRMSGVYGSTT-----YNFSPIAFILPNDYTKFVAEYTK---------------DKKANGGKLGYWICKPVDLSRGRGIFIFQDIKDL-----TYSCSVIVQKYISNPLLI--SGYKFDLRIYVCVTSPLMVYIYQEGLVRFGTEKYNLASLDNVYAHLTNTSINRFGPSYKERVGSGCKWTMSQFRAFLHSL--NINEPLMWQRISNIVTMTLLTITPSIPS---PPNCLELFGFDILIDDNIKPWLLEVNYSPALMVDCDVIVKKGLLYDLIDLL----NYKEVDRLRQRGY... 354
232 0.000e+00UniRef50_A0A078AQY2 Tubulin-tyrosine ligase family protein n=1 Tax=Stylonychia lemnae TaxID=5949 RepID=A0A078AQY2_STYLE  ali  22  108.NKRVTINVYCTEYEIVKKVSRKVNNFKELEEDHEGWDISWHDLAITPDY--MSKMQSYQKVNHFPGMYVVCRKNFLARNLMKMQRQ------FPDEYSFFPKTWLLPSEQIEFRNQFTTVSLN----------GKSNPKQGKKKTYIVKPEALSQGKGIFLSRSMEEIMDSC--QNEGCVVQRYIHQPYLIDD--LKFDLRIYVMLVNPLRIYFHEQGLARFATEEYQNSNLDNLYMHLTNYAINKNNDKFQQNEDEGHKRSLNAILCLLKQEGHDP--ERLLREIKDIIVKTLVIGQPYLSHLYKSCQCFQILGFDVILDHKCKPWLLEVNQSPSFSTPLDYKIKKQVIGDAFNLLNCSHERRQ............ 484
233 0.000e+00UniRef50_A0A2H1VC80 SFRICE_026684 (Fragment) n=3 Tax=Spodoptera TaxID=7106 RepID=A0A2H1VC80_SPOFR  ali  22  88.....IRKSLSLLYET---DVCAERGWRMYPGYEERWNLWWKTSAFPAASY--KTLGDWQFMNHIPKGGSICRKDNLSRLLRCMKRIYGA------VYDFSPPCYHLPLEYAKLVSECSRLRRDEN-------------GAGANVVWIHKPVAQSQGRGIFLFRSLCEM-----NCGTSAVVQRYIERPLLI--AGYKFDLRLYVCVPGPLTAYMYAEGLARFGTDKYTLSDIHNPYRHLTNSSLNKRYAECKDRIGSGCKWTLTQVRKALIGRWGAAEW-VVWQRIRALVTLTLLAQAAGTPPAR---NCFEFYGFDVLLDDCLKPWLLEVNLSPALASDCDIVVKQPMLHELFDLLGLPMK............... 421
234 0.000e+00UniRef50_A0A2I2U6P2 Tubulin tyrosine ligase like 8 n=6 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2I2U6P2_FELCA  ali  23  133..............................................................................................DEWKDLTRQYYSLVDGDAFISNSRNHFSQCQALLNKITSVNPQTEIDGLRNIWIIKPAAKSRGRDIVCMNRVEDILQLVSAKDNKWVVQKYIETPLLIYD--TKFDIRQWFLVTDPLTIWFYKESYLRFSTQRFSLDNL-DSAIHLCNNSIQKHLKNDEERLPYHNMWTSTRFREYLQKRGRGAVWSVIYPAMKRAVANTMRGVQDHVEPRK---NSFELYGADFILGRDFQPWLIEINSSPSMHTPVTAQLCAQVQEDTIKVVV---GRKVDRNCDVGNFELL 420
235 0.000e+00UniRef50_H2N6Y1 Tubulin tyrosine ligase like 7 n=9 Tax=Boreoeutheria TaxID=1437010 RepID=H2N6Y1_PONAB  ali  23  51...............EIVRLVIDEMGFMKTPDEDETSNLIWCDSAVQQEKIS--ELQNYQRINHFPGMGEICRKDFLARNMTKMIKSR------PLDYTFVPRTWIFPA-----------------EYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKL-----PSQDHLIVQEYIEKPFLME--GYKFDLRIYILVTSPLKIFLYHDGLVRMGTEKYNESNLTQLYMHLTNYSVNKHNERFERDETEGSKRSIKWFTEFLQANQHDVA--KFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKRGVLLNALKLIYPPEDK.............. 389
236 0.000e+00UniRef50_A0DAT4 Uncharacterized protein n=2 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0DAT4_PARTE  ali  21  117.YYYKFG----SSPIKLVKGLLEENGFKE--NNDKNWTLYWSSCAIRSEIYT--NLFAYQKVCHFPKSYEMTRKDLMHRNISKMQINHGFINF-----NFIPKTYILPAEMSYFLEEHEK-------------------IKNNNPVYICKPHASSQGKGIFITDKIQDILNKQNS-NNSYVVSHYIDKPLLI--NNLKFDLRIYVAITCPLRIYVYQDGLARFATEAYNPDSVQNRFVHLTNYSVNKDSPNFVANQDPGSKWSLLALREYLKLNKINE--QQIFERIEDLIIKTIISVESAIMNVPFRSNCFSLFGFDVLVDQFLKPWLLEVNFSPSLNIPLDLKIKGEMLADLFTLIIVPLDQR............. 459
237 0.000e+00UniRef50_A0A1V9Z3G8 Tubulin polyglutamylase n=2 Tax=Saprolegniaceae TaxID=4764 RepID=A0A1V9Z3G8_9STRA  ali  20  19...KKLKVNMTLAKYEVIKKIARDRGWKMVTDEEDKCTLHWID--VPDFLSTFKHMQPFQKVNHFPGMSNLARKSKLARNFQRM------TKLFPTQYDFCPKTWILPFDYTEFSQQFN-------------------ADGISQRAFIIKPDHSCQGRGVFLTKNLKDV-----NKTDIFVAQRYITAPLLI--SGKKFDLRIYVLISSPLRVYLFQDGLVRMCTADYTAPNADNKFMHLTNYAINKRSNNFEKNKDEGSKRSLRWFLSWLETKFDKEAVAALWDGIGDICLKSILAVQPTIAQEYQSSSSFAVLGMDVLVDEHLKPWLLEVNHLPSFHSPLDWNIKERLLSQTLDIMQISVD............... 380
238 0.000e+00UniRef50_A1L250 Zgc:158648 n=9 Tax=Euteleostomi TaxID=117571 RepID=A1L250_DANRE  ali  22  42...FITANVIGTKY-EIVRIVIEELTFHKARDDDETANLIWNDSAVQHEKIA--ELRNYQRINHFPGMGEICRKDCLARNMAKMIKSQ------PQEYSFIPKTWIFPAECTQFQNYV-----------------KELKRKGKQKTFIVKPANGAMGHGISLIRNCEKL-----PVQDHFIVQEYLDKPFLME--GYKFDLRFYILVTSPLRVFLYNDGLVRMGTEKYNESNLNQLYMHLTNYSVNKHNENFERDEDKGSKRSIGWFTEFLRINDYDVA--KFWGDVSELVVKTLLVAEPHVLHAYRMCRCFEVLGFDIILDRKLKPWLLEINRAPSFGTDIDYDVKKG............................. 371
239 0.000e+00UniRef50_A0A1W0A9U9 Tubulin-tyrosine ligase family (Fragment) n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1W0A9U9_9STRA  ali  23  387..............................................MFNPENGIRLTDGQYINHFPNHYELTRKDLMVKNIKRYKKEAEKDPTLAEKLDFIPTTYTLPAD-----------------YSLFVEEFRR----NPNVMWIMKPCSKAQGKGIFIINKLSQTKKWATAKSEGYVVSRYIENPLLI--GGKKFDLRMYVLVISPLQAFVYSEGFARFCNVKYSTDDMDNPFMHLTNVAVQKHNEDYNSKH--GGKWNIYNLRLYVEATRGRGEADKMLSAIQHIMLHSLKAVQNVIIND---PHCFECYGYDIIIDSDLKPWLVEVNASPSLSTTTDRNMKSRLLRDVLELVNDTVDARRNPELSTNGFE.. 701
240 0.000e+00UniRef50_B0XKZ1 uncharacterized protein n=1 Tax=Culex quinquefasciatus TaxID=7176 RepID=B0XKZ1_CULQU  ali  21  498...............................SKTNDWVGIWGKHMKSPCFKT---LRPYQKFNHLPGSFQIGRKDRVWRNL-----QTQMNRHGKKEFGFMPRTYIIPQD-----------------LKLLRQMWPRYSQRGCK--WIIKPPASARGTGIKVVNRWSQI-----PKRKPLIVQRYVERPLLI--NGSKFDLRLYVLVTSPLRVYMHTDGLARFASVKYSSDTLSDRYMHLTNYSINKLSDKYSANEDQGHKWTIKSLWTYFNEKG--VNTDRLWGALRNLVLRTVLAGEGPILNVGNRYNCYELFGIDVLLDSELVPWLLEVNISPSLHSALDAHVKGPLVKALLNTAMYQVPPR............. 810
241 0.000e+00UniRef50_A0A077ZVC4 Tubulin-tyrosine ligase family n=6 Tax=Eukaryota TaxID=2759 RepID=A0A077ZVC4_STYLE  ali  26  31......IKFKTTFRNCVVDS-LKKRGWKEVEG--EDWDLLWVERDCIYEILNHFHLQSHQKVNHYRNHYELTRKDLMVKNLKRYKKQLEKEGKYEEAFNFFPTTYNLPGDYSLFVEEFKKTL---------------------GSVWIMKPIAKSQGKG------------------------RYIINPLLI--GGKKFDMRIYCLVTSPLTAYLYRTGFGRFTHHRYTTEDIANNYVHLTNVAIQKTSENYDERL--GGKWDLRSMKLYLMSKYGQEKVSDAFSQIQELIIKCLQSVQKTIINDK---HCFELYGFDVLFDSNLKPWLIEINASPSMTTPNDYEMKIGLLDDTFT-TLDLEKILSGTEEQIGGFDLI 354
242 0.000e+00UniRef50_E2B9H3 Probable tubulin polyglutamylase TTLL9 n=12 Tax=Hymenoptera TaxID=7399 RepID=E2B9H3_HARSA  ali  20  52..................EVMLARGWTQIADPADGSWHLWWCETVEARRALEERRLLPRQRVPHFRNHYELTCKHRLGRNLKRYRRTLAAAGKAAEARICSPVTFELPADYRIFVEEYHRQQ---------------------GATWIVKPAAQSRGKGIFLFRKLKDLIEWKSKSQHQYIVQRYIDNPYLV--AGRKFDLRIYVLVTSPLKVWLAREGFARLCGRLFDLKNIEDSRVHLTNIAIQLKAIQNAQNSPSDCKWALSKLKEYLITYHGAQTVENLMQRIAGIIMASLLAVQPVMMQDR---NCFELYGYDVLLSDDLRPWLLEVNASPALTTDEDYRLKFDLIDDVLN-VLDFEGRFSGRETRIGGLDLL 405
243 0.000e+00UniRef50_A8IQM3 Flagellar associated protein, tubulin tyrosine ligase-like protein (Fragment) n=6 Tax=Eukaryota TaxID=2759 RepID=A8IQM3_CHLRE  ali  21  10.....IKW-RSSLKNTIYDVLQSKTEWVETESE-TDWDFFWADKGWIHHELDKLHLADWQRINHFPNHYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFPLTYVVP-----------------SEYRMFVEEFKR-----SGGVWIMKPIGKAQGQGIFLFNKLSQVGEKKEERPETYLAQRYLEAPYLV--GGKKFDLRIYALVTSPLRIFLHRSGFARFTNTRYSTEDITNTYMHLTNVAIQKHAPGFDSQ--KGMKWSIRSLRTYITTKHGEAAAAELFHAIQNIIIRALLAVQPAMINDK---HCFELYGYDVMIDANLKPWLIEVNASPSLTASADWVLKTAMLEDLLDIV-DLEGRREKVELRLGGFDLI 396
244 0.000e+00UniRef50_A8I2I6 Predicted protein (Fragment) n=4 Tax=Eukaryota TaxID=2759 RepID=A8I2I6_CHLRE  ali  19  3.....IRWRCDLDKPVLIQN-FKRRGWIDVSAELEDWDLWWAQSVKQLFGDSMTRLHPHQRINHFPNHYELTRKDLMVKNIKRYQKQVKREGGTAAELDIIPATYVLPQDYMLFAEEFRRCG---------------SSSGSGGTTWIMKPSSKSQGKGIFLINKLSQIKQWRREPEGKWCACH-ADAMFVILIGGKKFDMRIYVVVTSPLRVHVSNLGFCRFCNVKYSAEELENEFMHLTNVAIQQHGQDY--NEHHGNKWPLADMRLLLEATRGPEAAERLFADIDGVILKSLRACQNIIVNDR---HCFELYGYDIIIDDTLKPWLIEVNASPSLSTTTDRLLKHRVISDTLNLVSPP................. 349
245 0.000e+00UniRef50_D8REA7 Uncharacterized protein (Fragment) n=3 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8REA7_SELML  ali  23  71.....VRVDLSHCKYEVMRNVIGKLGWQEALDDRPS-HLYWTDSSIGPERLMA--LKHGQKVNHFFGMLQICRKKSLARHLSTMRKM------FPAEYRFFPRAYILPNQLQEFLTRF---------------------RSPKLRTYILKPDNGSQGKGVALVQNIADVKQAIGGFGANMLAQKYVTNPMLI--NGYKFDLRIYTLILSPLRLYLYREGLVRFCTMKYTRENLRHSCMHLTNYSLNKLHPNFEYNDDRGSKWSLSGLYRAMAARGYDT--KKLKRQIKKMVVMTFIAIAPYLSHNYHTCSCFEVLGLDVLIDDKCKPWLLEVNHSPSFSTPLDLKVKEALLSDTLSLI.................... 410
246 0.000e+00UniRef50_A0A0V0Q9L4 Uncharacterized protein n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0Q9L4_PSEPJ  ali  23  72...KIVFNVADCKYRVVYFVGKKLLKWRQYEQDKTDWDITWTDNAVQPE--QLGKMGHHQKINHFPGMYVLSRKNNLGRLLMKMKKQ------FPDHYKFFPQTWILPADFSDFKNQFDKK------------------VKGKAKTYIVKPSAGCQGRGIYLTRNLEEVE------NEPCVIQRYMHKPYLID--GLKFDLRIYVLVVDPLRIFVFEEGLTRFSTQPYTADNLDDLCMHLTNYAINKDNPNFDQKMDVGHKRSLASTYAYLEKEGHDI--EKLKREINDIIIKTLCCGQPVLAHEYKACQCFELLGLDVFLDDKLKPYVLEVNHTPSFSTPLDSLIKKNAIRDALKIMINLKNRNEIVQQRKEIMQK. 431
247 0.000e+00UniRef50_A0A0K0J860 BMA-TTLL-5 n=8 Tax=Onchocercidae TaxID=6296 RepID=A0A0K0J860_BRUMA  ali  22  57..KYHLRFKMIKCNQALVKTILHSYGFEQCSSRNSNCNIIWTGSHLKPH--VLRSMASWQRVNHFPRSFLLTRKDKLYECLGRAQTL------FGNSYNIIPEFFVTPKDYQKFVDHFNAQSHGLK-------------------PFIVKPVASSRGNGIFIIQSPGGI-----PLGSPMLVSRYIENPYLV--NGYKFDLRLYVLVTSPLVAYMYSEGLARFASEKYSNKSYEQHFSHLTNYSLNKNNGKFIRNEDTGHKWTLGALLRKLQSNGIDT--NLLMVRVEDVVLKALFSVQGQVANVVHSKCCFELFGFDILIDSSLKPWLLEVNLSPSLSTPLDLQLKSSLVCNV........................ 387
248 0.000e+00UniRef50_G7Y6V8 Tubulin polyglutamylase ttll6 n=2 Tax=Opisthorchiidae TaxID=6196 RepID=G7Y6V8_CLOSI  ali  23  1.......................................................MKTWQKINHFPGMSELCRKDSLARNLNRM------AKMFPKDYAIFPKTWSLPAEWNELQAY---------------------TRKRKSRTYILKPDSGCQGRGIYLTRSIKEIR-----PMENMICQVYISKPFLID--GYKFDMRLYVLLTSPLRMYMFKDGLVRFTTIQYNQRNMHNMYMHLTNYAVQKHSDGYIRDDEEGTKRRITTLNRWFTQNGYN--LEKIWNDVDDVVIKTVLSGYAVLRHNYRTCACFEILGFDIMFDHKLKPFVLEVNHSPSFSTDLDKEIKEAMLWDTLQLV.................... 283
249 0.000e+00UniRef50_Q6ZT98 Tubulin polyglutamylase TTLL7 n=335 Tax=Gnathostomata TaxID=35060 RepID=TTLL7_HUMAN  ali  23  51...............EIVRLVIDEMGFMKTPDEDETSNLIWCDSAVQQEKIS--ELQNYQRINHFPGMGEICRKDFLARNMTKMIKSR------PLDYTFVPRTWIFPA-----------------EYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKL-----PSQDHLIVQEYIEKPFLME--GYKFDLRIYILVTSPLKIFLYHDGLVRMGTEKYNESNLTQLYMHLTNYSVNKHNEHFERDETEGSKRSIKWFTEFLQANQHDVA--KFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKRGVLLNALKLLIRTSDKRRN........... 388
250 0.000e+00UniRef50_A0A1R2C3U9 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2C3U9_9CILI  ali  24  3...KIIINLHSDCKYQILRDIASSFDWEIIEKEDTDCDLVWHDCTISPDR--LNSLKLYQKINHFPGMSGIFRKNSMANNLNRFRKL------FPNDYNFYPKTWVLPGDLASFKNTVKQR----------------------KKIYIMKPEASSQGQGIYLVRGLSDIKE-----TSHHIAQEYLINPLLID--GLKFDLRIYVLITDPLRIFIHEEGLARFATEEYSPQNFNDVFVHLTNYSINKNNPHFVQAAKKSHKRSLSSVLIQLSEIGFD--VEGIWDQICDIIVKTVITIQPSLASNYRTCQCFEILGFDIILDNNLKPWLLEVNHAPSFSTDLDAEIKTAVISEAL-ILVDIND............... 344
251 0.000e+00UniRef50_J9GC82 Putative beta-tubulin polyglutamylase n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9GC82_9SPIT  ali  20  116..............YVVVKKALRQLGYKMTDDEKADWDIFWQDTGGITPDQLSK-MQNYQRINHYVNMYQLARKNNLCRNIMRMQKT------FKSDYNFIPKTWQLPQEQTDFKTQFN------------------PANKKKVKTFIVKPVHMCQGRGIYLIRKYEDLE---MKPGEQYVAQRYMTKPYLID--GLKFDLRIYALVYDPLRVFVYQEGLGRFATEEYTNGNLDNLFMHLTNYAINKNSDNFIEDDSSGHKRSLTAVFDYIRQNEPQCDVDKLWQDIQDMIAKTLISIQPTLQHGYRSCQCFEVLGFDVILDHKIKPYILEVNHAASFATPLDKKIKLDLMKDTFTLL.................... 449
