current user: public

If you have questions about the server, please let us know.

Query: 5Z4Q Entity 5(prereleased), from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# E-value Template Links and tools%idFirst MTLAAYKEKMKELPLVSLFCSCFLSDPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEELast
1 2.000e-51UniRef50_Q9H169 Stathmin-4 n=130 Tax=Euteleostomi TaxID=117571 RepID=STMN4_HUMAN  ali  99  1MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEE 186
2 1.000e-50UniRef50_H2R9V7 STMN4 isoform 3 n=23 Tax=Euteleostomi TaxID=117571 RepID=H2R9V7_PANTR  ali  99  1MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEK................ 170
3 2.000e-50UniRef50_U3JLY7 Stathmin n=63 Tax=Euteleostomi TaxID=117571 RepID=U3JLY7_FICAL  ali  95  1MTLAAYKEKMKELPLVSLFCSCFLSDPLNKPTYAY-EDTVDLTWCVISDMEVIELNKRTSGQSFEVILKPPSFDGIPEFNASLPRRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEE 185
4 1.000e-49UniRef50_A0A2U9AYH9 Uridine phosphorylase n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9AYH9_SCOMX  ali  61  352.TATAYKEKMKELSVLSLICSCFYPESRNKLV------------CEFEDMEVKPINKRASGQAFEVILKPPSPVSDVSHNLPSPPKRDISXXXXXXXXXXXXXXXXXXXXXVLRTLAEKREHERDVLLKAMEENSNFSKMAEEKLQMKMGQIKENREALLAAMIERLQEKERHAAVVRRNKEMKEE 524
5 1.000e-46UniRef50_Q09004 Stathmin-4 n=215 Tax=Euteleostomi TaxID=117571 RepID=STMN4_XENLA  ali  86  1MTLAAYKEKVKELPLVSIFCSCFLSDPLKKQTYKYEADTVDLTWCAISDMEVIELNKRASGHSFEVILKPPSFDGIPEITATLPQKRDPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHEREVILKAIEENNNFSKMAKEKLAQRMEVNKENREAHLAAMLERLQEKDKHAEEVRKNKEA... 183
6 2.000e-46UniRef50_Q6DGV2 Stathmin n=43 Tax=Clupeocephala TaxID=186625 RepID=Q6DGV2_DANRE  ali  76  1MTLAAYREKMKELPLVSLFCSCILPEPREKPTKK-TQDVVDLNLGIIKDMEVIELNKRSSGQAFEVILRPPSFDGQREFHPTFPPRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVAQKALEEHNNFMKMAKEKLEHRMEINKENREAHIAAMLERLQEKDKHAEEVRKHKELMD. 184
7 4.000e-44UniRef50_W5LCA7 Stathmin n=1 Tax=Astyanax mexicanus TaxID=7994 RepID=W5LCA7_ASTMX  ali  54  1MTLAAYREKMRELPLVSLFCSCILPQPKEKPTKHTPQGTVLYHYSHYSHHLLIKSHKESCSNLKTVLNKPKHISGKNYLYTTFLPNYKQKYSHLEHFFLAVALCDQGQEAELLKHLAEKREHEREVAQKAIDEQNNFIKMAKEKLEQRMEINKENREAHIAAMLERLQEKDKHAEEVRKNKEQMD. 185
8 2.000e-39UniRef50_A0A2I0LVV7 Stathmin n=44 Tax=Euteleostomi TaxID=117571 RepID=A0A2I0LVV7_COLLI  ali  96  1.........MKELPLVSLFCSCFLSDPLNKPGYTYE------------DMEVIELNKRTSGQSFEVILKPPSFDGIPEFNASLPRRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEE 165
9 2.000e-36UniRef50_F6WG43 Stathmin n=5 Tax=Boreoeutheria TaxID=1437010 RepID=F6WG43_HORSE  ali  43  2LTPTAYKEKMKELSVLSLICSCFYSQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPVLSSPPKRKDTSLEEVQKRLEAAEERRKVRSLPPAQGQRDPREARSDLLGLEVHDLNAMFCALKEAHPRELEEERSCFRGGLGTAHRRLSSQELHAAEVRRNKEQREE 177
10 4.000e-36UniRef50_Q93045 Stathmin-2 n=198 Tax=Amniota TaxID=32524 RepID=STMN2_HUMAN  ali  60  4.TAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYD------------DMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVE 176
11 4.000e-35UniRef50_UPI00051EFD8E tripartite motif-containing protein 35-like n=2 Tax=Neognathae TaxID=8825 RepID=UPI00051EFD8E  ali  92  307...............................VGGTPVDTVDLTWCVISDMEVIELNKRTSGQSFEVILKPPSFDGIPEFNASLPRRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEK................ 445
12 4.000e-34UniRef50_UPI0007ACD8C4 stathmin-3-like isoform X1 n=2 Tax=Sinocyclocheilus TaxID=75365 RepID=UPI0007ACD8C4  ali  50  112.TVSAYSEKLREMSVLSLLCSCLYSQPLPNTFPTQ-----------FEDMEVKSLNKRASGQAFEVILKSPTEPSPPQTLALPPQKKEPSXXXXXXXXXXXXXXXXXXXXXVXXXXXXXXXXXXXXXXXXXXXNNNYSKMTEEKLNHKMELIQENRMARLSALKQRLREKELHAAEVRKNKELHTE 287