252 0.000e+00UniRef50_UPI000454AAC8 tubulin monoglycylase TTLL3 isoform X4 n=3 Tax=Euarchontoglires TaxID=314146 RepID=UPI000454AAC8  ali  23  251...........................RMVRNETPY--LIWTTRR---DVLDCRFLAKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEA-----DADSFFPRCYSSPSEGAELKHLEVQVQRCEDILQQLRAVVPQIDMEGDRNIWIVKPGAKSRGRGIVCMDHLEEMLKLVDCKDGKWIVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQRYLETSCHRHPSDNMWSSQRFQAHLQEMGAPNAWSSIVPGMKAAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFRPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRRLDRTCDTGAFELI 626
253 0.000e+00UniRef50_A9V7H2 Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V7H2_MONBE  ali  23  227..................................SNWVGTWGKHMKPEAFRL---LRADQKVNHFPGSFQLGRKDRLWKNLAKMQ-----ARFGREHFDFIPETFCLPSDLHLLKRAW--------------------DAAGSKGKWILKPNASARGIGIKVVFEWSKI-----PKNKSVIVQRYLANPLLV--NETKSDLRIYAYVTSPLRVYICREGLARFATQKYTTKSLKNRYMHLTNYSVNKKSSDFISNSNKGHKWGLQAFFKRLRADGYDT--DRIWKSIEEIVLKTLIAVEGSINNCKHRSLCHELFGFDIMLESNLKPYLIEVNISPSMGSQLDRDIKGRLLRDVFNLA.................... 528
254 0.000e+00UniRef50_A0A210Q8G0 Tubulin polyglutamylase TTLL7 n=10 Tax=Bilateria TaxID=33213 RepID=A0A210Q8G0_MIZYE  ali  19  95....ITVNLSGTRYD-IIRQMSEKLGYVVAKEDDPNSYLFWNDCFVATDRIS--EMKSFQRINHFPGMGEITRKDCLARNMAKVQKQL------PDDFSFSPKTWILPADHSLLLNYAKDLRAKKKTKTFIIK-----------------PSNGAQGHGIQLFRNAEKI-----PQAEHFIVQEYIDKPLLMD--GYKFDLRIYVLVTSPLRVFLFDDGLVRLSTEKYTEANINHSFMHLTNYSVNKHNEFYEKGDSSGSKRSVQFFREYLRQN--DINDGVLWQNIGDMIVKTLIVSEPHLLHAYRMCRCFEVLGFDVLIDRKLRPWLLEINRSPSFGTDVDYDIKSALIEDTIRLLIKISDKSRNAEARKRLF... 455
255 0.000e+00UniRef50_H3AD66 Uncharacterized protein n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=H3AD66_LATCH  ali  24  294...............................................................................................EWEVFVQQYYQVVHDDALIENSMNYVDQCLWTLQRLKGVNPQLEIEGVRNIWIVKPGAKSRGRGIICMNRLEEMLKLVDCKDGKWVVQKYIERPLLIFD--TKFDVRQWFLVTDPMTIWFYRDCYLRFSTQPFSLHNLE-ASIHLCNNSIQKHYENSNSQVPSDNMWSSDQFRAHLQKTGGDVWSEIIFPGMKSAVIHVMQTAQDVVEFRK---NSFELYGADFMFGEDFRPWLIEINASPTMSTTVTTQLCTSVQEDTLKVVV---DRRMNRNCSTGQFELI 580
256 0.000e+00UniRef50_A0A1I8HL04 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8HL04_9PLAT  ali  23  186........CLTNCKYEVVQKAAQKFGLKEVEEDDE-WNVLWTDTYVSMDR--ACSMKKYQKINHFPGMSEICRKDCLGRNLARMRKL------FPKEYNFAPRTWVLPADYGDFQAY--------------------ARANKKHRTYIVKPDAGCQGKGIWFTRNPKDI-----KPGDNQVCQLYVSKPLLID--GYKFDLRIYVLVTSPLKIFVFKEGLARFTTVKYTAGNLENVFMHLTNYAVQKNRKDFVRNDEEGTKRH-----NY-------------------------RSCFP---NHVKGSACFEILGFDILLDRKLRPIVLEVNHSPSFTTDLDKEIKEALIWDTLHLIIGAVDKKKKRKVRERLFQR. 499
257 0.000e+00UniRef50_A0A1X7VFQ0 Uncharacterized protein n=2 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VFQ0_AMPQE  ali  22  74.................VQSVLFAHGFTRVRNESPLFNILWTWTH--PNLSVVRNLKWFQRINHFLRSEQITHKDYLCMNVQRMQKS-----KGFKNFNIIPQTFVLPSEMPYFKETF-----------------------RKGSVWIVKPCHSSRGRRIYLINNPSQICSV-----EPVVVSRYIDNPLCI--NGFKFDLRLYVAVTSPIRIYLYSEGLGRFAAEPYSKENLTNLYMHLTNYSINKTHPDFIEVENHGNKWSLSAILNHLRRKGYNI--QELMMSIEDAVIKTIISGEVPIASASRHFNCFELFGFDILIDESLKPWILEVNLSPSLTSPLDFKIKSNLITDLMSLIGIPVQD.............. 397
258 0.000e+00UniRef50_UPI000788E4A5 tubulin monoglycylase TTLL3 isoform X3 n=2 Tax=Rousettus aegyptiacus TaxID=9407 RepID=UPI000788E4A5  ali  24  477................................................................................................WSLFLQRYYQVVHDGAELRHLDTQVQRCEDILQQLRAVVPQMDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVDSKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCRRHPQDNMWSSQKFQAHLQDMGAPNAWSTIIPGMKTAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTSVTAQLCAGVQADTLRVVI---DRRLDRNCDTGAFELI 762
259 0.000e+00UniRef50_F1QP95 Tubulin tyrosine ligase n=43 Tax=Euteleostomi TaxID=117571 RepID=F1QP95_DANRE  ali  81  5IYTFVLRDDTSTVYAEVAKILTSTGKWKRLKKDNPRFNLMLGERNRLPFGRLGHEPGLMQLVNYYRGADKLCRKASLVKIIKTSPELKDSCNWFPESYIIYPTNLNTPVAPATNGISHMKSNPKTDEREVFLASYNSRKESGDGTVWIAKSSAGAKGAGILISHDANQLLEFIDNQGQVHVIQKYLEKPLLLEPGHRKFDIRSWVLVDHQYNIYLYREGVLRTSSEPYNSSDLQNMTSHLTNHCIQKEHSQNYGRYEEGNEMFFDEFKQYLLNTHNLAMETSILPQIKHIIRSCLACIEPAISTKHLSYQSFQLFGFDFMLDESFKVWLIEINGAPACAQKLYPELCQGIVDVAISTVF................... 363
260 0.000e+00UniRef50_A0A183I055 Uncharacterized protein n=2 Tax=Onchocerca TaxID=6281 RepID=A0A183I055_9BILA  ali  23  51..KYHLRFKMIKCNQALVKTILHSYGFEQCSSRNPNCNIIWTSSHLKP--QVLRAMASWQRVNHFPRSFLLTRKDKLYECLGRSQIL------FGDSYNIIPEFFVTPKDYQKFVDHFNAQSHGLK-------------------PFIVKPVASSRGNGIFIIQSPGDI-----PLGSPLLVSRYIENPYLL--NGHKFDLRLYVLVTSPLIAYIYSEGLARFASEKYSAKSYEQHFSHLTNYSLNKNNGKFIRNEDSGHKWTLGALLRKLQSNGIDT--NLLMVRVEDVVLKALFSVQGQIAAASHSKCCFELFGFDILIDTGLKPWLLEVNLSPSLSTPLDLQLKSSLVCNVLTLAAVPLVPQK............ 394
261 0.000e+00UniRef50_J9IWS9 Putative beta-tubulin polyglutamylase n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9IWS9_9SPIT  ali  22  264...KLIVNVYHCRYDVVREVASDNFQMRICEEDNLDYDIFWSDTGMPPEK--LQKLKPYQRLNHFPGMYVLARKNHLGKHLNKMRR------RFDKEYDFFPRTWMLPSEMADLKAFNQSCQE-----------------KNIKNVFIIKPEASCQGKGIYLTKNINDI-----ELTDHCVVQKYINKPYLMD--GLKFDLRIYVLVYDPLRIFLYKDGLTRLATETYNNNNIDEMCMHLTNYAVNKFSSNFAKNDSVGHKRSLKYTMRYLKQQKG-EDVETLWENIKDIIVKTMIAGLPTLHHNYKSCQCFEILGFDIMIDNKCRPILLEVNHSPSFSTPLDYKIKSELIRDTIRLLGLSSKRKQ............ 618
262 0.000e+00UniRef50_A0A2P4XLN3 Tubulin-tyrosine ligase family n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4XLN3_9STRA  ali  21  158....KFRWRVDAEKNVVV-WNFERRGWTKTEGD--DWNIYWTSIKNMFNPETGIRLVDGQYVNHFPNHYELTRKDLMVKNIKRYKKEMLAAAWSNDALDFLPTTYTLPAD-----------------YSLFVEEFRR----NPNAMWIMKPCSKAQGKGIFIINKLSQTKKWANQRKEGYVVSRYIENPLLV--GGKKFDLRMYVLVLSPMQALVYREGFARFCNVKYSVDDMDNPFMHLTNVAVQKNNEDYNSNH--GGKWSVANLCLYVEATRGRGAGEKLLRDIHSVMLHALRAVQNVIIND---PHCFECYGYDIIVDDNLKPWLVEVNASPSLSTKEDRSMKSRLLRDLISVVLCCHLRRLKLQASRG..... 545
263 0.000e+00UniRef50_A0CVD0 Uncharacterized protein n=5 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0CVD0_PARTE  ali  18  37....LIINVSDTKYDVVKFVGKKIFKWIQYEPDGVNWDMFWTDAAVQPE--TLGKMQPHQKINHFPGMYSLARKNHLGRNLMKMRKQ------FPNDYKFFPQTWLLPAEYGDFKNQF---------------------VKGKVRTFIVKPEASCQGRGIFLTRSINDI-----NPTDHYVAQRYMHRPFLID--GLKFDLRIYVLLTDPMRIYVYQDGLVRFATEQYTTNNLEDVCMHLTNYAINKENPNFVFNNDAGHKRSIKSVFGKLQEEGHNI--QKLWQDMYKLFIKTFCTVQPILNHHYKSCQCFEILGMDIFINDKLRPSLLEVNHTPSFTTPLDSLIKKNLIRDTLKLMNVSLKAKEEIIASRR..... 388
264 0.000e+00UniRef50_T1J6U0 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J6U0_STRMM  ali  23  65..KKVLKWKSTSVTPVIIRKVLYNSGMRLV-KRSQQWISVWAKHMRANMFKTVLE---FQKFNHFPGTFQIGRKDTLWRNHLRLRSVHGKRS-----YDFVPTTYVIPTDMKQLRHAWEK--------------------SGTEQMWIVKPPAAARGSGIKVIHKFVQI-----PKMRPLVIQKYLQNPYLI--NGMKFDLRIYVYVTSPLRIYVHKEGLARFACALYSPSSVGDRYMHLTNFSINRNYTANEDVDAKGHKWSLKALWGFLADQGHDT--TAIWNSIVDLIIKTVISCENTVSNMRNPSSCHELFGFDVILDSKLKPWLLEVNISPSLSSKLDVFIKGQMCKDLLNLSGVMIPPHLDK.......... 407
265 0.000e+00UniRef50_E0VML8 uncharacterized protein n=2 Tax=Paraneoptera TaxID=33342 RepID=E0VML8_PEDHC  ali  23  6....................................................LQSLRSHQKVNHFPRSYELTRKDRLYKNIERVQRL-----QGFKYFDFIPQTFVLPGDYKELCLFHHRI----------------------RGPWIVKPVASSRGRGIYIVNSPDQI-----PADETLVVAKYIDDPLLVD--GYKCDLRLYVAVTSPLVIYLYEEGLVRLATVKYSGQHLWNPCMHLCNYSINKYHEDYIKSEDPGHKWTLSALLRHLKSEGKDI--SLLMQKIEDVIIKAILSVTPTIVAAPHPRNCFELYGFDILIDSTLKPWLLEVNLSPSLGSPLDVRIKSAMLTDLLTLILPVVDP.............. 297
266 0.000e+00UniRef50_UPI000C77C89B tubulin polyglutamylase TTLL4-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C77C89B  ali  21  299..KRLLKWRLSNITPAIVKRCASNSGFRLMRRTCLDWGATWGKHMKST---LFKDIKDNQKLNHFPGTFNIGRKDRLWKNYHRL-----MLKFGKSEFGFLPRTFVLPADTKLLKKVWERR--------------------GGRGRWIVKPPALARGIGISVVNKFSSI-----PKNKPLVVQRYIARPYLI--NGTKFDLRLYLLVTSPLRLYLYDDGLVRFASNKYSNDSVGDVYMHLTNYSINKNSATYSQNEDQGHKWTLKTLWRHFDEQGIDHTV--VWEKIKDLMIKTIISAEGSMANVGSRYSCYELFGFDILLDSKLKPWLIEVNI............................................ 606
267 0.000e+00UniRef50_UPI0006CF19F0 tubulin polyglutamylase TTLL4-like isoform X1 n=4 Tax=Cimex lectularius TaxID=79782 RepID=UPI0006CF19F0  ali  21  451.....LKWKLSTITPLVVRHTVQNSGFKLVRSTTNDWLGIWGRHMKSICFKT---LKDYQKINHIPGTFQIGRKDRLWKNLFRL-----MSKFGKKEFGFIPRTFILPQDMKLLRQAWDRT--------------------GSKAKWIVKPPASARGTGIKVVHKWGQI-----PKKVPVIVQKYISNPYLI--NGNKFDLRLYVLVPNPLRIYLYENGLVRFASVKYSPSTLNNRYMHLTNYSINKLSNNYAQNEDAGHKWTIKSLWTYLE---GSVNMDALWTSLEELVIKTMISGESSISNLTSRYCSYELFGVDVLLDENLRPWLLEVNISLHSSSPLDLAVKGPMVKDLLNIAFQIPNKLTQAQQDE...... 796
268 0.000e+00UniRef50_M3Y598 Tubulin tyrosine ligase like 2 n=5 Tax=Boreoeutheria TaxID=1437010 RepID=M3Y598_MUSPF  ali  22  20.............TPEVVQSVLLERGWDKFEQDVEDWNLYWRASSVRMAK--HANIKPWQRLNHPPGTTRLTRKDHLARHLRHMKTTYGAA-----LDEFVPLTFVMPNDYSKFVAEYFRQ---------------KPGAGGARSCWICKPAE-ACGRGILLFRDIKDL------FDDAYVVQKYIRNPLLV--GRYKCNLRIYACVTGPLTIYIYQGGSARFATEKVDLGNLRNSHAHLTNSSISKCGASYVEVVGHGCKWTLGRFFSSLRS--WDVDDLLLRQKI-NVVILTVLAIAPSLPVA---ANCFELFGFDILVD-NLKPWLLEVNFSPALSIDCDASVKRKLIHDTIELTYLCGLRNERAEPRDG..... 351
269 0.000e+00UniRef50_A0A0A6YYG9 Protein ARPC4-TTLL3 n=17 Tax=Amniota TaxID=32524 RepID=A0A0A6YYG9_HUMAN  ali  24  291................................................................................................WSLFLQRYYQVVHEGAELRHLDTQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPPDNMWSSQRFQAHLQEMGAPNAWSTIIPGMKDAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRMLDRNCDTGAFELI 576
270 0.000e+00UniRef50_W5NBA8 ARPC4-TTLL3 readthrough n=13 Tax=Euteleostomi TaxID=117571 RepID=W5NBA8_LEPOC  ali  25  299...............................................................................................QWEEFIHGYYQVVHEGAAIEGSDQYADRCVTVLERLREVNPQLDIDGIHNIWIVKPGAKSRGRGIVCMKRLEEILKLVDSKDSKWVVQKYLERPLLIHD--TKFDLRQWFLVTDPLTIWFYKECYLRFSTQPYSVDNL-DSSVHLCNNSIQKHLLPSARRHPDDNMWSGEQFRAFLRARGRAGQWAAVVPGMKWAVIHALQTTQDLVESRRS---SFELYGADFMLGPDLRPWLIEINASPTMSTPVTSRLCAAVQEDTIRVVI---DRRADKTCDPGGFELI 585
271 0.000e+00UniRef50_W4GDH7 Uncharacterized protein n=5 Tax=Saprolegniaceae TaxID=4764 RepID=W4GDH7_9STRA  ali  21  45.........RTSLHNTVCDVMTSLDGWEETDSD-MDWDLHWADVGWVREYFDAMQPKEHQRLNHFKNHYELTRKDLLVKNLKRMKKQQAKSELSVPPADFWSLTFVLP-----------------MEYGMFLEEFKRF----PGAMWIMKPIGKAQGKGIFLFEKLSQISDWKKDHTDTYIVQKYIENPYTI--GGKKFDLRLYVLVTSPLVVWTYRAGFGRFSNARYSKADMDNLYMHLTNASVQKTAQDYDKSM--GCKWPLDSIKQFLISKHGVRAVDSLFHDIQTVVTKSLLAVQPILIQDK---HCFELYGYDILIDSDLKPWLLEVNASPSLTTDEDYGLKWNLVAHTMQ-VIDMARHRNGSERHVGGFDLI 439
272 0.000e+00UniRef50_H3HCR5 Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3HCR5_PHYRM  ali  20  300..YYSTMRRRGHSEKNVVVWNFERRGWTKTEGD--DWNIYWTTIKNMFNPENGIRLVDGQYVNHFPNHYELTRKD-LMEAAANAASASNPAVTGPNSNLNSAAAAAEVPGSPDALDFLPTTYTLPADYSLFVEEFRR----NPNVMWIMKPCSKAQGKGIFIINKLSQTKKWANQRKEGYVVSRYIENPLLV--GGKKFDLRMYVLVLSPMQALVHREGFARFCNVKYSADDMDNPFMHLTNVAVQKNNEDYNSNH--GGKWSVANLCLYVEATRGRGAGEKLLRDIHAVMLHALRAVQNVIIND---PHSFECYGYDIIVDDNLKPWLVEVNASPSLSTTTDRNMKSRLLRDVLELAV................... 657