13 4.000e-34UniRef50_A0A096NN56 Stathmin n=5 Tax=Amniota TaxID=32524 RepID=A0A096NN56_PAPAN  ali  54  4.TISAYKEKMKELSVLSLICSCFYTQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPMLSSPPKKKDTSXXXXXXXXXXXXXXXXXXXXXVLKQLAERREHEREVLHKALEENNNFSRQAEEKLNYKMELSKEIRERTWPHCASGCAKKELHAAEVRRNKEQREE 177
14 4.000e-33UniRef50_A0A1V4JDF2 Membrane progestin receptor alpha n=2 Tax=Columbidae TaxID=8930 RepID=A0A1V4JDF2_PATFA  ali  64  1............................................MATSDIQVKELEKRASGQAFELILGPRSKEATPEFPLSPPKKRDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKEGKD. 141
15 7.000e-33UniRef50_A0A2U9BAY0 Uncharacterized protein n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9BAY0_SCOMX  ali  63  51MTLTAYKEKMRELPLVSLFCSCILPQPRDAGVDK-KEGVVDLNLCNIRDMEVIELSKRASGQAFEVILKPPTFDGGPELRATTPPRQKPSXXXXXXXXXXXXXXXXXXXXXLLKHLAERREHEREVAQKAL---------TKERQEHRADADKQQRQMHLNASQERLQE-DKHSVEV......... 217
16 4.000e-32UniRef50_A0A0P7UKE3 Stathmin-4-like n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A0P7UKE3_9TELE  ali  55  4LSPSAYKEKMKELPLLSLFCSCLGREPQEKPEAEASADVVDLNWCVIRDMEVVEMNKRASGQAFEVILKPPSFDGGPETSISSPDYKNPSQEEVKDKPDVAEERRKCKEAELHSNRAEEGERKNEVTQRPVE--ENFVKVSRVEHEKNV---------------EHLQEKEKHAEEVRTIEETQED 173
17 6.000e-32UniRef50_J9P3D8 Stathmin n=11 Tax=Euteleostomi TaxID=117571 RepID=J9P3D8_CANLF  ali  98  20..................................YTADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKE............... 156
18 2.000e-30UniRef50_H2RT81 Stathmin n=139 Tax=Gnathostomata TaxID=35060 RepID=H2RT81_TAKRU  ali  77  1MTLAAYKEKVKELPLVSLFCACLNPRTIENPTYKA-EDAVDLGWCVMKDVEVIELNKRASGQAFEVILKPPSFDGVPDLNTSMPQRRDPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXKREHEREVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLERLQEKDKHAEEVRKNKEMKEE 185
19 6.000e-30UniRef50_UPI0007B9F658 stathmin-4-like n=1 Tax=Sinocyclocheilus rhinocerous TaxID=307959 RepID=UPI0007B9F658  ali  68  1MTLAAYREKMKELPLVSLFCSCILPEPREKPTKK-TQDVVDLNLGIIKDMEVIELNKRSSGQAFEVILRPPSFDGQREFHPTFPPRNDPSLEEIQKKLDAAEERRKVRNSDV.......................................................................... 111
20 3.000e-29UniRef50_A0A060YSR1 Uncharacterized protein n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060YSR1_ONCMY  ali  72  1MTLAAYKEKLKELPLVSLFCSCINPQTIDCKPIYKAEDAVDLGWCVIKDVEVIELNKRASGQAFEVILKPPSFDGVPELNVTMPQRRELSXXXXXXXXXXXXXXXXXXXXXXXXXXXXKREHEREVIQKAFEENXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLERLQEK................ 170
21 1.000e-28UniRef50_O70166 Stathmin-3 n=116 Tax=Amniota TaxID=32524 RepID=STMN3_MOUSE  ali  60  4.TVSAYKEKMKELSVLSLICSCFYSQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPVLSSPPKRKDASXXXXXXXXXXXXXXXXXXXXXVLKQLAERREHEREVLHKALEENNNFSRLAEEKLNYKMELSKEIREAHXXXXXXXXXXXXXXXXXXXXXKEQREE 177
22 2.000e-28UniRef50_O93388 Stathmin-3 n=158 Tax=Gnathostomata TaxID=35060 RepID=STMN3_CHICK  ali  59  4.TVSAYKEKMKELSLLSLICSCFHTQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPILSSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXVLKQLAEKREHEREVLHKALEENNNFSRLAEEKLNYKMELSREIREAHXXXXXXXXXXXXXXXXXXXXXKEQREE 177
23 2.000e-28UniRef50_H2UH23 Stathmin n=19 Tax=Gnathostomata TaxID=35060 RepID=H2UH23_TAKRU  ali  42  1LTQLAKEHKAKQAPMVARQCNCYCPPPFCFSKPTQRNHLANMDVCEG--FQVKELDRRSSGSAFQLILSPSNAKEAKAKVLLSPERKEISLEEQKKKMAAAEERRKSREFEMLKHFAEVREHEKEVLQKVVEERNTFSKTTQENLAQKMEAYKENRGAQMAALSEKFKARD............... 169
24 3.000e-28UniRef50_UPI000BA80F3A stathmin-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA80F3A  ali  35  14.............SILQCFCRACHARVVEKPHPTQMITNMQPKKMVYLATEVRASEQSKGGMKYELVLADPSDVAPPRF-ASTPPKSNISXXXXXXXXXXXXXXXXXXXXXKLNQLNEKRFREQEALLKKREYNANFVQSAKENLEQKMESNKENREAFIKSIQEKSREQDKHILDV......... 179
25 7.000e-28UniRef50_A0A151MMG4 Stathmin isoform A n=6 Tax=Amniota TaxID=32524 RepID=A0A151MMG4_ALLMI  ali  63  79..........................................SDMATSDIQVKELEKRASGQAFELILSPRSKEAVPEFPLSPPKKKDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKEGKD. 221
26 2.000e-27UniRef50_A0A093QZK2 Stathmin (Fragment) n=12 Tax=Amniota TaxID=32524 RepID=A0A093QZK2_PYGAD  ali  98  1................................................DMEVIELNKRTSGQSFEVILKPPSFDGIPEFNASLPRRRDPSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEE 138
27 2.000e-27UniRef50_Q09001 Stathmin-2-A n=121 Tax=Euteleostomi TaxID=117571 RepID=STM2A_XENLA  ali  54  4.TAIAYKEKMKELSMLSLICSCFYPEPRNITAYTYD------------DMEIKQLNKRASGQAFELILKPPSPVSEAPRTLASPKKKDVSXXXXXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXNNNFSRMAEEKLILKMEQIKENREYY........................... 149
28 3.000e-27UniRef50_UPI000A352B95 stathmin-3 isoform X1 n=2 Tax=Boreoeutheria TaxID=1437010 RepID=UPI000A352B95  ali  58  4.TVSAYKEKMKELSVLSLICSCFYAQPHPSTIYQY------------GDMEVKELDKRASGQSFEVILKSPSDSPESPVLSSPPKRKDISLEELRKRLEAAEERRKAR.............................................................................. 99
29 4.000e-26UniRef50_A0A195BK96 Stathmin-4 n=7 Tax=Myrmicinae TaxID=34695 RepID=A0A195BK96_9HYME  ali  32  176.............SVLQCFCHSCKAPPFKKPSGKGKPRTKQPKKVKFITTEIRCQEKSKGGLCYEVILAEP---TVPKRAPSPPQQSPTQQTAIEDKLKAAEERRLSIEAHKLAALAAKLSKIEEASRKKDELSAAFIAATRESLDAKMNNTEEKREAHIAEL....................... 334
30 7.000e-26UniRef50_A0A146Y3Y3 Stathmin (Fragment) n=4 Tax=Percomorphaceae TaxID=1489872 RepID=A0A146Y3Y3_FUNHE  ali  63  34MTLTAYREKMRELPLVSIFCSCILPEPRERPAD-QKEGLVDLNLCNIRDMEVIELSKRASGQAFEVILKPPTFDGTPELRATTPPRQKPSXXXXXXXXXXXXXXXXXXXXXLLKHLAER................................................................... 151
31 1.000e-25UniRef50_A0A1W4YDU4 Stathmin n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W4YDU4_9TELE  ali  56  1.........MKELPLLSLFCSCLGREPQEKPEAEASADVVDLNWCVIRDMEVVEMNKRASGQAFEVILKPPSFDGGPETSISSPDYKNPSQEEVKDKPDVAEERRKCKEAELHSNRAEEGERKNEVTQRPVE--ENFVKVSRVEHEKNV---------------EHLQEKEKHAEEV......... 152
32 1.000e-25UniRef50_A0A194R606 Stathmin-4 n=1 Tax=Papilio machaon TaxID=76193 RepID=A0A194R606_PAPMA  ali  29  220.............SVMQCFCHTCHRRSAPVKKPIGKPRTKQPKKVKFITTEIRCQEMSKGGLAYEVILAEPVGVPAPRRADS--PEKTPSVEEIQEKLKAAEERRRVSYMYTNAHLAQKMAKIEDASRIRSEQTNNFICTTKEALDAKMDSHEEKREAYISELRARLKDHLEGVEKTRLSLEQQT. 443
33 3.000e-25UniRef50_Q4RI20 Chromosome 8 SCAF15044, whole genome shotgun sequence (Fragment) n=1 Tax=Tetraodon nigroviridis TaxID=99883 RepID=Q4RI20_TETNG  ali  56  1....AYKEKMKELSVLSLICSCFYPEARNKLLHE------------FEDMEVKPIKKRASGQAFEVILKPPSPVSDAVHNFPPPPKRDISLEDIEKKLEAAEDRRRV............................................................................... 91
34 4.000e-25UniRef50_A0A2I0TBL4 Stathmin n=1 Tax=Limosa lapponica baueri TaxID=1758121 RepID=A0A2I0TBL4_LIMLA  ali  52  75LYFSAYKEKMKELSLLSLICSCFHTQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPILSSPPKKKDLSLEELQRRLEAAEERRKVMRCPVEA........................................................................ 177