273 0.000e+00UniRef50_B4NC68 Uncharacterized protein n=40 Tax=Bilateria TaxID=33213 RepID=B4NC68_DROWI  ali  22  66.....................FRKRGWLQVPSFDGQWNFYWANCRYIFGVDHPYRMRSDQIINHFPNSVELSRKDLLIKNIKRYRKDLERKGYGPSMKDIIPMTFVLPTDYNLLVEEFHK---------------------NPASTWIVKPCSKSQGVGIFLVNKLSKLKKYAYDNRDTCVISKYIDNPLLI--GGKKFDLRLYVLVTNPLKAYLYNEGFCRFCTEKYDQTEIDNVFMHLTNVSIQKTNEEY--NTIHGGKWPMQNLWLYLDSMRGEGVSDVLWNRISDTIRHSLNAVAPVMANDR---HCFEVYGYDIIIDNNLKPWLVEINTSPSMHSTTDRMLKARLIDNVLPVVLPPPDDHWDKT......... 420
274 0.000e+00UniRef50_X6MMT1 Uncharacterized protein n=1 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6MMT1_RETFI  ali  23  117.........RTTFRNVVHDVLSGRLGWKECVNHDVEWDLVWIDKEWMREIFDQCHFETHQRVNHFRNHYELTRKDMLIKNVKKTRRLLTKSSGEEE------------QESKQYQFIPSPSYTLPQEYSIFVEKFKQHPNGTQ---WIMKPVAKCQGKGIFLFTKLSDISDWKSNQVESYVVQKYISNPLLI--GGKKFDLRIYVLVTSPLVAWLYRSGFARFSGSRYTSHSINNTHIHLTNHAIQKTHENYKSDNGGDLKWNLRSLKLYLIAKYGNKKCNELFTEIQNVIIGSLLAVQPAMIQDK---HCFELYGYDILIDNKFKVWLLEVNSMPSFSSDEDYLIKYALINDALDIV-DMEGKLKGNELQVGGFDLI 517
275 0.000e+00UniRef50_UPI00077A226E tubulin polyglutamylase TTLL5-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077A226E  ali  21  90.YKFV----KTEC--KLVRSILGVHCFKEVHPNSSNFNLMWTGSHIKPH--TLRGLQDFQKVNHFPRSYELTRKDKLYKNIQRMQHS-----KGVKHFDFIPESYIIPEEFNEF------SGKVVPALKMIFFSCSRVQDLGNVSLIIL-------INGIFLHCNVVVLQPSHVPLDDNLLVCKYISNPLLVD--GFKFDLRLYVGVTCPLRVYLYEEGLTRFATVKYDSKNIKNVCMHLTNYSVNKKNADFVRCPDPGNKWSMSAMLRYLKHIGKDT--TALMMRIEDVVVKTIIAGELHIASACKMFNCFEIYGFDILIDENLRPWLLEVNLSPSLASPLDLKIKSHLVSDMFNLTGFVAHDPMVRKLPNRRF... 460
276 0.000e+00UniRef50_A0A212EGW3 Putative tubulin polyglutamylase TTLL2 like protein n=12 Tax=Ditrysia TaxID=37567 RepID=A0A212EGW3_DANPL  ali  22  14...FIYRLNDNGSGPSLLVKIFTERGWRIYQGYNERWNLWWRTSAFPATSYKA--LGDWQFMNHIPKGGSICRKDSLSRLLRCMRRIYGSI------YDFSPPCFHLPLEYAKLVSECSRLR-------------RGDDPTSSNVVWIHKPVAQSQGRGIFLFRSVCDMR-----CGSPAVVQRYIERPLLI--AGYKFDLRLYVCVPGPLTAYMYAEGLARFGTDKYTLSDIHNPYRHLTNSSLNKRYAECKDRIGSGCKWTLKQVRRALVGRWGAVEW-LVWQRIRALVTLTLLAQAAGTPPAR---NCFEFYGFDVLLDDCLKPWLIEVNLSPALAADCDVTVKQPMLHELFDLLGLPM................ 350
277 0.000e+00UniRef50_Q23MT7 Probable beta-tubulin polyglutamylase n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=TTL6A_TETTS  ali  22  353....LVLNVADTKYPVVKFVGKKIFKWKLAYDESMDFDIFWTDNAVQPE--QLGRMQPYQKINHFPGMFSLARKNHLARNLMKMRKQ------FPDQYKFFPQTWLLPAEYNDFKNQFEKSRSQQK-------------------IFIVKPEASCQGRGIFLTRSLDDL-----NPSDHYVVQRYLNKPYLID--GLKFDFRLYVLLADPLRIYLYYEGLTRFATEKYNRDNIEDMCMHLTNYAINKDNPNFKEKMDVGHKRSLTSVLQLLEDQGHD--VNKLWKDIKRVLIKTIISAQPTLAHHYKSCQCFEILGFDIILDSHLKPWVLEVNHTPSFSTPLDSYIKKNTIRDSLKLMNCTCKAKN............ 699
278 0.000e+00UniRef50_A0A075B5B5 Tubulin-tyrosine ligase domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075B5B5_9FUNG  ali  21  2.........NNTIYD-----VMKDRGWKDVSTTETDWDFHWADVFWVHEVFDTIHLLDHQRINHFRNHYELTRKDFLVKNVKRMVRYIERERQEASKFEFISTSFVLPQEH-----------------AMFQEEFKRNPGFNDANL----PVGKAQGKGIFLINKLSQISQWRKDPKEAYIVQKYIDNPYLI--GGKKFDLRIYVLVTSPLTVYIHRNGFCRFSNSTYSSDDLSNLYIHATNVAVQKTAPNYDG--ERGCKWLLRNLKMFIMTKHGEKECKSLFGKIEAMIIRSLLCVQKVMIQDK---HCFELYGYDVLIDNTLNPWLLEVNASPSFSTQMDYELKHQVLNDCFDIIFPLYDKKERPK--VGGFDLV 361
279 0.000e+00UniRef50_E0W3J3 uncharacterized protein n=1 Tax=Pediculus humanus subsp. corporis TaxID=121224 RepID=E0W3J3_PEDHC  ali  23  8...FVFRVNENGSGPDLLMQVCAERGWKEYAENNDSWNLWWKTSAFSIS--QHKQLKAWQFTNHMPKGSTICRKDNLARNLKCMKKVYGGI------YDISPPGYNLPLEYTKLVADCSRHDDDEDDNQK---------------VWICKPVSQSQGRGIFLFKSLNDL-----SYDSNAVVQKYIKNPLLI--GGYKFDLRLYVCVPSPLTVYLYKDGLVRFSTDKFSLSDLNNPFCHLTNSSLNKLGPGYKERIGAGCKWSFTQLRQYFQQAGIRDW--LLWQRVSALVTLTILSQSTSVPQ---TINCFEFYGFDVLIDEKLKPWLLEVNLSPALGCNVDSIVKKPLLHDLFDLL.................... 337
280 0.000e+00UniRef50_H3BLT7 Tubulin monoglycylase TTLL3 (Fragment) n=17 Tax=Amniota TaxID=32524 RepID=H3BLT7_HUMAN  ali  24  186................................................................................................WSLFLQRYYQVVHEGAELRHLDTQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPPDNMWSSQRFQAHLQEMGAPNAWSTIIPGMKDAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRMLDRNCDTGAFELI 471
281 0.000e+00UniRef50_A0A2T7P943 Uncharacterized protein n=5 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7P943_POMCA  ali  23  590............................EGEKENHDWIGCFGKHMKSTGF---KSLREYQKINHFPGSFQLGRKDRLWRNLSKMQ-----LNFGKREFSFFPQTFVLPSDFKLLKRAFE--------------------DGSSRQKWIVKPPASARGIGIKVINKWSQL-----PRRRAVIVQKYLAKPLLINDS--KFDMRVYVYVTSPLRAYVFEDGLARFASCKYSAKSLGNKFMHLTNYSVNKHNAEYQSNADNGHKWSLKSLWSYLKRHGVNTA--AIWENIKDKVVKTLISAESSINSVRSRYVVHELFGFDILLDENYKPWVLEVNISPSLHSNLDVIVKGRLICDMLNLALRIPDK.............. 904
282 0.000e+00UniRef50_A4Q9F0 Tubulin polyglutamylase TTLL7 n=215 Tax=Gnathostomata TaxID=35060 RepID=TTLL7_MOUSE  ali  21  40....IITANVAGTKFEIVRLVIDEMGFMKTPDEDETSNLIWCDAAVQQEKIT--DLQNYQRINHFPGMGEICRKDFLARNMTKMIKSR------PMDYTFVPRTWIFP-----------------SEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKV-----PSQDHLIVQEYIEKPFLME--GYKFDLRIYILVTSPLKIFLYHDGLVRMGTEKYNESNLTQLYMHLTNYSVNKHNERFERNEDKGSKRSIKWFTEFLQANQHD--VTKFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKRGVLLNALKLLIRTSDKRKN........... 388
283 0.000e+00UniRef50_A0A078ABZ5 Tubulin tyrosine ligase-like member 5 n=2 Tax=Oxytrichidae TaxID=57506 RepID=A0A078ABZ5_STYLE  ali  24  330..............AKLVRMILESHGF--LHTESNDWNILWTCTSSQQKTFMYENLNENQKINHFVNSSELTRKDRLCFNVGKMQ-----MKFGRNHFDFLPETYILPDEFSEF----------------YKTFNSVPKDSSDKNLWIVKPSSSSQGKGIFMIDDISEV-----PLNESLVISKYIGNPLLI--NGLKFDLRLYVLVTSPLKIYIYNEGLVRFASEPYDISNTQNVFAHLTNYSINKKSENFIQNKDFGNKWSLSALQSHLQKLGIE--MKIVWERIYDSVIKSLLSIEHHVNNTQNKSNSFDLFGFDIILDSELKPWILEVNLSPSLASPLDFHIKSNLIVDALNIVGIKKFTRRRD.......... 671
284 0.000e+00UniRef50_A0A0L8FYG9 Uncharacterized protein n=1 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8FYG9_OCTBM  ali  21  38.NKRAVSANISGTRFKLVKKVLDNLNFSITEDEDFTSYLIWSDAYVSNEK--VSDLQNYQRINHFPGMIKITRKDYLARNFVKMQKMYR------DAFSFHPRTWVMP-----------------SELSELSQRPRCHEMKQETQIYIAKPFNGSQGHGIYLCNSIEKI-----HFGENAIVQEYIHKPLLI--NNVKFDLRLYVLITDPLRVFVYKEGLVRLSTENYLPDNLENLFMHLTNYSINKRNNSYEKSTSPGIKRSFKYLNQYLRQN--DYDVTQLWQQIYDLIAKTMIMAEPHLLHAYRNCRCFEILGFDVLVDSNLKPWLLEVNRSPSLNTDIDLDVKTRLLEDTITLLIKISDKTRKAEAQKRLFSKV 405
285 0.000e+00UniRef50_F6WP65 Uncharacterized protein n=4 Tax=Tetrapoda TaxID=32523 RepID=F6WP65_HORSE  ali  24  287................................................................................................WSLFLQHYYQVVHEGAELRHIDTQVRRCEDILQQLRTVVPQMDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVDGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLENLDN-SVHLCNNSIQKHLENSCHRHPSDNMWSSQKFQAHLRDMGAPNAWTVIVPGMKAAVIHALQTSQDTVQGRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRRLDRNCDTGAFELI 572
286 0.000e+00UniRef50_A0A1R2BMU7 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BMU7_9CILI  ali  21  20....IICNILDTEYEVIKNVVVETLSWRISENENDDWDITWTDNYI--TTDKLSKMKAYQKINHFPGMHGICKKNYLAWNLNKMFKL------FPNEYNYFPKTWVLPGDYIDFKQHI-----------------------NKKKIFIVKPEASSQGRGIFLIKRLEDI-----NISERYVVQEYLSEPCLIE--GLKFDLRIYVLVTNPLRVFLHEDGLTRLATEVYSNPNFNDLCMHLTNYAINKNNPKFQFNSDSGHKRSLKSTYEYLKTQGKDI--EELKGKIEDIILKTLCSVQPSVAHVYKTCQCFELLGFDIIIDSNLNPVLLEVNHSPSFSTPLDWKIKHRLIRESLMLLGSRVRDRKNYYQNKKN.... 369
287 0.000e+00UniRef50_UPI000C30DD4E probable tubulin polyglutamylase TTLL2 n=1 Tax=Amphiprion ocellaris TaxID=80972 RepID=UPI000C30DD4E  ali  24  5.....LVFRLHDRGPEVVREVLLERGWEEYDEDEREWNLYWRGSAFRTSEY--HNLLPWQRLNHHPKTIGITRKDCLARNLRRM-----KATSGSSLYDFSPTAFILPNDYTRF----------------LAEHNKLRLVRGPSTYWICKPVDLSRGRGIFIFKDIKDLV-----YDCSVIVQRYISNPLLI--SGYKFDLRIYVCVKSPLTVYIHQEGLVRFATEKYNLSSLHNLYAHLTNTSINKFYKTEKGRVGQGCKWTMSKFRHFLYSQ--DINELLLWQRINNIVTLTLLTIAPSVPSC---PNCVELFGFDILIDVKFKPWLLEVNYSPALTLDCDIAVKKGLISDLIDLM.................... 332
288 0.000e+00UniRef50_Q9Y4R7 Tubulin monoglycylase TTLL3 n=117 Tax=Eutheria TaxID=9347 RepID=TTLL3_HUMAN  ali  24  230................................................................................................WSLFLQRYYQVVHEGAELRHLDTQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPPDNMWSSQRFQAHLQEMGAPNAWSTIIPGMKDAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRMLDRNCDTGAFELI 515
289 0.000e+00UniRef50_A0A183ADJ4 Uncharacterized protein n=1 Tax=Echinostoma caproni TaxID=27848 RepID=A0A183ADJ4_9TREM  ali  22  2.......................................................LTDFHKVNHFPRSYELTRKDRLAKNVQRMQQIKGLRQF-----DFVPQTYILPEEFRDFCKGFMQ----------------------DKGPYIVKPIASSRGRGIHIVSHPEEI-----PYEEPVIVSRYISNPFLLD--GFKFDVRIYAAVTSPLVVYIYEEGLVRFATVRYQVGNLKTQCMHLTNYSVNKKNFEFVQNDDAGNKWSLGALLRFLKSEGAD--VTGLMVRIEEIIIKSFLCVVSPIASACAMFQCFELYGFDIIVDEDFRPWLLEVNLSPSLASPLDFKVKSHMITDLFNLVGIVCHDPTRKTQ........ 296
290 0.000e+00UniRef50_A0A0L0HRH0 Uncharacterized protein n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0HRH0_SPIPN  ali  24  24..............PQVVKDVLESKGWLPVEGKSLYWNLWWKGSRYRKSDYEAC--QPWQRLNHFPKTLNLTRKDTLYRLLKTMRGIYGPI------YDFVPLTFSLPNDYVR-----------------FVRVYAEEDEQGVKGLWICKPADLSRGRGIFLFRDLHEL-----TYDCNVIVQRYISNPMLI--SGYKFDIRCYVVVRSPLVVYLNQEGIARFATSVYTTTELSNVYAHLTNTSINKFSPSLSHEKDEGCRWTLGKLRTWFEGMG--VDFEKIWRKIQGIILLTLLAVEVPLVPA----GCFELYGFDIMLDENLRPHLLEVNFGPALSTDVDVEIKKPLIEDIINLV.................... 339
291 0.000e+00UniRef50_L1IW93 Uncharacterized protein n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IW93_GUITH  ali  22  101........NLTGCHYSVIRDVCQDLGWR-VTSNEEKWTIKWTDRYLLGSTIKDMKMGRSQRINHFPSLCEIAFKCRLAVNLNRMKKVL------PAEYDFYPETWTLPEEYHTVL---------------------RLIAEKKNRTFIVKPNTGSQGNGILITRRANEI-----PKEGKFVVQKYLNNPLLID--GLKFDLRIYVLVTSPLRVYVCRDGLARFCTQEYSSKNANAQFMHLTNYAINKHNDEFNGLDEEGSKRSLGSIRKWLDENGYSS--QEVWSNICSMVVKTILAALPANQHSYRGFSCFTVLGFDVMLDSSTKPWLIEVNELPSFETPLDRDVKSTVIRDTFMMVAP.................. 444
292 0.000e+00UniRef50_J9I7H1 Tubulin tyrosine ligase-like family, member 5 n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9I7H1_9SPIT  ali  22  230...............RLVRSVLEINGFKYTESHE--WNILWANSHCKSYLYEG--LNEYQKINHFPSSNEITRKDKLCLNLVKMQEKHGKHNF-----DFIPDTYVLPDEFGDFYAHYQKVKQNDP----------------KHNIWIVKPANLSRGRGIYLIDDIAEV-----SVDDISVISRYIQNPLLI--NGHKFDLRIYVAVTSPLRIYVYKEGLARFASEQYSNKNKDNKYQHLTNYSVNKNNENFIQNDDFGFKWSLGAFCKHLESIGID--MNLFWSRIYDVIIKSIISGENQIFNAVHKTNCFELFGYDILIDSDLKPWLIEINLSPSLASPLDITIKSSLISELMTLVGVKKFDRRIESQNK...... 567
293 0.000e+00UniRef50_A0A1W4YXN9 probable tubulin polyglutamylase TTLL9 n=5 Tax=Bilateria TaxID=33213 RepID=A0A1W4YXN9_9TELE  ali  25  1.......................................................MEEHVRICHFRNHYELTRKNLMXXXXXXXXXXXXXXXXXXXXCDFFPRTFVLPSEYALFVEEFKRS---------------------PGNTWIMKPVARSQGKGIFLFRKLKDIVDWKKNQVERYVAQRYIENPYLI--SGRKFDLRVYVLVTSPLKAWLYRDGFARFSGTRFSLSSIDDQYVHLTNVAVQKTAPDY--DPEKGCKWQLQKLRRYLTAKHGAETVETLFRDIDNIFIRSLQSVQKVFINDK---HCFELYGYDILLDEDLKPWLIEVNASPSLSSQEDYEMKYRLLEDTLNVV.................... 292
294 0.000e+00UniRef50_A0A090M7W5 Tubulin-tyrosine ligase/Tubulin polyglutamylase n=4 Tax=Mamiellales TaxID=13792 RepID=A0A090M7W5_OSTTA  ali  20  61..........TTTPNTITHSIMLARGWCEVAVTDPSWDFFYADVGWIHDYKSAAHMEEYQRVNHFPNHGELTRKDLMAKNLNRARRQAAKNEGAEKAFDILPLTYVMPQEAMMMRRAF----------------------RERGGLWIMKPIGRAQGKGIFIVHKASQIAKWVVEREKNYVAQQYISNPYCV--GGRKFDLRLYVLVMSPTRAYLYRDGFARFTATRYTCDSFDDEMVHLTNHSVQKRDPNYDAS-KCDLRWSARSMRQYIAAKHGTAIADALVYNIANVVVHSLQSVAPVMINDR---HCFEMYGYDVMLDENLRPWLIEVNASPSMSVDSDRALKTALFQDVLNIVDMTPSRRGRPEEHVGGFDLI 427
295 0.000e+00UniRef50_A0A2J7QZV6 Uncharacterized protein n=7 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7QZV6_9NEOP  ali  22  598......KWKLSTITPLVIRRTLVNSGFRLVRK-SNDWCGTWGKHMKSLCFKT---LKEFQKINHFPGTFQIGRKDRLWKNLYRL-----MTKFGKKEFGFIPRTYVLPQDSKLLRQAWEK--------------------SCGKEKWIIKPPASARGTGIKVVHRWAQI-----PKKRPLVVQKYISQPYLI--NGSKFDLRLYVLVTNPLRIYIYDDGLVRFASVKYSSDSLGDRYMHLTNYSINKMSSQYTQNEDQGHKWTVKTLWTYLEKEG--VDVTALWNSLVDLVIKTIISGESSINQLTRRYCSYELFGIDVLLDETLKPWLLEVNISLHSSSPLDLAVKGPMVRDLLNMA.................... 926
296 0.000e+00UniRef50_A0A0A9VSG9 Tubulin polyglutamylase TTLL6 (Fragment) n=1 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9VSG9_LYGHE  ali  20  67...YSLINSSNCRYDLVRFTATKFS----IKESLENWNIYWTDLSISVQRC--KEMKRFQRINHFPGMMEICRKDLLARNLNRLYKA------FPEEYNVFPKTWCLPTDM---------------------AEVTEYAKTHKGKCFIVKPDQGCQGRGIAITKNINQLKTY-----DRMICQQYIQRPFLID--GYKFDLRIYVLITSPMRLFVYNEGLARFATAKYKEPNISNMYMHLTNYSVNKHSRTYIVDDIDGSKRKLSTINQWFQKNNYD--VKKIWDSIDDVIIKTMIVSLPTLKHYYHTCACFEILGFDFMFDYRLKPYVLEVNHSPSFNTEIDHEVKESLLYDTFSILNLQHNNRDKKRARDRLF... 417
297 0.000e+00UniRef50_A0A1R2C3V7 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2C3V7_9CILI  ali  20  18....LIMNVANTKY-EIIKDVASILRWSISDKQDQDWDLLWTDTAVSTERLS--KMRIAQKINHFPGMYQIARKNCMALNLNKLRKLY------PSDYNFYPMTWVLPIELTDFISALSH---------------------NKSKTFIVKPEASSQGRGIYLVKKPEDLQE-----TDHYIAQQYLTKPYLID--GLKFDFRIYVLVADPLKIFIHEEGLARFATETYQARNLDQAFMHLTNYAINKNNPGFIQNQEAAHKRRLSSVLLRIEEDGYDVV--ALWDKICDIVIKTLCTVQPSLAHVYRSCQCFEILGFDIILDHRLKPWLLEVNHSPSFTTDLDTEIKQKVIFEAIKIMNITTKSQKMQEAQC...... 366
298 0.000e+00UniRef50_A0A224XKK0 Putative tubulin polyglutamylase ttll6-like protein (Fragment) n=1 Tax=Panstrongylus lignarius TaxID=156445 RepID=A0A224XKK0_9HEM  ali  25  19..........NCRY-EIVRDVAESFGMKEA---SEGWNIYWTD--ISVNHDRCKEMKRYQRVNHFPGMLEICRKDLLARNLNRMLKL------FPSDYNFYPRSWCLPTEL--------------NEVLEFCKVYRNKPL-------IVKPDLGCQGKGIFITKNLNDLKDL-----DKMICQVYISKPFLID--GYKFDLRVYVLITSPLRIYVYNEGLVRFATKRYNGSNISNMYMHLTNYSVNKHSRAYVNDAEGGSKRRISTINHWLMDRFYNT--ERLWKAVDDVIIKTIIVALPSLKHSYHACACFELLGFDFILDNKLNPFLLEVNHSPSFHTDIDLEVKESLLNDTFSLLNLSSNEKQK........... 348
299 0.000e+00UniRef50_UPI000625C9BC tubulin polyglutamylase TTLL4 n=1 Tax=Orussus abietinus TaxID=222816 RepID=UPI000625C9BC  ali  22  90...KHLKWRLSTITPLLVRKTLVNSGFRLMKK-SPEWTGIWGKHMKSICFKT---LKESQKINHFPGSFQIGRKDRLWRNLSRM-----MARYGKKEFGFIPRTYILPQDMKFFRQVWEKC--------------------AGKEKWIIKPPASARGTGIRVVHRWSQI-----PKKRPLIVQQYLSRPRLI--GGAKFDLRLYVLVTSPLRIYLYPDGLVRFASVKYDINYLNDRFMHLTNYSVNKTSASYTSNDCAGHKWTIKTLWSYLEKEH--VNVSKLWASMKDIVVKTMIAGESSINALTRRYSCFELFGVDILLDENLKPWLLEVNISLQSSSPLDEAVKGPLIRNVFNMV.................... 421
300 0.000e+00UniRef50_H2T511 Tubulin tyrosine ligase-like family, member 4 n=4 Tax=Percomorphaceae TaxID=1489872 RepID=H2T511_TAKRU  ali  23  6....................................................FKALGEHQKLNHFPGTFQIGRKDRLWRNLSKMQ-----SRFGKQEFGFFPRTFVLPQDIKLLRKAWEDC--------------------GSRQKWIIKPPASARGIGIQVIHKWSQM-----PRKRPLLVQKYLHKPYLI--SGNKFDLRIYVYVTSPLRIYIFSDGLVRFASCKYSMKTLSNKFMHLTNYSVNKKNSEYQTNSDDGHKWALKALWEYLGSRG--VNTTLIWEKIKDIVVKTIIASEPYVINVESPYSCHELFGFDIMLDENLKPWILEVNISPSLHSNLDVSIKGQMVKDLLNLAGFRLPRRED........... 301
301 0.000e+00UniRef50_A0A0P4XXV2 Tubulin polyglutamylase TTLL4 n=3 Tax=Daphnia magna TaxID=35525 RepID=A0A0P4XXV2_9CRUS  ali  21  205..RRCLKWKLSTITPVVVRKTVVNSGFR-VIKEPKDWIGTWGKHMKSP---LFTSILEHQKVNHFPGTFQIGRKDRLWRNMQKM-----VAKYGNEEFGFLPQTFVLPHDLRLLRKHWSRRTTDV--------------------PWIIKPPASARGTGIQVIHEWNQL-----PRKKPLVVQSYVKNPYLI--NGTKFDIRLYVFVTSPLRIYLYENGLVRFASLTYSMNSLDDLYVHLTNYSVNKHCEGYVANEDQGHKWTLASLWTYF--LGLGVDVEAIKSSLSDIVIKTLLSVTPALNNVANRYSCFELFGFDILLDSDLKPWLLEVNISPSLHSSLDLSVKGPLIKNVLNMA.................... 560
302 0.000e+00UniRef50_UPI000D535A7A tubulin polyglutamylase TTLL7 isoform X4 n=5 Tax=Eutheria TaxID=9347 RepID=UPI000D535A7A  ali  22  51...............EIVRLVIDEMGFMKTPDEDETSNLIWCDSAVQQEKIA--ELQNYQRINHFPGMGEICRKDFLARNMTKMIKSR------PLDYAFVPRTWIFPAEYTQFQNYMKELKKKRKQK-----------------TFIVKPANGAMGHGISLIRNGDKL-----PSQDHLIVQEYIEKPFLME--GYKFDLRIYILVTSPLKIFLYHDGLVRMGTEKYNESNLTQLYMHLTNYSVNKHNEHFERDETEGSKRSIKWFTEFLQANQHDVA--KFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKKGVLLNALKLLIRTSDKRKN........... 388
303 0.000e+00UniRef50_E0VZA9 uncharacterized protein n=1 Tax=Pediculus humanus subsp. corporis TaxID=121224 RepID=E0VZA9_PEDHC  ali  22  433..RKHLKWRLSSITPIVIRRTLINSGFKLVRKSNE-WTGQWGKHMKSFVF---RTLKDFQKLNHFPGTFQIGRKDRLWKNLYSL-----MMKFGKKEFGFIPRTFILPHD-----------------RKLLRTAWEKASGVGKGQ-WIVKPPAAARGTGIKVVHRWGQI-----PKKKSLIVQKYIAQPYLI--NGSKFDLRLYVLMTSPLRIYLYDDGLVRFASVKYSEDCLSNRFMHLTNYSINKLSNQYQVNADHGHKWSLKTLWVYLAKQG--VDVKALRKNLTDLVIKTIISGESNINNLPSRYCSYELFGIDVLLDNNLKPWLLEVNISPSLHSPLDLAVKGPLVKELLNIAGFQIPAKLTKEQEQNFLE.. 785
304 0.000e+00UniRef50_A0A2R5G3L6 Tubulin polyglutamylase TTLL5 n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5G3L6_9STRA  ali  21  13....VIRWKMDFDKQCLL-GCFDRRGWERCSDSDQDWHVYWGTVKQLFSPDCVYRLRDGQLINHFPNHYELTRXXXXXXXXXXXXXXXXRPRSSAPAGPQRGTHWQTVADAHVPCNFLPPTYVLPVDYSLFLEEFRR----NPNSVWIMKPTSKARGVGIFLVTKLHQIKKWASKGNGQYVISKYIERPLLI--GGRKFDLRMYVLVTSPLKAFLYQDGFARFCNEKYSGSDRDNHYMHLTNVAVQKHNEDYNENH--GGKWSLANLRLYLQAMYGADATARLFEELESVILVSIKAVQNVIMNER---HCFECYGYDLLIDENLKVWLIEVNASPALTTKSDRSLKHSLVHNIFNILLP-EDLPENPKEREQRMQEI 402
305 0.000e+00UniRef50_A0A067RJS4 Putative tubulin polyglutamylase TTLL2 n=21 Tax=Neoptera TaxID=33340 RepID=A0A067RJS4_ZOONE  ali  20  8...FVFRINDNGAGPNLLIQVCVERGWRQYSECRDNWNLWWRNTGLPLSHY--KQLKTWQFTNHIPKGSSICRKDNLARYLRCMKKIYGTI------YDFSPLVYNLP-----------------LEYTKLVAEFSQ-GKSKVNSVWICKPVGQSQGRGIFLFKDLGDLC-----YDSNAIVQRYIQNPLLI--GGYKFDLRLYVCIPSPLTVYLYREGLVRFGTDKYSMADLNNPFCHLTNSSLNKWGPGYNEKKEPGCKWSLKQLRHYFHQTKISDW--LLWQRISSLVVLTVVSQLSGIPN---TANCFEFYGFDVLIDSSLRPWLLEVNLSPALGCDIDQIVKKPMLHDMFDLLGLPM-------CNTGL.... 343
306 0.000e+00UniRef50_A0A1W4X552 probable beta-tubulin polyglutamylase n=1 Tax=Agrilus planipennis TaxID=224129 RepID=A0A1W4X552_AGRPL  ali  22  524..RKYMKWKLTNITPVLVRNTLTNTGFRLIRK-STEWVGTWGKHMKSPMFKT---LKDSQKLNHFPGTFQVGRKDRLWRNLQRL-----MLMYGHKEFGFIPRTYILPQEVKVLKQNWKNGDDSEK--------------------WIIKPPASARGTGIRVIHKWSQL-----PKKANLIVQRYISNPFLI--NGNKFDLRLYVLVTSPLRIYLYPDGLVRFASVQYSDSNLKDRYMHLTNYSINKLSSNYTANDDQGHKWTLSKLWEYLQTR--NVDTKGLWRCLQQLVIKTMISGESTIDNMSNRYNCYELFGVDVLLDENLDPWLLEVNISPSLHSPLDAHVKGPMVQSLFNLA.................... 856
307 0.000e+00UniRef50_A0A067CAA9 Uncharacterized protein n=2 Tax=Saprolegnia TaxID=4769 RepID=A0A067CAA9_SAPPC  ali  20  11....KIKINMTLAKYEVIKKIAKDRGWKMVSDEDDKCNLHWID--VPDFLNTFKHMQPFQKVNHFPGMSNLARKSKLARNFQRM------TKLFPAQYDFCPKTWILPFDYTEFSQQFN-------------------ADGTSSRAFIIKPDHSCQGRGVFLTKQLKDV-----SKTDIFVAQRYLPSPLLI--GGKKFDLRIYVLISSPLRVYLFQDGLVRMCTADYTAPNAANKFMHLTNYAINKRSNNFEKNDGQGSKRSLRWFLSWLGETHAAAAVDALWEGIGDICLKSILAVQPTIAHEYHSSSSFAVLGMDVLVDDHLKPWLLEVNHLPSFHSPLDWNIKERLLNQTLDIMQISGDDKANYE......... 374
308 0.000e+00UniRef50_A0A1B6FD64 Uncharacterized protein (Fragment) n=1 Tax=Cuerna arida TaxID=1464854 RepID=A0A1B6FD64_9HEMI  ali  22  441...KLLKWKLSTITPVVVRRTIVNSNFKLVRKSNE-WCGTWGKHMKSLCFKT---LREYQKINHFPGTFQIGRKDRLWKNLFRL-----MAKFGKKEFGFIPRTYVLPQDNKLLRSAWEK--------------------NCGKEKWIVKPPASARGTGIKVIHKWTQI-----PKKCPLVVQKYIADPYLI--NGSKFDLRLYVLVTSPLRIYLYDNGLVRFASVKYSNESLADRYMHLTNYSINKLSSQYTQNEDQGHKWSLQAMWTYLEKE-QGVDVKALWDHLIDLVIKTIISGESAIANLASRYCSYELFGVDVLLDENLKPWLLEVNISLHSSSPLDLAVKGPMVRDLMNIAGYQIPNKLSSQVQT...... 787
309 0.000e+00UniRef50_E0VPT2 uncharacterized protein n=3 Tax=Eukaryota TaxID=2759 RepID=E0VPT2_PEDHC  ali  23  18.....................FEKRGWVQVGPDD-DWNFYWSGCRTLFSVDSGYRMNDSQMISHFPTHYELSRKDLLVKNIKRYRKELEREGNPYLHLDFVPVTFVLPAD-----------------YNMFVEEYRK----NPQSTWIMKPCGKSQGAGIFLINKLSKLKRWSRESKESYVISKYIDNPLLI--GGKKFDLRLYVLVSSPLKAYLFKLGFCRFCTLKYDTSELDNMFVHLTNVSIQKHGGEYNSMH--GGKLSIQNLRLYLESTRGKVVTERLFTSISWLIVHSLKAVAPVMANDR---HCFECYGYDIIIDNKLKPWLIEVNASPSLTSTTDRILKHKLIDNIISVVLPP................. 356
310 0.000e+00UniRef50_A0A0M0JU53 Tubulin polyglutamylase ttll4 n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0JU53_9EUKA  ali  25  112.........RSNHTIVCVSGAMKRSGFKRLVK-GTGYNFFWGHHLK---DSALQKLHPEQKVNHFPGSYTLGRKDYLWKNISRQQRAH------PEAYDFVARTYVMPRDRELLEKDYV-----------------------DGEVYIVKPPASAEGRGIRLVNRWE----SMPKPGQPAVVQRYLDDPLLID--GKKFDCRVYVAVTSPLRIYVYEEGLTRFCTSDYVYATIRNRYMHLTNFAVNKKNESFVDRDDEGSKWTLTALWRYLENKG--VNVPKLRTQIEDILIKTLIAGEPTVVNSAGRPSCFELFGYDIFIDAKLKPWLIEVNVACSLSSPLDRRVKGSMMTDLLHIIIVPYDKKVVKSEKTG..... 453
311 0.000e+00UniRef50_Q23SI8 Probable alpha-tubulin polyglutamylase Ttll1 n=10 Tax=Eukaryota TaxID=2759 RepID=TTLL1_TETTS  ali  24  21.....................FAARGWTRCDKDDDDWNIYWANVRNIFNPKSGIRLNDMQIINHFPNHYELTRKDLMVKNFKRYKKELEKENS--------PYCQKDENGNYLYLDFIPQTFTLPGEYSLFVEEFHR----NPNATWIVKPASRSQGKGIFLLRKIQQLKKIAFSLKEAYVVSRYIDNPLLV--GGRKFDLRIYALVTSPLKVYLYAMGFGRFCNEQYTQDEMDNMFIHLTNVAIQKFSDKYSEKH--GGKWSLQSLRYYLEMVYGTDMANKCFDDINNIIIMSLKSVQSIIINDK---HCFEMYGYDILIDENCKPWLIEINASPSLTVKIDKELKTELIKNVYQIVIP--DDWNDDSSKTG..... 371
312 0.000e+00UniRef50_A0A068YKW7 Tubulin polyglutamylase ttll4 n=3 Tax=Echinococcus TaxID=6209 RepID=A0A068YKW7_ECHMU  ali  19  80.....LIWRNTVITPNVVKRALERSHFRLTEGCYCDWIGCFGRH---LTPVLFRQIKDFQKMNHFPGSFELGRKDLLTINLSKMR-----TRFGSENFSFYPTTFILPREFSRLKDSW----------KQGLDHSPPRNKKRGLPTWIIKPPASARGMGIYLANRLTEV-----PRRKKSIAQVYISHPYLI--GGNKFDLRLYVYMTSPLRLYIHKNGLVRFASQKYSNEQVNNRFVHLTNYSVNKRNTQYHHCDKTSHKWPLEDLWRHLEERGRDT--RKLWEEIKSIVFKTMASAVSKMAHVARRESVHEIFGFDILLDSELRPWLLEVNISPSLHTSLDNKIKSEVVVDMLNLAGFRLPPRSAKEETKR..... 435
313 0.000e+00UniRef50_K3X5F4 Uncharacterized protein n=2 Tax=Oomycetes TaxID=4762 RepID=K3X5F4_PYTUL  ali  20  163..YYKTHWERNC-----VKNAFAVAGLVRTGKRWTGWHLAWAKHIPKTKFKLFKDSHHAQVFNHFPDPWVIGRKDRLLRTLASCKRRFGAS------YSFFPDGFTLPDQMDAFRRLLQR-----EDALLLSIATATTSLRPKSSIWILKPPASACGRGIRVITS-KDVDSI--SKDRKYVVQRYIAQPLLLD--GYKFDLRIYTLVTSPLRIYLFQEGIARFCTNAYSLEKLKNRFSHLTNYSVNKTNDKFVENVDAGSKWSLTGLLAHLQALRILNDREALMAQIRDIICKTIIAAEAHLTPVKKPVTCYELFGFDIMLDSNLTPWLIEVNVSPSLGSPLDKRVKGLLLSDIFHLVGVPVD............... 516
314 0.000e+00UniRef50_E2AHW8 Probable tubulin polyglutamylase TTLL2 n=42 Tax=Holometabola TaxID=33392 RepID=E2AHW8_CAMFO  ali  24  19....................VCTERGWREYAGENNRWNLWWRSGGFPTSHY--RPLLPWQFVNRIPKGNSICRKDKLIRHLKCMKKVHGSI------YDFSPAGYNLPSEYTKLAEECSRYEKDYK-------------------IWICKPVGQSQGKGIFLFRKLSDL-----SYDNAAVAQRYIENPLLI--GGYKFDLRLYVCVPSPLTIYLYKEGLARFATEKFSLERLDDPFRHLTNFSLNKLGPGYSEKKEAGCKWTFRQLRRYFEQSGYFDWI--LWQKISCLVTLTILSQAAGIP---KSSNCFEFFGFDVLIDENLKPWLLEVNLSPALSNDCDSEVKKPLLHDLFDLL.................... 328