35 4.000e-25UniRef50_A0A1W4WVP9 stathmin-1-A isoform X4 n=1 Tax=Agrilus planipennis TaxID=224129 RepID=A0A1W4WVP9_AGRPL  ali  24  9.............SVMQCFCHTCRAPIPPISKIKAKPRTYQPKKVKFVSTEVRCQEKTRGGLCYEVILSEPEVKAAPPKRPSSPPNKNMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXQIMKIEEASRKKDEQTNQFISATREALEQKMENHIGKREAFITDLKTKMKDH................ 173
36 2.000e-24UniRef50_UPI000981C123 stathmin-3 isoform X2 n=2 Tax=Boreoeutheria TaxID=1437010 RepID=UPI000981C123  ali  58  4.TMSAYKEKMKELSVLSLICSCFYSQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPMLSSPPKRKDTSLEELQKRLEAAEERRKARN............................................................................. 100
37 3.000e-24UniRef50_A0A2I3MWS7 Stathmin n=3 Tax=Euteleostomi TaxID=117571 RepID=A0A2I3MWS7_PAPAN  ali  53  6......KEKMKELSVLSLICSCFYTQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPMLSSPPKKKDTSXXXXXXXXXXXXXXXXXXXXXVLKQLAERREHEREVLHKALEENNNFSR-------------QRLREECGGG-----RGRELHAAEVRRNKEQREE 156
38 3.000e-23UniRef50_F7B2A2 Stathmin 2 n=4 Tax=Tetrapoda TaxID=32523 RepID=F7B2A2_XENTR  ali  42  6...LAYKEKMKELSMLSLICSCFYPEPRNISAYTYDG------------LAFLALCKASGNPLKEVILQWPGDKGRYGLDFR-PRGKCISGDSHNLSLSAACLIAQSQEAQVXXXXXXXXXXXXXXXXXXXXXNNNFSRLAEEKLILKMEQIKENREYYLATLMER.................... 159
39 5.000e-23UniRef50_A0A2I4CQX7 Stathmin n=23 Tax=Gnathostomata TaxID=35060 RepID=A0A2I4CQX7_9TELE  ali  56  1MTLTAYREKLRELPLVSLFCSCILPEPREPREPRKKEGIVDLNLCNIRDMEVIELSKRASGQAFEVILKPPTFDGGPELRATTPPRQKPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAQKAL---------TKEYQEYRVNAHHELR--HLNASQE---EEDKHIVEV......... 165
40 1.000e-22UniRef50_Q9VMH3 LD04103p n=36 Tax=Diptera TaxID=7147 RepID=Q9VMH3_DROME  ali  23  9.............SVMQCFCHTCRAPPIKKNNKIRSKQPRLSKKVKFITTEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSXXXXXXXXXXXXXXXXXXXXXKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDM....................... 168
41 1.000e-22UniRef50_T1JD68 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1JD68_STRMM  ali  30  108.............SILQCLCSCKSHEILEKSILHEVHCTQPTKKGAYIATEIRAAEKSKGGMAYEVILAQPAAETPPKLPDSPP-KTSLSXXXXXXXXXXXXXXXXXXXXXKLNQXXXXXXXXXXXXXXXXXXXXXFINQTKEQLELKMVSIKENRESYLSELRAKLKDHNSHIEEVQMSIKSHKE 280
42 2.000e-22UniRef50_A0A2J7PPH3 Uncharacterized protein (Fragment) n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7PPH3_9NEOP  ali  32  1.................................................TEIRCQEKSKGGLSYEVILAEPVAVTPPKRPSSPS--NKVSXXXXXXXXXXXXXXXXXXXXXRMAFLAAKMSKIEEASKKREEQANNFISQTREALEQKMEAHIEKRESFIGTVVEKTRSLEMQANEVRNAVEEK.. 139
43 3.000e-22UniRef50_A0A2J7QAZ8 Uncharacterized protein (Fragment) n=5 Tax=Neoptera TaxID=33340 RepID=A0A2J7QAZ8_9NEOP  ali  26  23........................RRAAPIKKAKTKPRSKQPKKLKFITTEIRCQEKSKGGLSYEVILAEPVAVTPPKRPSSPS--NKVSXXXXXXXXXXXXXXXXXXXXXRMAFLAAKMSKIEEASKKREEQANNFISQTREALEQKMEAHIEKRESFINDLKYKLKDHRESVEKTRLSLEMQR. 181
44 8.000e-22UniRef50_A0A0U2T2W0 Stathmin n=4 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=A0A0U2T2W0_SACKO  ali  40  43........................................................KTTGGVAYDVILSEPKTETVLKRPVSPPKKSEKSLTDIASKLAAAEERRKSMESQLLQRLAEERALAQEKASRVMKDNNNFQEVTKKQLDEKMQVFEENRNARFQALQKRLKEKEIHGREVRNHKRSISQ 172
45 8.000e-22UniRef50_A0A1B6KW62 Stathmin (Fragment) n=5 Tax=Hemiptera TaxID=7524 RepID=A0A1B6KW62_9HEMI  ali  25  33..................ICPCF---QVCKCEGRSTEADNMSSPTDADATEIRCQEQSKGGLKFDVILADPAATPPAPKRTQSPTRTK-SXXXXXXXXXXXXXXXXXXXXXKIASIAAKLSKIEEASKKKDEQTSVFITQTKEALDQKMETHVEKRDAYLSIIKTKLKDHWDSIEKTRQTLEKQT. 195