315 0.000e+00UniRef50_D2VDT4 Tubulin tyrosine ligase (Fragment) n=27 Tax=Eukaryota TaxID=2759 RepID=D2VDT4_NAEGR  ali  22  1...................................DWHIFWASVKQIFNPENGMRLGEHQIINHFPNHYELTRKDSMVKNLKRYKKETEKTEELIHLSNQLSNPNYVAPPRRNIMDYVPITYTLPADYSLFVEEFKK----NPNQMWIMKPSSKAQGKGIFIITKLSQVKRWAKDKKEQYVISKYINAPLLV--GGKKFDLRMYVLVTSPLKAYVYKEGFARFCTAKYTNDDVDNMFIHLTNVAIQKHGDDY--NDKHGGKWNIKMLRLYLESTAGKEKTDKMFEEIYYIFKESLKACKNIIINDK---HCFEMYGYDLLLDSDLKPWLLEVNASPSLTTTTDRILKMSLLNDTFNIVVHYKDYKYDKKQPKGNYELL 356
316 0.000e+00UniRef50_A0A1I8NBZ9 Uncharacterized protein n=9 Tax=Calyptratae TaxID=43742 RepID=A0A1I8NBZ9_MUSDO  ali  22  536..YRILKWRVTTVMPRVVRTILSNSGMRLLKKTN-DWMGVWGKHMKSPCFKTVR---PYQKINHLPGSFKIGRKDSCWKNLVK-----QMAKHGKKEFGFMPKTYIMPND-----------------LKQFRKSWPKYYQRNVK--WIIKPPASARGSGIRVVDRWAQI-----PKRKSFIVQKYVERPLLI--NGSKFDLRLYVLVTSPLRVFMYHNGLARFASVKYSSDTLSDRCMHLTNYSINKFSSNYAKNEDHGHKWTIKSLWNYLGNRG--VHTELLWDALRSLVLRTILAGENSINNMIRTYSCFELFGFDVLLDADLIPWLLEVNISPSLHSPLDAHVKAPLVQSVLNTALYNVPPKLTIERQK...... 883
317 0.000e+00UniRef50_A0A0L0CKI7 Uncharacterized protein n=2 Tax=Lucilia cuprina TaxID=7375 RepID=A0A0L0CKI7_LUCCU  ali  20  638..........NSRYNLIGR-IAKILGFKVVKENKL-WNILWTDSMPGVEIY--KNMKRFQQINHFPGMMEICRKDLLSRNLNRMLKLY------PKDYRIFPKTWIFPADYGEALNYANNH--------------------NKQKMYIIKPDAGAQGRGIWLTNDLKNV-----SPTERMICQTYISKPLLID--GYKFDLRVYALITSPLRIFVYNEGLARLATHKYSMENSDNLYMHLTNYSVNRRNSQYEDDDDCGSKRNFGAINNWMR--RHDYDAKEFWNRIDDIVIKTVLSAWPILKHNYHACACFEILGFDILVDSKLKPYVLEVNHSPSFHTNVDRQVKRPLIRDTLSLIGVLADKRQILREDRKRIKQ. 983
318 0.000e+00UniRef50_J9J0N0 Tubulin tyrosine ligase-like family, member 5 n=2 Tax=Oxytrichidae TaxID=57506 RepID=J9J0N0_9SPIT  ali  21  424...............KLVRSMMEANG--LTYTESHEWNVLWSSSSCKAYLYEG--LNEHQRINHFPSSYEVTRKDRLCYNMVKMQ-----EKHGRQNYDIVPDTYILPQEYREFSQHFNMLAQKEP----------------KKNIWIVKPANLSRGRGIHLIDSLSDVMI-----DDLSVVSRYITNPLLI--NGHKFDLRIYVLVTSPLRVYVFKEGLARFASETYTSKDKDNKFMHLTNYSINKKNDNFVEQDDVGFKWSLSAFCSHLEQVGID--MNLMWSRIYDLIIKAILSGEHYVNYNLHRNNCFEVFGYDVILDSELKPWLLEVNLSPSLASPLDLTIKSTLLADTFNMIGVKKYDRRK........... 756
319 0.000e+00UniRef50_A9JRD4 Si:ch211-220i15.2 protein n=27 Tax=Osteoglossocephalai TaxID=1489341 RepID=A9JRD4_DANRE  ali  23  20..............PQVVREVLLERGWEEFDEEEGDWNLYWRTSGFRNSDYE--NILPWQRLNHHPKVTHVTRKDYLVRHLRRM-----KCAFGATLYGFSPSTFILPNEYTKFLGVYTK--------------------NHSSRYWICKPVDLSRGRGIFLFEDIKDLV-----YDSSVIVQRYISNPLLI--SGYKFDLRIYVCVKSPLVIYMHQEGLVRFATEKYTLASLHNLYSHLTNTSINRFYAMDKERVGKGCKWTLSQFRCFLHKQ--DVNELLLWHKISNIVTLTLLKAVPCIPS---SPNCLELLGFDILIDSSYKPWLLEVNHSPALSVDCDVTVKKGLIGDFIDLL.................... 334
320 0.000e+00UniRef50_A0A1R2C7L8 Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2C7L8_9CILI  ali  21  10....IIINVANTQYDIIKSIASEELNWTLSEKDEENWDICWQDFAISPEK--FADLEIYQKINHFPGMGTLSRKNNLASNLNIMQKV------FPDDYNFFPETWVLPKDLFDLKNRAKF------------------------NILIVKPESSCQGKGISLIKRIEDL-------PERCVAQRYISRPFLID--NLKFDLRLYVLITDPLRIFLHEDGLVRFATEEYKRNNLENLYMHLTNYAINKNNPKFQFEPSGGHKRTLSWLWSYLEEKGHN--VDALWREIAAIIVKTIISGAPCITHLYRSCHCFEVLGFDVILDQNLKPWLLEVNHTPSFTSQIDLMVKKSVIIDALNLLNITPQNRT............ 346
321 0.000e+00UniRef50_A0A1R2B8W3 Uncharacterized protein n=3 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2B8W3_9CILI  ali  23  119..............AKLVRSILESSGF--FYTESHSWNLLWSGS--SPQEFLYEDLNPYQKINHFPCSNELTRKDKLCINMTNMQEKYSK-----EAYDFIPETYILPESFPILFNRFN---------------------SDKKNVWIVKPTNSSQGRGIFLVDSIHNI-----PLDDICVISKYIDNPYLI--NGLKFDIRLYVCVTSPLRVYLYEEGLTRFASEKYVNEFKDNKFIHLTNYSVNKKNENFIQNDGVGHKWSLTALMKYFKE--KNVDVDGLWQRIYDLVIKSVLSIESQVTENLHRNNCFNLFGFDVILDSSLKPWLLEVNLSPSMATPLDFYIKSNLLIDTFNLIGIHMKPARK........... 446
322 0.000e+00UniRef50_A0A068XPI3 Tubulin polyglutamylase ttll4 n=3 Tax=Hymenolepis TaxID=99110 RepID=A0A068XPI3_HYMMI  ali  21  210...KKLIWRNSQITPNVLKRALERSHFKLTNRTSTDWIGYFGRHIPSA---LFRQLKEYQKLNHIPGSFELGRKDQLTRNINKIR-----NRFCGDVYNFYPATFLLPPEYSMFKNAYRHSF---------------NGKRKSSNTWIIKPPASSRGRGIYLASKLGDI-----PKRKKVVAQKYISDPYLI--NGNKFDLRLYVYVTSPLRIYIHRNGLVRFASQKYSVKEFDNKFVHLTNFSINKKNTNCRPPDEASHKWPLDDLWRYLKAKGHDT--EKLWEDIKAIAFKTVATATFKMAHVRCRESAHEVFGFDVILDSKLRPWLLEVNISPSFHTPIDNDIKTEVVVDLLNVAGFRLPPKEETESNSR..... 562
323 0.000e+00UniRef50_B7QA67 uncharacterized protein n=1 Tax=Ixodes scapularis TaxID=6945 RepID=B7QA67_IXOSC  ali  21  2...................SVLAKRNWLRVEPD-QDWNIYWAGVRAVFSADYGSRLSDHQRINHFATHYELTRKDLMAKHMKRYRRELNKNSADGEIPDLVPPTFVLPRD-----------------YNMFVDEFRKTAPS----MWIVKPCGKAQGVGISLVNKPSQVKGLLNSTKEPHVVCRYLERPLLI--GGRKFDLRLYALVTSPLRAYLYRRGFCRLCQLHYSLQDLTDPLVHLTNVSVQRQGGRYNSQH--GGKWDLRSLELWVCGTRGSQAANKLWQDLRQVVAHSLRAVAGTMLSD---WHCFECYGYDILLDEQLRPWLLEVNASPSLSTPGDWVLKETMLDDLFEIVAPHGELRSARNARQGDFELL 352
324 0.000e+00UniRef50_U4TXN5 Uncharacterized protein n=7 Tax=Holometabola TaxID=33392 RepID=U4TXN5_DENPD  ali  23  52..RKFFKWKLSTITPIIVRKTLSNSGFALVRK-SNQWLGTWGKHMKSPMFKT---LKETQKLNHFPGTFQLGRKDRLWRNFQKMISKYSLKEFG-----FLPHTYVLP-----------------QELKLLKQNWDFSGPNGGKDMWIIKPPASARGVGIKVINKWCHL-----PKKTSLVCQKYINNPYLI--NGSKFDLRLYVLVTSPLRIYLYPDGLARFAT-KYSDDDLKDRYMHLTNYSINKLSSQYTANEDANA--TLTKLLEYMHDEG--VDTKTLWKHLQQLVIKTIISSEALIENMNSYYNCYELFGIDVLLDEHLKPWLLEVNISPSLHSPLDAHVKGPLVQTLFDIA.................... 380
325 0.000e+00UniRef50_Q8IPB2 Uncharacterized protein, isoform D n=69 Tax=Schizophora TaxID=43738 RepID=Q8IPB2_DROME  ali  22  566....VLKWRITNIMPKVVRLILANSGMRMLKKTN-DWMGVWGKHLKSPCFKAIRS---YQKINHLPGSFRIGRKDSCWKNLQR-----QMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQ-------------------RNTKWIIKPPASARGAGIRVINRWGQI-----PKRRPLIVQKYIERPLLI--NGSKFDLRLYVLVTSPLRVFMYHNGLARFASVKYSTDTLNDRCMHLTNYSINKFSSNYSKNEDHGHKWTIKSLWTYLANRG--VRTDCLWEALRSLVLRTILAGENGINNVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSPLDAHVKAPLVQGVLNTALVPPKLSLDKQKE....... 912
326 0.000e+00UniRef50_UPI00054EEFCD probable tubulin polyglutamylase TTLL2 n=4 Tax=Percomorphaceae TaxID=1489872 RepID=UPI00054EEFCD  ali  22  5.....LVFRLHERGPEVVREVLLERGWEEYDEEEREWNLYWRGSAFRNSEYL--NLMPWQRLNHHPKTVGITRKDCLARNLKRMR-----ATFGSSLYDFSPTAFILPNDYTRFLSEYNKV------------------TRGPSAYWICKPVDLSRGRGIFIFEDMRELV-----YDCPVIVQRYIGNSLLI--SGYKFDLRIYVCVKSPLTVYIHQEGLVRFATEKYNLSSVHNLCAHLTNTSINKFSPFYKERVGRGCKWTMSKFRHFLQSQ--DINELLLWQRINNIVTLTLLTIAPTVPSC---PNCVELLGFDILIDAEFKPWLLEVNYSPALTLDCDITVKRGLIGDLIDLMNYTLTDSLRERAFQR..... 345
327 0.000e+00UniRef50_Q9VB58 AT11276p n=50 Tax=Schizophora TaxID=43738 RepID=Q9VB58_DROME  ali  21  150........VSNSRYAMIGK-ISKTLGYKLV-KESKMWNILWSDSF--PGVELFKNMKRFQQINHFPGMIEICRKDLLSRNLNRM------LKIFPQDYKIFPKTWMLPADYGDAMNY----------------------ALNHKRTFILKPDSGAQGRGIWLTNDLKTI-----GPHERLICQTYIHRPLLID--GYKFDLRVYTLITSPLRIFVYNEGLARFATNKYTPGNANDLYMHLTNYSVNKRNSHYEDNDDCGSKRKLSAINNWMR--RHNYDVEEFWSNVDDVIIKTVLSAWPVLKHNYHACACFEILGFDILVDWKLKPYILEVNHSPSFHTNVDREVKRPLIRDTLNLVSVLADKRQILKEDRKR.... 492
328 0.000e+00UniRef50_S9WZ42 Tubulin tyrosine ligase-like family, member 5 isoform 2-like protein n=3 Tax=Amniota TaxID=32524 RepID=S9WZ42_CAMFR  ali  23  67..YKIVRTDS-----RLVRSILTAHGFHEVHPSSTDYNLMWTGSHLKP--FLLRTLSEAQKVNHFPRSYELTRKDRLYKNIIRMQHTH-----GFKAFHILPQTFLLPAEYAEF---------CRIQWLQVPLFCQIPAREMSGSI---------------VERSPNQI-----SLEENILVSRYINNPLLIDD--FKFDVRLYVLVTSPLVIYLYEEGLARFATVRYDAKNIRNQFMHLTNYSVNKKSGDYVSCDDPGNKWSMSAMLRYLKQEGRDT--TALMAHVEDLIIKTIISAELAIATACHRSSCFELYGFDVLIDSTLKPWLLEVNLSPSLACPLDLKIKASMISDMFTVVFVCQDPAQR........... 403
329 0.000e+00UniRef50_A0A2P6VQK8 Tubulin polyglutamylase n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6VQK8_9CHLO  ali  21  49......INLASCKYP-VLRVVQRQLGWEE--GDDEDAHLFWCDTSAGTERLV--RMSRPQRLNHFPGMLEIARKKGLARNLANMR------SLFPEEYDFNPRTFLLPEMEEAFWE------ELQSGAENSSSGGGGGPKGYRRPTYILKLDNGSMGRGIKLVQTAAQAAAALPTFDENVVASRYIDRPLLID--GKKFDLRIYVLVRCPLRVFLCREGLVRFCTEAYTPSNLGNAYAHLTNYAVNKLNPAFVEQSGTGSKWTISAFADWMRQQGHD--FDALWRQIAHIIVKSVIACQPMLQYQYDGLTCFELLGYDVLIDEDLRPWLLEVNHSPSLTTPLDLEIKSKLVREALALAGVQPERVK............ 408
330 0.000e+00UniRef50_A0A158Q947 Uncharacterized protein n=2 Tax=Oxyuridae TaxID=51026 RepID=A0A158Q947_ENTVE  ali  22  71..RFKMIKTN----QLLVKTILYSYGFEQCSERNPNVNLIWSASHLSP--YTLRSLGPWQRVNHFPRSSELTRKDKLYENVARARRL------FGNAFDFIPDFFVSPRELAAFTNS--------------------YNTGEVTKPFIVKPVASSCGHGIFIIRKPQEI-----PMISNLLVSEYISNPYLID--GHKFDLRIYVLVTSPLTVYIYKDGLARFASEKYSKEDFEEQYCHLTNYSLNKFSDHFIRNEDSGHKWTLGAALRRMKVDG--VDTKLLMVRIESIVLKTLISVQGSITARCRSKCCFELFGFDILIDSDLKPWLLEVNLSPSLDSPLDLQLKSALVCDTLTLAAIPL................ 405
331 0.000e+00UniRef50_UPI000B99A61E tubulin polyglutamylase TTLL5-like n=1 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B99A61E  ali  22  4............................RVGQDVSDFNLLWTGIHPKPD--ALRSLAAHQRVNHFPRSYELTRKDRLYKNIEKMQHT-----KGVKHFDFIPQTFIMPGDFRDLMTCHYRQ----------------------RGPWIVKPVASSRGRGIYIVNSPDEVPVEESVVVA-----KYIDRPLLI--AGHKCALRLYVAVTSPLLIYMYEEGLVRLATVKYDSKHLWNPCMHLCNYSINKHHSDYIKSDDPGHKWTLSALLRHLRKRGVEGDTGQLMQRIEEVVVKAIMATAPSIVAACHPNNCFELYGFDILIDYQLKPWLLEVNLSPSLGSPLDTRLKSAMLADLLTLVVPALDPVTRP.......... 331
332 0.000e+00UniRef50_V4AN87 Uncharacterized protein n=2 Tax=Bilateria TaxID=33213 RepID=V4AN87_LOTGI  ali  23  85........NLSGTRYEVVRQMVEKLGYSVSKEDDWGAYLIWNDSFVSFDRIS--DLKSYQRMNHFPGMGEITRKDSLARNILRLQKV------FPNEYDFIPKTWILPSD-----------------YNLLLGHARELKSKKKQRTFIVKPSNGAQGHGISLYRNAEKIMQ-----SEHTIVQEYIDKPLLLD--GFKFDLRVYVLVTSPLRIFLLNDGLVRLCTERYNDSNVGRLYMHLTNYSINKHSETYEKSVDTGSKRSIQYLNEYLRRNHHD--VNKLWTDISEMIVKTMIAAEPHVLHAYRMCRCFEILGFDFMVDRKCRPWLIEINRSPSFGTDIDYDIKSALVEDTLKLLIKISDKRRNAEAQKRLF... 442
333 0.000e+00UniRef50_Q9VX74 FI09605p n=65 Tax=Bilateria TaxID=33213 RepID=Q9VX74_DROME  ali  23  71.....................FQKRGWLQVPSFNGEWNFYWANCRYIFGIDHPYRMRSDQVINHFPNSIELSRKDLLIKNIKRYRKDLERRG-DPLAQSHPPDTKLGIGGRYKHLDIIPMTFVLPSDYQMFVEVFHR----NPASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYDNRDTCVISKYIDNPLLI--GGKKFDLRLFVLVTNPLKAYLYKEGFCRFCTEKYDETEIDNVFMHLTNVSIQKTNQEY--NSIHGGKWPLQNLWLYLDSLRGEGVSDMLWSRITATIRHSLDAVAPVMANDR---HCFEVYGYDIIIDNNLKPWLIEINTSPSMHSTTDRMLKSRLIDNVLDVVVPP................. 414
334 0.000e+00UniRef50_A0A158NC37 Uncharacterized protein n=44 Tax=Hymenoptera TaxID=7399 RepID=A0A158NC37_ATTCE  ali  20  117..RFLTICMVNCKYD-VVRRMAVRFGMKEVTEDSS-WDLYWTDQNINVERI--KDMKRFQRINHFPGMTEICRKDLLARNLNRMQKL------FPKDYNFFPKTWCFPADHGDAMAY---------------------AKARRSKTFIIKPDASCQGRGIYLIKHLKDIKS---SDRERLICQVYIARPFLID--GYKFDLRIYTLITSPLRIYVYNEGLVRFATSKYKEPNISNMFMHLTNYSVNKHSQMYIIDDEIGSKRKISTLNKWFKT--KNVDVDELWSKIDEIIIKTIIVAYPVLKHNYHACACFELLGFDILLDWKLKPYLLEVNHSPSFHTDIDRDVKEGLLMDTFDILNLQYDKKKIIEEDRKR.... 465
335 0.000e+00UniRef50_J9IVT2 Uncharacterized protein n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9IVT2_9SPIT  ali  23  277...............KLIRAILENNGFLQTEAH--DWNILWTCQSMKPSQYEG--LNENQKINHFPQSYELTRKDRLCYNIVQMQ-----DKFDKEEFNIIPDTYILPDEFAD-----------------FYSHFHKLKSKEQSNLWIIKPQNSSQGKGIYIIDDISEV-----PIDESCIVSKYITNPLLI--NNLKFDLRIYVLITSPWRIYVYHEGLARFASEPYQVQSSKNKFAHLTNYSINKKNEKFVPNDDTGHKWSLGALSKHLEQIGID--LNLMWSKIYDVIIKSLLSVYNNLKKLPNKNNCFELLGYDILIDNDLKPWLMEVNLSPSLATPLDLKIKSGLMIDTFNLIGVKKFDRRRDN......... 609
336 0.000e+00UniRef50_A0A1B0CZT0 Uncharacterized protein n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0CZT0_PHLPP  ali  22  172..RYRFMNTET----RLLRKILGGHGLKEAEED-ETFNLLWTGIHLKPD--ILRNLLPYQRVNHFPRSSELTRKDRLYKNIEKMQHLRGGSKNF----DIVPESYLLPTEYRDLVSAH----------------------NKYRGPWIVKPAASSRGRGIYIVNSLDKI-----PSDEQLVVAKYISDPLCID--GHKCDVRLYVAVTSPLLIYVYEEGLVRLATVKYNRSSLWNSCMHLCNYSINKYHSDYIGDEDVGHKWTLSALLRHLKSQGCDT--EQLMLNIEDVIIKAIFSCAQSIVAACRMFNCFELYGFDILIDDTLKPWLLEVNLSPSLGTPLDAKVKASLLTDLLNMVGIP................. 525
337 0.000e+00UniRef50_D2Z0I4 Tubulin tyrosine ligase-like family, member 9 n=43 Tax=Eukaryota TaxID=2759 RepID=D2Z0I4_CHLRE  ali  22  10.....IKW-RSSLKNTIYDVLQSKTEWVETESE-TDWDFFWADKGWIHHELDKLHLADWQRINHFPNHYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFFPLTYVVP-----------------SEYRMFVEEFKR-----SGGVWIMKPIGKAQGQGIFLFNKLSQISDWRRDHPETYLAQRYLEAPYLV--GGKKFDLRIYALVTSPLRIFLHRSGFARFTNTRYSTEDITNTYMHLTNVAIQKHAPGFDSQ--KGMKWSIRSLRTYITTKHGEAAAAELFHAIQNIIIRALLAVQPAMINDK---HCFELYGYDVMIDANLKPWLIEVNASPSLTASADWVLKTAMLEDLLDIV-DLEGRREKVELRLGGFDLI 374
338 0.000e+00UniRef50_C1MNT4 Predicted protein (Fragment) n=2 Tax=Micromonas TaxID=38832 RepID=C1MNT4_MICPC  ali  19  1.....LKWRSDFDKFVVVSN-FEKRGWERAHQTSSSWNVYWANVHHLFHPSAESRLGDHQVVNHFPNHYELTRKDLMVKNVKRYRKELEKEAALAAALRGNGLGGVAVPTPTDHLDFVPLTFSLPADYSLFAEEFRRGGGDNARTTWIMKPTGKAQGKGIFLVNKLAQVKRWANPAQEAYIVSRYVHNPLLI--GGKKFDLRLYVTVTSPLRAFISKLGFARFCNVKYSGDDIDNPFVHLTNVAIQKRGEEYNESH--GNKWPLRDLRLHLESTRGKTATDALFAAMRDCVTHSLRAVSNVMVNDR---HCFELYGYDLLVDESLKPWLIEVNASPSLSTEADRRLKCRVIRDALLVAVPP................. 404
339 0.000e+00UniRef50_A0A2A6C9S5 Ttll-9 n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6C9S5_PRIPA  ali  23  49..............NTILDVLSRRTGWEVATGEE--WNFHWATREWMSTSFDRYKFTSRQFVNHFRNDFELTRKDNLIKNFKKMKRTLEKNKKEFAKYSFMPASYVLP-----------------SEYHIFVEEFKKYP---DNTIWIMKPVAGAQGRGIFLFRRLKHIQEWKKKDAQPYVVQAYISRPYLI--GGKKFDARIYVLVTSPLTAWVHREGFARFSHSRYTTDCVEDAFVHLTNVAIAKTAPDY--DPEKGLKWSLNRLIRFYESSFSKQRVQEMISDLANLIVNSLKCVESLIIQD---SHCFELYGYDVLFDEDLKPWLLEVNASPSLSSQDDYRLKYRVLSHMLDII-DLEGKREGNEIHVGGFDQL 392
340 0.000e+00UniRef50_J9HUU5 Tubulin-tyrosine ligase family protein n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9HUU5_9SPIT  ali  19  3..........NGVEARLIRSLCEDNGFREATKRDQEFTVMWACSNIKSQVY--QSLTKYQKVNHFPKSTEITRKDYMYRLLARMREIHGAKHYG-----FVPLTFILPNELQELNEAMQADSSKQ---------------------WIVKPSSSSQGKGIFLTNTINDI-----PPKQSMIASQYIANPMLIDD--YKFDLRIYVAITSPLRVYIYDEGLTRFATVKYTQTNKKQRYVHLTNYSLNKYNANFINNDDQGSKWSLAALRRKMTTMGIDH--EKVFQKIDDIILKTIIAGENVINNATEMFNCFELLGFDVLIDDQLEPWLLEVNLSPSLNSPLDQKIKSNLIADLFNLA.................... 328
341 0.000e+00UniRef50_UPI000C6C4871 probable tubulin polyglutamylase TTLL1 n=1 Tax=Drosophila hydei TaxID=7224 RepID=UPI000C6C4871  ali  23  73.....................FQKRGWHKVPAFDGEWNLYWANCRYIFGVDHPYRMRSDQIINHFPNSMELSRKDLLIKNIKRYRKDLERKGDALAMTHPNSTKLGVGGTRYMYLDIIPMTFVLPADYNLFVEQFHK----NPASTWIVKPSDKSQGVGIYLINKLSKLKRFAYEHRDTCVISKYIDNPLLI--GGKKFDLRLYVLVTSPIKAYLYNEGFCRFCTQRYDQTEIDNVFMHLTNVSIQKNNKEY--NTIHGGKWSMQNLWLYLDSIRGEGVSKKLSCRISETIRHSLDAVAPVMANDR---HCFEVYGYDIIIDNNLKPWLIEINTSPSIHTKNDCTLKTRLIDNVLDVVIPPPDERWSKTPSQRNFTLI 439
342 0.000e+00UniRef50_A0A0L0DV92 Tubulin polyglutamylase TTLL13 n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DV92_THETB  ali  22  176............CKYEVVRACVAELGWHVQESNAARWDVYWIDSTAPL--QILSTMKPFQRINHFPGMHEICRKDSLARNLTRMQR------KFPDAFTFFPKTWILPADYGDFKAHFRKRSAKPL---------------------ICKPENSAQGKGIFLTHTGDEIGAF-----DHYVAQVYVNNPLLID--GYKFDLRIYVLVTSPLRIFIYDDGLVRLCTEKYSSKSLGSAFQHLTNYSVNKKNTNFSGDGSDGAKRSIKVQNAEWAAAGID--VPALWASIEDAIIKTLITAQPTLAHTYATFQCFEILGFDIMIDAALKPWILEVNHSPSFGTDIDRNVKSGVIAEALALLNLDPKAKSR........... 512
343 0.000e+00UniRef50_A0A0L8H9G0 Uncharacterized protein n=1 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8H9G0_OCTBM  ali  24  468MNR-LLRWRLSPITPLVVKSALVRARFKLTNKHY-DWIGCFGKHMKSQAFRV---LRDFQKLNHFPGSFQIGRKDKLWRNLSKLQ-----SHFGKKEYGFFPQTFILPTDLKVFKKNW--------------------DDGGNRVKWIIKPPASARGKGIRVIYKWSQI-----PKRRPIIVQRYLSRPFLI--NSSKFDIRLYILVSSPLRIYLYDDGLVRFASCKYTTSSLNNRCIHLTNYSINKMNPSYLNNMGDGHKWSLKALWSYLKKQGINS--QPIWESIKDIIIKTIVSGEAVVANLKSPYSVYELFGFDIILDEYLKPWLLEVNISPSLHTPLDVSIKEPMVCDVLNIA.................... 800
344 0.000e+00UniRef50_I7LUA7 Tubulin-tyrosine ligase family protein n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7LUA7_TETTS  ali  23  77..KKIVVDLSNTKYDVIKQICSESFNWNITYRSNADWNIKWQD--FYINEDDLRRMLPYQKINHFPGSYNLGKKNYLGKNLSKMR------LKFPDDFDFCPRTWLLPYQYEDLRNFYEKNK-------------------SKKPVFIVKPEASCQGKGIYLVKKFSTLKQ-----DQHMVVQEYIKHPFLID--GLKFDFRVYVLVKSPLKVFIYREGLARFATCKYSKKNLKNMCMHLTNYAVNKHNPEFQNQDNVGHKRSFSSILKYLEDNGKDA--TGVFLQIKQIVNKTMCSVQPYLSHLYRSCQCFEVFGFDIMLDDDLKAYLIEVNHTPSFTTPLDYHIKHSLITDTL-ILVDTRNKAK............ 423
345 0.000e+00UniRef50_A0A2T7P571 Uncharacterized protein n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7P571_POMCA  ali  24  26....VFRFHENGGGPELLREVFEERGWVEYEQEDDNWNLWWRSSYFNIRDYE--NICPWQHLNHFPKTSAITKKDALVRNLRRMQCLHGSNIF-----NFSPLSFNLPNDYHKF----------------LKEHEAMRDTSKKKILWICKPADLSCGRGIFIFQDVSGLL-----YDCGSVVQQYIENPLLI--GGYKFDLRIYIVVTHPLVVYAYEEGIVRFSTEKFDLNKTDNIFAHLTNFSINKYSPAYTVNVGAGCKWTLKQLRHYFFIN--NIDDRMLWRQIINIVVLTLMTQAPLVPKVK---NCFELFGFDVLVDETMKPWLLEVNCSPSLLSDCDIQVKKQMLHDLIDLI.................... 354
346 0.000e+00UniRef50_A0A0T6B3W8 Uncharacterized protein n=1 Tax=Oryctes borbonicus TaxID=1629725 RepID=A0A0T6B3W8_9SCAR  ali  23  521..RRYLKWKLSTITPIVVRKTLQNTGVLLVRKSNE-WMGTWGKHMKSP---LFKTLKEEQKLNHFPGTFQLGRKDRIWRNLQKL-----MMKFGQKEFGFMPQTYVLPQDLKLLKQCWVNKNGSGDE------------------IFIIKPPASARGVGIKVINKWNQL-----PKKTAIVVQRYVSNPYLI--NGSKFDLRLYVLVTSPLRIYLYPDGLARFASAKYSVKDLKDRYMHLTNYSINKLSSQYTANEDQGHKWTLSKLWEFLETEG--VDTKALWKNLENLVIKTMICGESPIDHLMSRYNSYELFGVDVLLDDRLKPWLLEVNISPSLHSPLDAHVKGPLVKALFDIAQFHLPTRLNRIAN....... 868
347 0.000e+00UniRef50_A0A1R2BU85 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BU85_9CILI  ali  25  98.YKFIKSDV------KIVKTVLEAAGFIPTTSH--DWSILWSCGTPNNFFY--QNLNIGQRVNHFPSSTEITRKDRLCYTITQMQ-----EHFGKKNYDITPDTYNLPDEFADFYAHFHNEKHVK---------------------WIVKPPASSQGKGIYLVDSINEV-----PIDENCIISKYIENPLLI--NDLKFDIRIYVLVTSPLRIYMYEEGLARFASEPYNLLSKKNKFSHLTNYSLNKHNENFYRNDDVGHKWSLSALCRHLEAEG--VDIELMWMRIYDLIIKTIIASEPAVVAACHHNSCFDLFGFDVILDSGLKPWLLEVNLSPSLSTPLDYHIKSNLLIDAFNLMGIGPLERKK........... 432
348 0.000e+00UniRef50_UPI00084DCAE2 tubulin monoglycylase TTLL3-like isoform X2 n=1 Tax=Xenopus laevis TaxID=8355 RepID=UPI00084DCAE2  ali  24  286............................................................................LEHNDIDMETESTPAMTDAQWEEFLRGYYQVIHDGATIEHSEYYVEQCSEVLHKLEAANPQLDIEGERNIWIVKPGAKSRGRGIICMDRLEEILKLVDCKDGKWVVQKYIERPLLI--FGTKFDVRQWFLVTDPLTIWFYKECYVRFSSQVFSLENL-DTSIHLCNNSIQKHFENSQTRHPTDNMWSSKQFQVHLQKLGAPHAWETIVPGMKAAIIHAMQSAQDIVEYRKS---SFELYGADFMFGENFQPWLIEINASPTMSTPVTSKLCAGVQEDTLRIVV---DRKLDRNCDVGAFELI 591
349 0.000e+00UniRef50_F7EIF9 Tubulin tyrosine ligase like 2 n=4 Tax=Theria TaxID=722675 RepID=F7EIF9_MONDO  ali  24  21............TTPEIVKNVLLERGWKKFNEDVGDWNLYWRTSSFRM--IDYKNVKPWQRLNHHPGTITLTRKDYLARHLKHMKGIYGAS-----LYAFSPLTFIMPYEYIKFVAEYSR---------------EKEALGKKPSYWICKPAKLSRGRGIKIFSDLKDLI-----FDCTTVVQKYISNPFLI--AKYKCDLRVYVCVAGPLTIYIYQEGLARFATEQFDLTNLKNNCAHLTNSSINASYKKNKVGVGRGCKWTLTRFFSYLRSN--DVDDLLLWQRINHLVILTMLSIAPSVPFV---SNCFELFGFDILIDDKFKPWLLEVNYSPSLDCSIDESVKRKLIHDIIELM.................... 342
350 0.000e+00UniRef50_UPI000B988B49 tubulin polyglutamylase ttll6-like isoform X1 n=6 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B988B49  ali  20  96..........NCKY-EVVTKIAKSFGMRSVR-ECDNWNLYWTDHTVTVER--AKEMKRFQKVNHFPGMAEICRKDLLARNLNRMLKL------FPKDYNFFPKTWCLPADLGEVIAY---------------------SRSHPNKTFILKPDVGCQGKGIYLTKNVKDVKPY-----ERMICQVYIHKPFLID--GFKFDMRIYALVTCPLRIFVYNDGLARLPPSRYKEHNTTNIYMHLTNYSLNKHSRMYVVDDEAGSKRRLSTLNQHLEKLSYD--VERVWAAVDDAIIKTILAAHPVLKHSYKACACFELLGFDILLDYRLKPYILEVNHSPSFHTDLDADVKESLLEDTFRILLAQCHRKRALDEDRQR.... 435
351 0.000e+00UniRef50_T1IDB6 Uncharacterized protein n=4 Tax=Cimicomorpha TaxID=33354 RepID=T1IDB6_RHOPR  ali  24  18........TMNCRY-EIVRDVAESFGMKEA---SDGWNVYWTDMSV--NHDRCKEMKRYQRVNHFPGMLEICRKDLLARNLNRMLKL------FPSDYNFYPRSWCLPTEL--------------NEVLEFCKVYRNKPL-------IVKPDIGCQGKGIFITKNLNDIKDL-----DKMICQVYISKPFLID--GYKFDLRVYVLITSPLRIYVYNEGLVRFATKRYNGSNISNMYMHLTNYSVNKHSRAYVNDAEGGSKRRISTINHWLMDRFYNT--ERLWKAVDDVIIKTIIVALPSLNHSYHACACFELLGFDFILDNKLNPFLLEVNHSPSFHTDIDLEIKEALLKDTFNLLNLSSNDKQK........... 349
352 0.000e+00UniRef50_A0A1R2BU47 Uncharacterized protein n=2 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BU47_9CILI  ali  24  8......VNINSKKYYPVVGAATKSLGW--STTLAHDWDILWRDGSVSLS--TLARMKTTQKINHFPGMYEISRKNCLAKNLNRFRET------FPEDYDFYPETWILPQDIEGFKS-----------------------VLNNKNTLIIKPDASSQGKGIFLVNKIEEVKDL-----KNVIGQKYINNPLLID--GLKFDLRIYVLVADPLRVYIHEEGLARFATEPYSPNNLNNRFMHLTNYAVNKHNEKFIGDNEQSHKRSFSSILKKLEKEGRDSA--NLWDDICDIIIKTLLTAQPFLATSYKSAQCFEVLGFDILIDSDLRPWLLEVNFTPSFTTPLDLNIKKQVITDTLRLV-SLPDRSKQ------VFEKI 352
353 0.000e+00UniRef50_UPI00046C1D72 tubulin polyglutamylase TTLL7 isoform X5 n=1 Tax=Chrysemys picta bellii TaxID=8478 RepID=UPI00046C1D72  ali  22  41....ITANVAGTKY-EIVRLVIDELGFVKTRDEDETANLIWSDSAVQQDKIA--ELRNYQRINHFPGMGEICRKDFLARNMTKMIKSQ------PQEYSFIPRTWIFPAEYMQFQNYV-----------------KELKKKRRQKTFIVKPANGAMGHGISLIRNGEKLQA-----QDHLIVQEYLDKPFLME--GYKFDLRVYILVTSPLKIFLYHDGLVRMGTEKYSDSNLSQLYMHLTNYSVNKHNEHFERDEDKGSKRSIKWFTEFLQTNHLD--VSKFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKKGVLLNALKLLIRTSDKRRNLAQQK...... 393
354 0.000e+00UniRef50_UPI0006239B19 tubulin polyglutamylase TTLL5-like isoform X1 n=1 Tax=Linepithema humile TaxID=83485 RepID=UPI0006239B19  ali  22  113...............KLINLLLQSHGLVEVPMNETDFNILWMGNHPKPD--ILRNLMPYQKVNHFPRSYEITRKDRLYKNIEAMQRSKGLRNL-----DFIPQTFLLPAEVRELISAHFRY----------------------RGPWIVKPKASSRGRGIYIVNNPEKILT-----DESVIVAQYINNPLLVD--GHKCDLRLYVAVTDPLLIYLYEEGLVRFAAVKYDGGNIWNPCMHLCNYSINKFHVDYVKSEDPGHKWTLSALLRHLRVKGQDT--ELLMQRIEDIIIKSILATASGIVSVKHPDACFELFGFDILIDDTLKPWLLEVNLSPSLGSPLDVRLKSALISDLLTLVLPAVDPILRSQ......... 445
355 0.000e+00UniRef50_A0A0M0K4Q9 Tubulin polyglutamylase ttll6-like protein n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0K4Q9_9EUKA  ali  22  95............CKYDVVAQAARGLGWRCTTDEHEEFNLLWNDSYVP--FDTIAQLNKYQKVNHFPGMSELAKKNLLAKNLNRI------AKQMPGEFGFVPPTFILPGEAEPLKSWFQSQYLEPLIRPSNPTRYPRHPAQKRKPTLIVKPDAGCQGKGIFLTKHLDDVVEA-----DGMIAQQYLQTPLLVD--GYKFDLRLYVLVLSPMRILLFKEGLARFCTERYNESNLDDAYMHLTNFAINKHHEEFTIDEDGGHKRSVSSLFAWLKQVGY--ATERIWAQIKQLIVKTLLSVQPHLAHVYHSFSCFEILGFDVILDRKGKPWLLEVNHAPSFSSQLDQKIKLELLRNTMRLIHLQAYHKKKFKQEQQL.... 480