46 1.000e-21UniRef50_UPI000BA80F34 calponin homology domain-containing protein DDB_G0272472-like isoform X1 n=6 Tax=Chelicerata TaxID=6843 RepID=UPI000BA80F34 :_  ali  28  14.............SILQCFCRACHASAIEKPPPTQGIANTQPNKMVRLATEVRATEQSKGGMKYELVLADPA-DVAPPCLASSPPKTSMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEYNAVFKQAARNSLEQKMEANKENREAIIKSIQEKSRERLSRGEEIRKSLDAQTQ 188
47 2.000e-21UniRef50_Q8IPK0 Stathmin, isoform B n=60 Tax=Holometabola TaxID=33392 RepID=Q8IPK0_DROME  ali  23  9.............SVMQCFCHTCRAPPIKKNNKIRSKQPRLSKKVKFITTEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSXXXXXXXXXXXXXXXXXXXXXKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDM....................... 168
48 2.000e-21UniRef50_A0A0L7LQQ1 Cell cycle control protein cwf22 (Fragment) n=10 Tax=Ditrysia TaxID=37567 RepID=A0A0L7LQQ1_9NEOP  ali  20  9.............SVMQCFCHSCHRRSAPVKKPVGKPRTKQPKKVKFITTEIRCQEMSKGGLAYEVILAEPVGAPAPRRADSPVEKTPSSLEQ-----------------SKMAAIAQKMAKIEEASKIRSEQTNNFI-----AIEDKLTTAADKRDENIKKMLERLRVHEEQVRKVRSGNQER.. 165
49 3.000e-21UniRef50_K1QU47 Dual oxidase 2 n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1QU47_CRAGI  ali  25  33.......................QNQPVPLELKSIHNVNRRKENVIGVRMQV-GLQKSTGGVAYDYILKPAADNA--PKISSPPKDKPLTXXXLRRSMEITKENRELQIMSLQEKLREHLAKVQEV----CRNSESMSKELEERLIQKYEAYEENRNNQLQSVVKRLQDHAKHIEEVCKASETMS. 238
50 5.000e-21UniRef50_K7GMK4 Stathmin n=5 Tax=Euteleostomi TaxID=117571 RepID=K7GMK4_PIG  ali  59  5..............................................AMDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVE 144
51 1.000e-20UniRef50_P31395 Stathmin n=10 Tax=Amniota TaxID=32524 RepID=STMN1_CHICK  ali  63  1............................................MATSDIQVKELEKRASGQAFELILGPRSKEAAPEFPLSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKEGKD. 141
52 3.000e-20UniRef50_A0A158NLS3 Uncharacterized protein n=39 Tax=Neoptera TaxID=33340 RepID=A0A158NLS3_ATTCE  ali  32  9.............SVLQCFCHSCKAPPFKKPSGKGKPRTKQPKKVKFITTEIRCQEKSKGGLCYEVILAEP---TVPKRAPSPPQQSPTQQTAIEDKLKAAEERRLSIEAHKLAALAAKLSKIEEASRKKDELSAAFIAATRESLDAKMNNTEEKREAHIAEL....................... 167
53 3.000e-20UniRef50_M9NEA1 Stathmin, isoform D n=31 Tax=Diptera TaxID=7147 RepID=M9NEA1_DROME  ali  26  100...............LQLHLSEMHSNPADASALTVMERMRQEDLENRIATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSXXXXXXXXXXXXXXXXXXXXXKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDM....................... 247
54 3.000e-20UniRef50_A0A0N8BNH1 Putative Stathmin-3 (Fragment) n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0N8BNH1_9CRUS  ali  36  73...................................................IRGEEKSKGGLSYEVILAEPVSDRPPPLTVSTPTRPQPSEEEIERKLLAAKERR-----EANRSINDVDEKISKAVEKRQELVSTFVTKTKENLDAKMEESQEKREAHLSSLKTKLKEHLERVETIRLTNETKLQ 203
55 4.000e-20UniRef50_A0A1B6LZ66 Uncharacterized protein (Fragment) n=4 Tax=Cicadellinae TaxID=33370 RepID=A0A1B6LZ66_9HEMI  ali  25  134............................KKELIVKEERVNGFGDVGITATEIRCQEQSKGGLKFDVILADPAATPPAPKRTQSPTRTK-SXXXXXXXXXXXXXXXXXXXXXKIASIAAKLSKIEEASKKKDEQTSVFITQTKEALDQKMETHVEKRDAYLSIIKTKLKDHWDSIEKTRQTLEKQT. 289
56 6.000e-20UniRef50_P54227 Stathmin n=10 Tax=Euarchontoglires TaxID=314146 RepID=STMN1_MOUSE  ali  63  1............................................MASSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKD. 141
57 6.000e-20UniRef50_A0A1Y1KC35 Uncharacterized protein (Fragment) n=1 Tax=Photinus pyralis TaxID=7054 RepID=A0A1Y1KC35_PHOPY  ali  26  77....................................................RCQEKTRGGLCYEVILSEPEVKATPPKRPNSPXXXXXXXXXXXXXXXXXXXXXXXXXXXKVAALSAQIMKIEEASRKKDEQTNNFISVTRDALEQKMETHIGKREAYIHELKSKMKDHIDTVEKTRLSLEQQCD 211