356 0.000e+00UniRef50_A0A267G9L8 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267G9L8_9PLAT  ali  21  7.......................................................MRKYQKINHFPGMSEICRKDCLARNLSRMRRL------FPKEFNIAPRTWVLPADYADLQAY---------------------ARSRKHRTYILKPDAGCQGRGIWFTRCVKDI-----KPTDNLVCQLYVSRPFLIDD--YKFDLRVYVLVADPFRIFVFKDGLARFTTVKYSAVNLDNVYMHLTNYAVQKNCQQYVRNDEEGTKRRISTINRWLAKNGHDVA--KLWSDIDDVIIKTILSAHGVLRHNYRSCACFEILGFDIILDRSLRPLVLEVNHSPSFSTDLDLDIKSALILDTLRLVIGAVDKRKRRKARDRLFQR. 314
357 0.000e+00UniRef50_UPI000719DA8D tubulin polyglutamylase TTLL13-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719DA8D  ali  23  169...........................................................QKVNHFPGMSEICRKDLLARNMNRMQKQ------FPKEYAIFPRTWCLPADAGDFQTYV---------------------RTKKNKTYICKPDSGCQGRGIFVTRNPKDIKPF-----DDLVCQVYVSRTFLID--GFKFDLRVYTVVTSPLRIYVYKDGLARFATTPYSPQNVENVYMHLTNYAINKNSADFVRDDEAGSKRKISTINRWWAQHGYDC--GRVWADIDDVIIKTLVAAYPTLKHNYRTCACFEVLGFDILLDHKLRPYLLEVNHSPSFTTDLDKEIKDGLVYDTLGLIFAACDRRK............ 455
358 0.000e+00UniRef50_U3JTZ5 Tubulin tyrosine ligase like 7 n=13 Tax=Bilateria TaxID=33213 RepID=U3JTZ5_FICAL  ali  21  43....ITANIAGTKY-EIVRVVIQEMGFVKTRDEDETANLIWSDCAVQQEKIA--ELRNYQRINHFPGMGEICRKDFLARNMTKMIKSQ------PQEYSFIPRTWIFP-----------------SEYTQFQNYVKELKKKRRQKTFIVKPANGAMGHGISLIRNGEKLQA-----QDHLIVQEYLDKPFLME--GYKFDLRVYILITSPLKVFLYHDGLVRMGTEKYSDSNLSQLYMHLTNYSVNKHNERFERDEDKGSKRSIKWFTEFLETN--NLDVSKFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKRGVLLNALKLLIRTSDKRRNLAQQK...... 395
359 0.000e+00UniRef50_A8J0Y4 Predicted protein (Fragment) n=3 Tax=Chlorophyta TaxID=3041 RepID=A8J0Y4_CHLRE  ali  21  9.....IRINLSACKYEVLRIVQRKLGWKEV-GDEDDWELYWTDTSVSIERI--MKLTKIQKINHFSGMLEICRKRAMARNLMKM------AKAFPQHFDFFPRTFVLPSDREDFLAD--------------------VRSRGKKQVYILKPDAGCQGRGIRLVQGGKE-----EMASPNVVAQHYLYNPMLIH--GYKFDLRIYALVLSPLRVFLFHEGLARFCTEKYSPSNLDVAFMHLTNYAVNKKNEAFVSAAAASAKWCLAQLRHYIESTG--ASYDQVWGDIADLIIKSLCSVQPVLRNNYRSCSCFEILGYDVMLDDAMRPWLIEVNHSPSFNSPLDLAIKEELI........................... 340
360 0.000e+00UniRef50_A0A1R2AS92 Uncharacterized protein n=3 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2AS92_9CILI  ali  25  13....IVCNVGDTQYEVVKHVAKKKLCWHLNEDFDDEWDLEWTDNAVSPDKLS--KMRPYQKINHFPGMYGICKKNYLAWNLNRMWKL------FPNEYNFYPKTWVLPGDWIDLKNNW-----------------------GKNKFFILKPEASCQGKGIFIVNKIEEV-----NPNERLVAQEYLKEPLLID--GLKFDLRIYVLVASPMRVYIHDQGLARLATEPFNSGNMQDMCMHLTNYAINKNSSKFVFNDDVGHKRSLVSIFEYLQGEGYDT--KSLMKSIEDIIMKTLCSVQPYLAHLYKTCQCFELLGFDIILDSSLKPWVLEVNHSPSFSTPLDWKIKKKVIRDTLLLLGVKAKTRKK........... 356
361 0.000e+00UniRef50_UPI0007E7CAB8 tubulin polyglutamylase TTLL5 n=2 Tax=montium subgroup TaxID=32352 RepID=UPI0007E7CAB8  ali  23  224...............KLLRKLFNVHGLTEAQGEN-NFNLLWTGVHMKLD--IVRNLAPYQRVNHFPRSYELTRKDRLYKNIERMQHLRGMKHF-----DIVPQSFVLPIESRDLCVAH----------------------NKHRGPWIVKPAASSRGRGIFIVNSPDQI-----PQDEQVLVSKYIVDPLCID--GHKCDLRVYVLVTSPLIIYLYEEGIVRLATVKYDADNLWNPCMHLCNYSINKYHSDYIQDEDVGHKWTLSALLRHLKLQSCDT--RQLMLNIEDLIIKAVLACAQSVISACRMFNCFELYGFDILIDNALKPWLLEINLSPSMGSPLDTKVKSCLMADLLTCVGIPAYSPEMRS......... 554
362 0.000e+00UniRef50_R7UAZ0 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7UAZ0_CAPTE  ali  23  299...YPVSANLSGTRYDIVRQMVEQAGFTISRHEDPMAYLIWNDSFVSTERIS--ELKPFQRINHFPGMGEICRKDCLARNMAKMAKAH------PEDYSFVPKTWILP-----------------SEYTAFQTYARDLKKKKKSKTFIAKPSNGAMGNGISLFRNTEKI-----PQNENIIIQEYIDKPLLIE--GFKCDMRIYVLITSPLRVFLFNDGLLRLGTEKYTDGNIDHLYMHLTNYSVNKHNDRYEKSHDTGSKRSLKFFNDYLR--RHDYDVSHLWKNITELIVKTLIVSLPHIMHAYRMCRCFELLGFDVMLDKKLRPWLIEINRSPSFGTDLDYDIKSSLVEHTLKLLIKASDKRKNIAAQK...... 653
363 0.000e+00UniRef50_UPI00084B9CF8 tubulin polyglutamylase TTLL4-like n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084B9CF8  ali  23  382...KLLKWRHTPITPLIIRKTVANSGYKMTKRT-LLWSGTWGKHMKSTCY---KSVKSYQKVNHFPGTFQIGRKDKLWSNFLRLQNRFGKEEFG-----FIPKTFVLPAELSALKTAF--------------------DKEGVKKKWIVKPPASARGTGIQVVDKWSQL-----DQESQLVVQRYVSRPYLI--NNTKFDLRIYVAVTSPLRIYLYNDGLVRFASVEYRNESLSDRFMHLTNYSVNKSSSSYTHNAEQGHRWTLWSLWAYLKPLGIDT--GAIWSRIADMVIKTVMSGEHDIITRRSKYSSYELFGFDVLLDEKLRPWLLEVNISPSLHSSLDYKVKGPLMSSLLTMAFHVPDHR............. 721
364 0.000e+00UniRef50_A0A158NL81 Uncharacterized protein n=10 Tax=Hymenoptera TaxID=7399 RepID=A0A158NL81_ATTCE  ali  21  111...............KLINLLLQSHGLMEVSMNETDFNILWMGSHPKPD--ILRNLMPYQKINHFPRSYEITRKDRLYKNIEAMQRSKGLRNL-----DFIPQTFLLPTEARELISAHFRY----------------------RGPWIVKPKASSRGRGIYIVNNPEKILT-----DESVIVAQYINNPLLID--GHKCDLRLYVAVTDPLLIYLYEEGLVRFAAVKYDGGSVWNPCMHLCNYSINKFHVDYIKSEDPGHKWTLSALLRHLRSMGQDT--ESLMQRIEDIIIKSILATASGIVSVKYPETCFELFGFDILIDDMLKPWLLEVNLTPSLGSPLDVRLKSALITDLLTLVVDPILRSQNSNR........ 447
365 0.000e+00UniRef50_A0A088AHJ7 Uncharacterized protein n=8 Tax=Apocrita TaxID=7400 RepID=A0A088AHJ7_APIME  ali  23  10...FVFRLNDNGTGPHLLTQVCTERGWREYTGENNRWNLWWRSGGFPLPHYKL--LLPWQFINRIPKGSSICRKDNLIRHLRCMKKMHGSI------YDFSPVGYNLPSEYTKLAEEWSRCEHDR--------------------VWICKPVGQSQGKGIFLFRKLSDLT-----YDNAAVVQRYIENPLLI--GGYKFDLRLYVCVPSPLTIYLYKEGLARFATEKFSLEHLNDSFRHLTNFSLNKLGPGYSEKKESGCKWTFRQLRRYFEQAGYYDWF--LWQRIACLVSLTILSQAASIP---KSSNCFEFFGFDVLIDKNLKPWLLEVNLSPGLSNDCDSEVKKPLLHDLFDLL.................... 335
366 0.000e+00UniRef50_A0A1R2CL98 Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CL98_9CILI  ali  22  92MFKFLGGEV------KLIRWLLEDNGFKE---GKNNWLIGWSNTAMRSQIY--QNLTPFQKVNHFPRSHEITKKDNLFKNITKMQSLYGKR-----HYNFIPETYILPNDSMRLSEEMDRDSE---------------------SLWIIKPAAGSQGRGIFLTNRISDV-----PQAQAMVASRYISNPLLI--NMLKFDLRIYIAVTSPLRIYIFKEGIARFATEPYDLKNPRNRFVHLTNYSLNKYSPHFKDMNEDGKKWTLTALKGFLESQG--VNFQSIWEEIKDIAVKAIISIESVINSAMSMYNCFELLGFDILIDNNLRPWLLEVNLSPSMNTSVDLKIKSALISDLFNLIIRKLEPRKRRNSN....... 428
367 0.000e+00UniRef50_L1J6Y6 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1J6Y6_GUITH  ali  23  6...KRLNVNLSMCKYSVIENCCKSLGFKITQSESQ-WHLFWTDMSVGEERC--MRLRRPQKLNHFPGMQEIAHKCKLAKNLNRMQTEL------PGLYNFHPETFSLPVEFNAFQ----------------RAALGDGKEKKSRKTYIVKPDDGACGVGIFLTRKPSSI-----PRKLSCVAQRYMGKPLLIE--GKKFDLRLYVLVTNMLRAYLFSEGLARFASEAYSTGNMDMRYMHLTNYSVNKQHKDFETDEEKGSKRSLGFVRSWLRANGYD--VKKIWEDIERCIVKTLLAVQPQVAHAYRTFSCFDLLGFDILLDEEGKPWVIEVNEMPSFDTPIDEAVKTAVVTETLLLV.................... 347
368 0.000e+00UniRef50_K7IY53 Uncharacterized protein n=21 Tax=Apocrita TaxID=7400 RepID=K7IY53_NASVI  ali  25  23...........CDYPSTPLRVLQARGWRQVDDSS--WDLWWCETGELRLALEGRSLRPQQRVAHFLSHCELTRKNYLYRNLKRYKRLLLRAGKSRE---------------AELCDAMPTSFELPSEYRMLVEEYRRA----PGTTWIVKPASGSQGRGIFLFQRLRDLNEWRAKSQDTYLVQKYIDNPYLLE--GRKFDLRIYVLVTSPLKVWLAREGFARLSSEQFSLERIDDSRVHLTNMSIQLR---PNRNLGLGRKWALNCLREYLTERHGARTVNDLFKRIAGIIMASLQAVQSAIIPLR---NSFELYGYDVLLDERLRPWLLEVNASPSLTDPADFRLKFDLVDDVLS-VLDLERRLTGREQRVGGLDLL 382
369 0.000e+00UniRef50_UPI000CEF621F tubulin monoglycylase TTLL3 isoform X1 n=1 Tax=Terrapene mexicana triunguis TaxID=1415176 RepID=UPI000CEF621F  ali  24  57.............................................................................................GARWGDFLRAYYQVIHEGALLDQLGSHVEQCEHVLQRLAEVLPQLEMEGDRNIWIVKPGAKSRGRGIICMDRLEEMLKLVDCKDGKWVVQKYIERPLLIH--NTKFDLRQWFLVTDPLTIWFYRDSYLRFCTQPFSLHNL-DTSIHLCNNSIQRHYENSLSRHPPDNMWSSQQFQAHLQQAGAAGAWQEIVPGMKAAIIHTMQTSQDVVEFRKS---SFELYGADFMFGENCQPWLIEINASPTMSTAVTSRLCASVQEDTLRVVI---DRKHDRSCHTGAFELI 345
370 0.000e+00UniRef50_UPI000A2A9095 probable tubulin polyglutamylase TTLL2 n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A9095  ali  23  13..............PEILRDVCVERGWKEYEEDEDEWNLWWKSSGFRTSDFESCR--PWQRLNHFPKSNSITRKDSLARNLRRMKGVYGNILF-----NFAPLSFNLPNDYRKFVTEYS------------------NGKDKRRSLWICKPADQSRGKGIFLFRNLTDL-----TYDCATVVQQYIQNPFLI--AGYKFDLRLYVLVTSPLQIYLYHEGLARFGTEKFDLNSLDNVYSHLTNTSINKFYATDKERIGSGCKWSLSQLRTYFYQ--HNVNDQLIWHRITAIVVLTLLMQAPEVQ--KDTASCFELFGFDILIDENLKPWLLEVNFSPSLGIDCDLSIKKALLDDTLK...................... 328
371 0.000e+00UniRef50_A0A267G9G2 Uncharacterized protein n=3 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267G9G2_9PLAT  ali  20  606..RRLLKWRLSSITPLVVKRVIGRSGFKISQKESDDWLGYFGKHMKPNGFRTIRE---YQKVNHFPGSFILGRKDRLWKGLQRMQRLHGRKAFG-----FAPTTYCLPGDLKEFKAAWDAASVGTAQQQQQR--------------WIIKPPASARGIGIRVVNKWQQI-----PKKRPVIVQTYLSRPYLI--NGSKFDLRIYVYVTSPLKFYVHEQGLVRFASVQYSSKTLGNRFMHLTNYSVNKHSASYTNGNPTGHKWSLQSLWAYLRRCGQSP--ERVWDSIKDLVAKTMISGESHIAACRRQYCVHELFGLDVLLDDQLQPWLLEVNISPSLHSPLDVRVKGAMVTDLMRLA.................... 968
372 0.000e+00UniRef50_F6SRA1 Uncharacterized protein n=10 Tax=Bilateria TaxID=33213 RepID=F6SRA1_CIOIN  ali  22  6....................................................FRALREYQKINHFPGSFQLGRKDRFWRNISRMQ-----TRFGKKEFGFVPQTYIMPWDKKLLKNAWE--------------------EGSSKQKFILKPPASARGIGIRVIHKWNQV-----PLKKAVIVQKYLSRPYLI--NGSKFDLRLYVYVTSPLRIYLFEDGLVRFATCKYSMKHLSNRYMHLTNYSINKKSGEFQQNDDQGHKWSLKALWGHLQEQG--VNTDKIWEQMKDTVIKTIISVEQFTNNCRRRYCCHELFGFDIMLDDKLRPWVLEVNISPSLHSPLDVEIKGPMVRDMFNLAFLVPDKRQ............ 301
373 0.000e+00UniRef50_A0A1Q9CG17 Tubulin polyglutamylase TTLL5 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9CG17_SYMMI  ali  25  681..............PLLQETFLHNG---MVPTLGNDYVIQWSGPNIKDAVY--QSMTEWQRINHFPGSTELTRKDRLWHHFAEMARNYGK-----QCFDFVPETYVLPEQFDEFLTCYQRTRC----------------------TWIVKPNSSSRGRGIFILQDLSEL-----PVDETVVVSRYIMNPLLIQ--GLKFDLRVYVLVTSPLKAYIYREGLTRFASAPYSTDHMQDAFRHLTNYSINKNSCTFVENDNVGHKWSLSALNKHLRCVG--VDVDLMWTRIMDLIVKTLMSVEPAISNRTRRENCFELYGFDVLVDDELKPWLLEVNLSPSMESPLDWQIKSSLLADTFNIV.................... 999
374 0.000e+00UniRef50_C9JSD3 Tubulin monoglycylase TTLL3 n=16 Tax=Euteleostomi TaxID=117571 RepID=C9JSD3_HUMAN  ali  24  18................................................................................................WSLFLQRYYQVVHEGAELRHLDTQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPPDNMWSSQRFQAHLQEMGAPNAWSTIIPGMKDAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRMLDRNCDTGAFELI 303
375 0.000e+00UniRef50_A4Q9F0-2 Isoform 2 of Tubulin polyglutamylase TTLL7 n=26 Tax=Tetrapoda TaxID=32523 RepID=A4Q9F0-2  ali  21  40....IITANVAGTKFEIVRLVIDEMGFMKTPDEDETSNLIWCDAAVQQEKIT--DLQNYQRINHFPGMGEICRKDFLARNMTKMIKSR------PMDYTFVPRTWIFP-----------------SEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKV-----PSQDHLIVQEYIEKPFLME--GYKFDLRIYILVTSPLKIFLYHDGLVRMGTEKYNESNLTQLYMHLTNYSVNKHNERFERNEDKGSKRSIKWFTEFLQANQHD--VTKFWSDISELVVKTLIVAEPHVLHAYRMCRCFEVLGFDILLDRKLKPWLLEINRAPSFGTDIDYDVKRGVLLNALKLLIRTSDKRKN........... 388
376 0.000e+00UniRef50_A0DNY0 Uncharacterized protein n=4 Tax=Oligohymenophorea TaxID=6020 RepID=A0DNY0_PARTE  ali  20  1MQNKKLKWKSDFEKSVIIENFVNRGWIKEKEEESTDWNVYWANVRNIFNPKNGFRLNDQQIINHFPNHYELTRKDFMVKNLKRFKREQDKEVLETFNFDFLPTTYIFPGEYSLFVEEFHR---------------------NPNQTWIVKPAARSQGKGIFLLRKIQQLKKISGTSKENYVVSRYIDNPLLI--GGKKFDLRMYVLVTNPLKVWIYNKGFGRFCNEQYTTDEIENMFVHLTNVAIQQYSDKYSQKH--GGKYSIDALKLYVESAYGTDALQRMMDDIHNIMLTSLKSVQAVIQNDK---HCFEMYGYDILLDSNLKPWLIEINASPSLTTPVDKNLKMNLINDVYNIVLPNDDFPDNEQK........ 365