58 1.000e-19UniRef50_UPI00083BB1A8 stress response protein NST1 isoform X2 n=2 Tax=Bombinae TaxID=70988 RepID=UPI00083BB1A8  ali  32  5.........................................TESPVNESTEIRCQEKSKGGLCYEVILAEP---TVPKRAPSPPQTSPTQQIAIEDKLRAAEKRRLSLEAQKLAVLAAELSKIEEASRKKDELSAAFIAATRESLDAKMNNTEEKREAHIAELRNKLKEHFESVEKTRLSLEQQT. 145
59 1.000e-19UniRef50_H0YS40 Stathmin n=6 Tax=Neognathae TaxID=8825 RepID=H0YS40_TAEGU  ali  40  1............................................MATSDIQVKELEKRASGQAFELILSPRSKEAVAEFPLSPPKKKDVSXXXXXXXXXXXXXXXXXXXXXLKKTGRDEAERGSSFRKKLLSFNTKTYEISPRKCSMKMQAIVFGRINCLIDDLERLREKDKHVEEVRKNKEGKD. 143
60 2.000e-19UniRef50_P16949 Stathmin n=170 Tax=Euteleostomi TaxID=117571 RepID=STMN1_HUMAN  ali  64  1............................................MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKD. 141
61 3.000e-19UniRef50_U3IZG6 Stathmin n=8 Tax=Tetrapoda TaxID=32523 RepID=U3IZG6_ANAPL  ali  55  4.TESAYKEKMKELSLLSLICSCFHTQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPILSSPPKKKDLSLEELQRRLEA...................................................................................... 91
62 8.000e-19UniRef50_A0A2K6GZ35 Stathmin n=8 Tax=Euteleostomi TaxID=117571 RepID=A0A2K6GZ35_PROCO  ali  63  1..................................................QVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREK................ 120
63 1.000e-18UniRef50_S9YUY3 Stathmin n=3 Tax=Euteleostomi TaxID=117571 RepID=S9YUY3_CAMFR  ali  54  2..PTAYKEKMKELSVLSLICSCFYSQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPVLSSPPKRKDTS................................................................................................ 78
64 8.000e-18UniRef50_A0A2P8ZJS1 Uncharacterized protein n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8ZJS1_BLAGE  ali  24  103.......................YRRPAPIKKAKNKPRCKQPKKVKFITTEIRCQEKSKGGLAYEVILAEPVNVTPPKRPSS--PNSKVSAENIEEKLKAAEERRLKTRLSLEVQTNEVRNAVEEKLKTAAAQDENIKKMLDRLREHRVRTGMNEKVAQLXXXLEKLRSHLKKLHDICK....... 276
65 9.000e-18UniRef50_A0A1Y1KHX4 Uncharacterized protein (Fragment) n=4 Tax=Polyphaga TaxID=41084 RepID=A0A1Y1KHX4_PHOPY  ali  26  77....................................................RCQEKTRGGLCYEVILSEPEVKATPPKRPNSPXXXXXXXXXXXXXXXXXXXXXXXXXXXKVAALSAQIMKIEEASRKKDEQTNNFISVTRDALEQKMETHIGKREAYIHELKSKMKDHIDTVEKTRLSLEQQCD 211
66 1.000e-17UniRef50_A0A1S3M7I0 stathmin-4-like n=9 Tax=Euteleostomi TaxID=117571 RepID=A0A1S3M7I0_SALSA  ali  81  186.....................................DAVDLDWCVIKDVEVIELNKRSSGQAFEVILKPPSFDGVPELNTTMPQRRELSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHERDVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLERLQEKNKHREEVRKNKELKEE 334
67 2.000e-17UniRef50_UPI000C77613D uncharacterized protein LOC111692643 n=1 Tax=Anoplophora glabripennis TaxID=217634 RepID=UPI000C77613D  ali  24  10......................IHRTQIPITKVKTKPRTNQPKRVQFVTTEVRCQEKTRGGLRYEVILGEPEVKTAPPKKQLSP-KSSMSXXXXXXXXXXXXXXXXXXXXXKIAALSAKMVKIEEASRKKEEQTSQFIAATRDALEQKMELHTEKREAYITDLKTKLKSR................ 159
68 3.000e-17UniRef50_A0A2K5PFD7 Stathmin n=10 Tax=Euteleostomi TaxID=117571 RepID=A0A2K5PFD7_CEBCA  ali  51  4.TLSAYKEKMKELSVLSLICSCFYTQPHPNTVYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPMLSSPPKKKDASXXXXXXXXXXXXXXXXXXXXXEVRRNKEQRE................................................................. 112
69 3.000e-17UniRef50_Q09006 Stathmin-1-A n=61 Tax=Vertebrata TaxID=1261581 RepID=STM1A_XENLA  ali  57  1............................................MCDSDIKVKQLEKRASGQAFELILSPPSMDAAPDLSITSPKKKECSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTTKMETIKENREAQIAAKLERLREKDKKVEEIRKGKECKE. 141
70 3.000e-17UniRef50_V8PD60 Stathmin n=2 Tax=Amniota TaxID=32524 RepID=V8PD60_OPHHA  ali  62  1MLCSAYKEKMKELSMLSLICSCFYPESRNLNIYTYD------------DMEVKHINKRASGQAFELILKPPSPS---------------------------------QEAQVXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLILKMEQIKENREAN........................... 114
71 5.000e-17UniRef50_A0A1B6LG97 Stathmin n=3 Tax=Hemiptera TaxID=7524 RepID=A0A1B6LG97_9HEMI  ali  30  1........................................MSSPTDADATEIRCQEQSKGGLKFDVILADPAATPPAPKRTQSPTRTK-SXXXXXXXXXXXXXXXXXXXXXKIASIAAKLSKIEEASKKKDEQTSVFITQTKEALDQKMETHVEKRDAYLSIIKTKLKDHEKRAEMVRQNKRLST. 144
72 1.000e-16UniRef50_Q4SH33 Stathmin n=2 Tax=Tetraodontidae TaxID=31031 RepID=Q4SH33_TETNG  ali  43  3.............................................AGKDFHVRELDRRASGSAFQVILSPSNLTEPKAKILLSPERKGISXXXXXXXXXXXXXXXXXXXXXMLKHFAEVREHEKQVLHKATEDRNNFSKMTKENISQKMEAYKENRVAQRAVLDEKFKARD............... 128
73 3.000e-16UniRef50_E3TF65 Stathmin n=20 Tax=Gnathostomata TaxID=35060 RepID=E3TF65_ICTPU  ali  57  1............................................MAASDIKVKELDKRASGQAFEVILRDPAPEAKGDFPLSPQKKKDWSXXXXXXXXXXXXXXXXXXXXXFLKHLAEKREHEKEVQQKALEENNHFSKMAEEKLNQKMEATKEKRTAIMAAMTEK.................... 122
74 3.000e-16UniRef50_L5K112 Stathmin n=4 Tax=Eukaryota TaxID=2759 RepID=L5K112_PTEAL  ali  52  1.........MKELSVLSLICSCFYSQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPVLSSPPKRKDAS................................................................................................ 70
75 5.000e-16UniRef50_A0A2K6PDA0 Stathmin n=13 Tax=Amniota TaxID=32524 RepID=A0A2K6PDA0_RHIRO  ali  50  1.........MKELSVLSLICSCFYTQPHPNTIYQY------------GDMEVKQLDKRASGQSFEVILKSPSDSPESPMLSSPPKKKDTS................................................................................................ 70
76 9.000e-16UniRef50_E9G463 Uncharacterized protein n=11 Tax=Daphnia TaxID=6668 RepID=E9G463_DAPPU  ali  37  12...................................................IRGEEKSKGGLSYEVILAEPVSDRPPPLTVSTPTRPQPSEEEIERKLLAAKERR-----EANRSINDVDEKINQAVQKRQEIVSTFVTKTKENLDAKMEESQEKREAHLNSLKTKLKEHLERVETIRLTNDTK.. 140
77 1.000e-15UniRef50_UPI00084B56A0 uncharacterized protein LOC108672750 isoform X3 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084B56A0  ali  20  9.............SFLRCFCHTCHKKPLSKKINKKPRCKQPNKTRRNHATEIRAEEKSRGGMSYEVILSQAVTERPSSPAKSPSPPPARSITXXXXXXXXXXXXXXXXXXXRVASIGERLCRLEEAARKRQEANDEFICSTATALDLKLDASSVNREAHLDGLKAKVADH................ 178
78 1.000e-15UniRef50_A0A1Y1KER4 Uncharacterized protein (Fragment) n=27 Tax=Polyphaga TaxID=41084 RepID=A0A1Y1KER4_PHOPY  ali  26  77....................................................RCQEKTRGGLCYEVILSEPEVKATPPKRPNSPXXXXXXXXXXXXXXXXXXXXXXXXXXXKVAALSAQIMKIEEASRKKDEQTNNFISVTRDALEQKMETHIGKREAYIHELKSKMKDHIDTVEKTRLSLEQQCD 211
79 1.000e-15UniRef50_A0A1D2NFE0 Stathmin-4 n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2NFE0_ORCCI  ali  28  1........................................MTTNGVDIDLNISASEEAKGGVKYELVLSSPVVDTPPRTISPTNGKPIVSXXXXXXXXXXXXXXXXXXXXXKLASLQEKFKKIDEAAKIRAEEESNFINSTKENLEQKMKVHIDNRDSIITDLKVKLQHHNSHLQEVRQNLES... 146
80 2.000e-15UniRef50_UPI0003F09055 stathmin-like n=1 Tax=Elephantulus edwardii TaxID=28737 RepID=UPI0003F09055  ali  48  1.........................................MTITASSDMQVEELEKRTSSPAFEQIHSPRSKEAGPAFPLSPQKKKDHSLEENQKTSEAVEERPKSRAAEDWKQLPEKRELLDKVLQKAMEKHNNVSKMAEWK-------PQRDSRAPRAAKLERLPEKDAHIDKVRKNRESKD. 137