377 0.000e+00UniRef50_W5NFG8 Tubulin tyrosine ligase-like family, member 2 n=17 Tax=Gnathostomata TaxID=35060 RepID=W5NFG8_LEPOC  ali  22  20..............PELVREVLLERGWKEYSEEEGDWNLYWRTSVFR--DVEFENILPWQRLNHHPKTLGITRKDWLARNLKRM-----KGTFGSALYDFSPTAYILPNDYTKFLGEYTK---------------EKAANGGKPGYWICKPVDLSRGRGIFIFDDIKKL-----TYDSSVIVQRYISNPLLI--SGYKFDLRIYVCVRSPLTIYIYQEGLVRFATEKYQLTCLDNLYSHLTNTSINKFGPSYKERVGPGCKWTMSKFRCFLHSQKFDEI--LLWQGINSIVTLTVLTIAPSLP---FSPNCIELFGFDILIDDNFKPWLLEVNYSPALSLDCDVTVKKRLLHDLVDLL----NYKKIDSLRQSGY... 352
378 0.000e+00UniRef50_A0A1J1J5U1 CLUMA_CG019077, isoform A n=2 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1J5U1_9DIPT  ali  23 1572.YKFL-----NTET-RLLRKILNGHGLSEISHDATDFNLLWTGNQLKPD--MLRNLSQYQRINHFPRSSELTRKDRLYKNIERMQHF-----RGFKHFDIVPQTFLLPADYKELTFAH----------------------NKIKGPWIVKPVASSRGRGIFLAKTPDEIQSHIAS-DEQVVVARYIADPLCID--GHKCDIRIYVAVTSPLIIYVYEEGLVRIATVRYDNENLWNPCMHLCNYSINKYHTDYIGDEDVGHKWTLSALLRHLRNQGCNT--EQLMLNIEDIITKAIFACTQPIVSACRMFNCFELFGFDILIDDTLKPWLIEVNLSPSLGTPLDTKVKASLLTDLLTLVGVP................. 1907
379 0.000e+00UniRef50_Q9Y4R7-5 Isoform 3 of Tubulin monoglycylase TTLL3 n=6 Tax=Amniota TaxID=32524 RepID=Q9Y4R7-5  ali  24  18................................................................................................WSLFLQRYYQVVHEGAELRHLDTQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPPDNMWSSQRFQAHLQEMGAPNAWSTIIPGMKDAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRMLDRNCDTGAFELI 303
380 0.000e+00UniRef50_UPI000937C217 tubulin polyglutamylase TTLL13-like n=2 Tax=Stegomyia TaxID=53541 RepID=UPI000937C217  ali  19  146..........NSRYDIIPR-ICRRLGYRLVAEN-ELWNVCWTDSLVGVDFC--RDMRRFQKINHFPGMFEICRKDLLARNLNRMQKQ------FPTEYQIFPKTWVFPADLGEAIAY---------------------SRTHRSKTYILKPDQGSQGRGIFLTKNLKEI-----NPRDRMICQVYIHRPLLID--GYKFDLRVYTLVTSPLRIFVYKEGLARFATYKYCITNTSNNFMHLTNYSVNKYSRCFSNDDEAGSKRRFATLNRILTSEGYDIA--ELWNNIDDVIVKTILSAWQVLRHTYQASACFEILGFDILIDHRLKPYILEVNHSPSFHTDIDKEVKEALIHDTFVMLLNGEVKKRVLEEDKRR.... 485
381 0.000e+00UniRef50_A0A2J7R2D0 Uncharacterized protein n=2 Tax=Blattodea TaxID=85823 RepID=A0A2J7R2D0_9NEOP  ali  20  8...FVFRINDNGGGPNLLFQVCAERGWREYSECGDNWNLWWRTTGLPLSHY--KQLKTWQFTNHIPKGSSICRKDNLARYLRCMKKVYGTI------YNFSPQCYNLP-----------------LEYTKLVAEFSQGKNNG-NAVWICKPVGQSQGRGIFLFKDLGDLC-----YDSNAIVQRYIENPLLI--GGYKFDLRLYVCIPSPLTVYLYKEGLVRFSTDKFSMADLSNPFCHLTNSSLNKWGPGYNEKKEPGCKWSLRQLRRYFHQTKISDW--LLWQRVSALVVLTVVSQLSGIPS---TANCFEFYGFDVLIDASLRPWLLEVNLSPALGCDIDQIVKKPMLHDMFDLLGLPM-------CNTGL.... 343
382 0.000e+00UniRef50_A0A0G4EAN7 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EAN7_VITBC  ali  19  198..............PLVRENFIHN-GFTQTEGH--DWQILWAGSVLRDTIYE--QMNEHQKVNHFPGSTELTRKDRLWCSFAAMRRYY-----GDEVFDFLPESYILPEQYDLFVAAYHWYSGVGSPTNS-----PISSRQQNTQLWIVKPTCSSRGRGIFLLRDLREL----PGREEGCIVSRYIDNPYLIQD--LKFDLRVYVLVTDPLRVYVYKEGLTRFASSRYTCGDLS-RFKHLTNYAVNKNAAHYVANKDSGHKWSLTALNKHLRYMG--VDMHSVWRKVMDVIMKTLLSIEHTVIEKSKTSNCFELYGFDILLDSNLKPWLMEVNLSPSLDTPLDRKVKGQLLSDALNVVVTAIDRRALNEAR....... 545
383 0.000e+00UniRef50_A0A2J7QZW0 Uncharacterized protein n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7QZW0_9NEOP  ali  22  256......KWKLSTITPLVIRRTLVNSGFRLVRK-SNDWCGTWGKHMKSLCFKT---LKEFQKINHFPGTFQIGRKDRLWKNLYRL-----MTKFGKKEFGFIPRTYVLPQDSKLLRQAWEK--------------------SCGKEKWIIKPPASARGTGIKVVHRWAQI-----PKKRPLVVQKYISQPYLI--NGSKFDLRLYVLVTNPLRIYIYDDGLVRFASVKYSSDSLGDRYMHLTNYSINKMSSQYTQNEDQGHKWTVKTLWTYLEKEG--VDVTALWNSLVDLVIKTIISGESSINQLTRRYCSYELFGIDVLLDETLKPWLLEVNISLHSSSPLDLAVKGPMVRDLLNMA.................... 584
384 0.000e+00UniRef50_U6DJ34 Tubulin tyrosine ligase-like family, member 3 (Fragment) n=3 Tax=Tetrapoda TaxID=32523 RepID=U6DJ34_NEOVI  ali  24  54................................................................................................WSIFLQRYYQVVHEGAELRHLDAQVQRCEDILQRLRAVVPQMDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVDGKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPSDNMWSSQKFQAHLKEMGAPDAWSTIVPGMKAAVIHALQTSQDTVQCRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTAVTARLCAGVQADTLRVVI---DRRLDRNCDTGAFELI 339
385 0.000e+00UniRef50_B4HWZ2 GM18785 (Fragment) n=1 Tax=Drosophila sechellia TaxID=7238 RepID=B4HWZ2_DROSE  ali  22  55....VLKWRITNIMPKVVRLILANSGMRMLKKTN-DWMGVWGKHLKSPCFKAIRS---YQKINHLPGSFRIGRKDSCWKNLQR-----QMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQ-------------------RNTKWIIKPPASARGAGIRVINRWGQI-----PKRRPLIVQKYIERPLLI--NGSKFDLRLYVLVTSPLRVFMYHNGLARFASVKYSTDTLNDRCMHLTNYSINKFSSNYSKNEDHGHKWTIKSLWTYLANRG--VRTDCLWEALRSLVLRTILAGENGINNVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSPLDAHVKAPLVQGVLNTALVPPKLSLDKQKE....... 401
386 0.000e+00UniRef50_A0A0A9ZEM7 Putative tubulin polyglutamylase TTLL2 n=8 Tax=Panheteroptera TaxID=33351 RepID=A0A0A9ZEM7_LYGHE  ali  22  6...FVFKLNDNGAGPNLLFQVFLERGWKEFSEDTDTWNIWWRTAGFPTSHYKA--LKTWQFTNHVPKASAICRKDWLSRHLKCMRNNYG------NIFDFSPEAYILPLDYTKLVETCSRLAVNND----------------KDDVWICKPVGLSQGKGISLFRKVSEL-----TYDTNTVVQRYVRNPLLI--GGYKFDLRLYVCVPCPLTIYVYREGLARFSTDKFSLSDLKNKYAHLTNCSLNKQGPGYKDKVGAGCKWSLKQLRYYLNQNGFDDW--LLWQRIANLIILTIGSQSSGIPA---TSNCFEFYGFDVLIDDTLKPWLLEVNISPALGTDCDVDVKKPMLHDMFDLL.................... 334
387 0.000e+00UniRef50_UPI000C9FEDC9 tubulin monoglycylase TTLL3 isoform X4 n=1 Tax=Octodon degus TaxID=10160 RepID=UPI000C9FEDC9  ali  24  230................................................................................................WALFLQRYYQVVHEGAELKHLDTQVQRCEDMLQQLRAVVPQMDMEGDRNIWIVKPGAKSRGRGIVCMDHLEEMLKLVDCKDGKWVVQKYIERPLLI--FGTKFDLRQWFLVTDPLTVWFYRDSYIRFSTQPFSLKNLDN-SVHLCNNSIQKHLENSCHRHPPDNMWSSQKFQAHLRETGAPNAWSTIVPGMKAAVIHALQSSQDTVQDRK---ASFELYGADFVFGEDFQPWLIEINASPTMSTPVTARLCAGVQADTLRVVI---DRRLDRNCDTGAFELI 515
388 0.000e+00UniRef50_Q8IGW4 RE12363p n=3 Tax=Schizophora TaxID=43738 RepID=Q8IGW4_DROME  ali  22  323....VLKWRITNIMPKVVRLILANSGMRMLKKTN-DWMGVWGKHLKSPCFKAIRS---YQKINHLPGSFRIGRKDSCWKNLQR-----QMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQ-------------------RNTKWIIKPPASARGAGIRVINRWGQI-----PKRRPLIVQKYIERPLLI--NGSKFDLRLYVLVTSPLRVFMYHNGLARFASVKYSTDTLNDRCMHLTNYSINKFSSNYSKNEDHGHKWTIKSLWTYLANRG--VRTDCLWEALRSLVLRTILAGENGINNVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSPLDAHVKAPLVQGVLNTALVPPKLSLDKQKE....... 669
389 0.000e+00UniRef50_G0QSE4 Tubulin-tyrosine ligase family protein, putative n=8 Tax=Oligohymenophorea TaxID=6020 RepID=G0QSE4_ICHMG  ali  23  21......IKFKTSFKNCILE-AMKKRQWKE--GDNDEWDINWTEKEFIVEVLEHLNLLNQQKVNHFRNHYELTRKDLMTKNIKKYKKVLEKEGKIEESYNFTPLTYQLPCEYSIFCEEFKKVNQ----------------ISESKQLWIMKPIGKSQGKGIFIFRNIKDISSWKNQYKDPYVVQKYISDPLLI--GGKKFDMRIYALCTSPLTIYLYRTGFARFTHHRYDLDDINNVYVHLTNVAIQKNSDNYDKKL--GGKWLLQKLKLFLISKYGQEKVDYAFFQVQNIIIKSMLAVQKVIVNDKR---CFELYGFDIILDSSLKPWLLEINSSPSMTTQQDSELKQGILDDTFTII-DLEKVLTGQEEQIGGFDLI 379
390 0.000e+00UniRef50_A0A1B6EF09 Uncharacterized protein n=5 Tax=Neoptera TaxID=33340 RepID=A0A1B6EF09_9HEMI  ali  22  10..KRKIKFGVDPQCAPVVTTVLLNRGWEEVKKESGLWNLYWCDMSTLRETMDSIKHGSNQKISHFCSNYELTVKNMLYRNMKRYKRQAIQSKTEEIMCNCMPVSFEMP-----------------NEYLMFVEEYRK----NPGSTWIVKPSRGSQGRGIFLFQKLKELAEWRDGKDKGWIVQKYIENPYLI--AGRKFDLRIYVLVTSPMKVWMCREGFARISCHNYSLDNLEDNLTHLTNSSLQVTASKSESV--QVCKWHIHKLREFLTAKHGQANINELFEQIAWIILYSLKSV--HINQSK---HCFELYGYDILLDDSLKPWLLEVNSSPTLSDDDDYKLKFNMLTDLFHII-DLEERLTGKELRVGSFDLI 381
391 0.000e+00UniRef50_A0A0G4EHB6 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EHB6_VITBC  ali  21  218...........THYDLIRDVCESFPHWKEVENEDDDWDLFWTDGAIPADRLL--RMRPYQKINHFVGTCAIARKNFLGRNLLRMKK------FFPKAYRYFPQTWILPTDTSSFKA--------------------QFSNRRKPKTFILKPEAMSQGRGIQLIRRFEDV-----NLTERYVAQRYVHKPLLVD--GLKFDLRLYVLLTDPLRIFLHQEGLVRFATEKYNSKNLNRCRMHLTNYAVNRGSAHFEQPDSSGHKRSLKQFMQILASKGCD--VPGLMAEVEEMIVKTVVAVQPTLAHVYHSCQSFEVLGFDILIDHRFKPWLIEVNHSPSFSSPLDRHVKFHVLRDALALLNIKPENRRKYQAS....... 560
392 0.000e+00UniRef50_A0A2K3E3N5 Uncharacterized protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3E3N5_CHLRE  ali  21  63.....IRINLSACKYEVLRIVQRKLGWKEV-GDEDDWELYWTDTSVSIERI--MKLTKIQKINHFSGMLEICRKRAMARNLMKM------AKAFPQHFDFFPRTFVLPSDREDFLAD--------------------VRSRGKKQVYILKPDAGCQGRGIRLVQGGKEARVLGEMASPNVVAQHYLYNPMLIH--GYKFDLRIYALVLSPLRVFLFHEGLARFCTEKYSPSNLDVAFMHLTNYAVNKKNEAFVSAAAASAKWCLAQLRHYIESTG--ASYDQVWGDIADLIIKSLCSVQPVLRNNYRSFSCFEILGYDVMLDDAMRPWLIEVNHSPSFNSPLDLAIKEELITQTIDLV.................... 407
393 0.000e+00UniRef50_A0A2R5G326 Tubulin polyglutamylase ttll6 n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5G326_9STRA  ali  21  44....VVVNVSNCRY-EVVRSAAKSAGWRVEEDEDEYWNVYWTDTSVSSQR--AMRLERFQRLNHFPGMYHLARKGGLGKH------LTQLAKLFPSDFSFFPQTWVLPQQWSEFKE--------------------RIESGKGNRTFIIKPDASCQGKGIFLTRTHENV-----NPTESQVAQRYLHKPLLID--GFKFDMRIYVILTSPLRIFLFEDGLVRICTQKYVERNLQKSRMHLTNYAINKESEDFVFNEGTGNKRSLRWFWGWLEEQHGKDARDGFVAETHDMIIKSIISVLPQLRHIYRSCNCFEILGFDVLMDRKFKPWLIEVNHSPSFATPLDTDIKSRLIAKTMALIGVHASDKRKSRQR....... 435
394 0.000e+00UniRef50_A0A182NQ30 Uncharacterized protein n=5 Tax=Neoptera TaxID=33340 RepID=A0A182NQ30_9DIPT  ali  23  73.....................FEKRGWVQVTADD-DWNFYWGTCRNIFSVDSGYRMHDNQLINHFPNHYELSRKDLLVKNIKRYRKDLERDGNPEKTEANIPGGSKY-----LYLDFIPITFVLPADYNMFVEEYRK----NPQSTWIMKPCGKSQGAGIFLINKLSKLKRWSREAKESYVISRYIENPLLI--GGKKFDLRLYVLVTSPLKAYLFRLGFCRFCTVKYDTSELDNMYVHLTNVSVQKHGGEYNNHH--GGKWSVQNLRLYLEGTRGKEVTDKLFGSITWLIVHSLKAVSSVMASDR---HCFECYGYDIIIDNTLKPWLVEVNASPSLTTANDRILKYKLIDNILNIVLPPPDVRWSKIPSLGNFDLL 438
395 0.000e+00UniRef50_A0A1X7VP47 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VP47_AMPQE  ali  20  387....RIKWLSDLEKFVLLSN-FERRGWVKGSSEDGDWNFYWCSVRMMFSVDNGIRLADDQIINHFPTHYELTRKDYMVKNIKRYRKDLEKDGSPIAERDFIPVTFMLPAD-----------------YNIFVEEYRRQ----PNATWIMKPAGKAQGVGIFLINKLSQIKKWSKDKKDTYVISRYIDNPLLI--GGKKFDLRLYVLVTSPLKSYIYQLGFCRFCTVKYSINELDNMFVHLTNVSIQKHGDEY--NDSHGGKWPLSNLKLYLECTHGKEVTDKLFNDIHWLIVHSLKSVQNVMTSDR---HCFEVYGYDIIIDVYLKPWLIEVNASPSYTTINDRIMKHSLINDTLNIILPP................. 739
396 0.000e+00UniRef50_Q16I90 AAEL013750-PA n=2 Tax=Aedes aegypti TaxID=7159 RepID=Q16I90_AEDAE  ali  19  30..........NSRYDIIPR-ICRRLGYRLVAEN-ELWNVCWTDSLVGVDFC--RDMRRFQKINHFPGMFEICRKDLLARNLSRMQKL------FPTEYQIFPKTWVFPADLGEAIAY---------------------SRTHRSKTYILKPDQGSQGRGIFLTKNLKEI-----NPRDRMICQVYIHRPLLID--GYKFDLRVYTLVTSPLRIFVYKEGLARFATYKYCITNTSNNFMHLTNYSVNKYSRCFSNDDEAGSKRRFATLNRILTSEGYDIA--ELWNNIDDVIVKTILSAWQVLRHTYQASACFEILGFDILIDHRLKPYILEVNHSPSFHTDIDKEIKEALIHDTFVMLLNGEVKKRVLEEDKRR.... 369
397 0.000e+00UniRef50_UPI000719DACF tubulin polyglutamylase TTLL4-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719DACF  ali  22  693.......WRLSTITPLIVKGLIARSGFRVSRKEH-DWLGYWGKHMKSGGFGVIRE---FQKVNHFPGSFQIGRKDRLWRNLAHMQKLHGKKEFG-----FVPQTFVLPQDVRLLKRTWQEHSCKK---------------------WIVKPPASARGVGIKVISKWSQI-----PKKKAVIVQRYIGKPYLI--NETKFDLRVYVYVTSPLRVYIHEDGLVRFASCKYTPDSIKNKFIHLTNYSINKNHAGYTYNDDHGHKWSLVTLWKYMKDQ--DINTNVIWENIKEIVIKTIISSESGLNNVRSRYSCHELFGFDIILDEKLKPWVIEVNISLHSSSPLDVKIKAPMACDLFRLA.................... 1019
398 0.000e+00UniRef50_UPI0001CBB602 uncharacterized protein LOC100373878 n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0001CBB602  ali  22  33.NSFV</