81 3.000e-15UniRef50_Q9GQR5 RH02809p n=39 Tax=Diptera TaxID=7147 RepID=Q9GQR5_DROME  ali  30  3.........................................NNTVDTEATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSXXXXXXXXXXXXXXXXXXXXXKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAIISDM....................... 123
82 5.000e-15UniRef50_H9GPR1 Stathmin n=106 Tax=Vertebrata TaxID=1261581 RepID=H9GPR1_ANOCA  ali  62  1............................................MASSDIQVKELEKRASGQAFELILGPPSKDAVPEFPLSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQ........................... 115
83 5.000e-15UniRef50_UPI00084B9330 eukaryotic translation initiation factor 5B-like isoform X1 n=2 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084B9330  ali  20  9.............SFLRCFCHTCHKKPLSKKINKKPRCKQPNKTRRNHATEIRAEEKSRGGMSYEVILSQAVTERPSSPAKSPSPPPARSITXXXXXXXXXXXXXXXXXXXRVASIGERLCRLEEAARKRQEANDEFICSTATALDLKLDASSVNREAHLDGLKAKVADH................ 178
84 1.000e-14UniRef50_A0A0P4WFR2 Uncharacterized protein n=1 Tax=Scylla olivacea TaxID=85551 RepID=A0A0P4WFR2_9EUCA  ali  27  10.................................................TEIRCEEKSRGGMCYEVILAEPSADKPTPPATSSPRPKSMTXXXXXXXXXXXXXXXXXXXXXRLASVGERMTRLEEASRKREENTAAFIAATQAALEDKLDTTTNNREAYLNGLRAKLSDHLNNVDGVRKQLEAQT. 145
85 1.000e-14UniRef50_A0A1A8BEK7 Stathmin 1b (Fragment) n=2 Tax=Nothobranchius TaxID=28779 RepID=A0A1A8BEK7_9TELE  ali  52  1...........................................MASAEDIQVKELDKRASGQAFEVILGAPAPDSKGEFPLSPPKKKDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLQLKMEQIQENRQAF........................... 116
86 2.000e-14UniRef50_A0A0V0XWJ4 Prestin n=1 Tax=Trichinella pseudospiralis TaxID=6337 RepID=A0A0V0XWJ4_TRIPS  ali  18  330.......................YPETQADPPATAGGSLQFLKSLLSMNPESESSTSSSGNLSFELILRPPTKHAPS--NLNSPCNLKTTXXXXXXXXXXXXXXXXXXXXXKVEK-AKIEERLLEAAERRKALLQKFQEETENEIQSRAKVTSLNREKLFEERIEKIKDHEKHVEEVRRSR..... 488
87 2.000e-14UniRef50_Q1RLQ1 Stathmin n=8 Tax=Osteoglossocephalai TaxID=1489341 RepID=Q1RLQ1_DANRE  ali  62  1...........................................MAATSDIQVKELDKRASGQAFEVILGSPASDVKNEFLLSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXKREHEKEVLQKALEENNNFSKMAEEKLNQKMEANKENRTAIXXXXXXXXXXXXXXXXXXXXXKETKE. 142
88 2.000e-14UniRef50_UPI0007E6AFAB stathmin-2-like n=1 Tax=Drosophila rhopaloa TaxID=1041015 RepID=UPI0007E6AFAB  ali  28  9.............SVMQCFCHTCRAPPIKKNNKIRSKQPRLSKKVKFITTEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSVEEIEQKLKAAEERR................................................................................. 110
89 2.000e-14UniRef50_B1GS89 Stathmin (Fragment) n=4 Tax=Neoptera TaxID=33340 RepID=B1GS89_COTCN  ali  27  3.......................................TTAETIINEATEIRCQEQSKGGLCYEVILAEPTGAKRAPSPQRSQP-SPTQQSAIEEKLKAAEERGLSLEAHKLASLAAQLSKIEETARKKDEITAAFMTATRESLDAKMNSSEEKREAHMSEL....................... 125
90 4.000e-14UniRef50_A0A0V1BI47 Sulfate transporter n=6 Tax=Trichinella TaxID=6333 RepID=A0A0V1BI47_TRISP  ali  24  420.........................................................SSGNLSFELILRPPTKHAPA--NLSSPCNLKTTXXXXXXXXXXXXXXXXXXXXXKVEK-AKIEERLLEAAERRKALLQKFQEETEKEIQNRAKVTSLNREKLFEERIEKIKDHEKHVEEVRRSR..... 540
91 1.000e-13UniRef50_W5JZC1 Stathmin n=4 Tax=Euteleostomi TaxID=117571 RepID=W5JZC1_ASTMX  ali  60  1...........................................MASPSEIKVKELDKRASGQAFEVILADPAPDAKSEFPLSPPKKKDLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXKREHEKEVLQKAAEENNNFSKMAEEKLNQKMEANKENRTALXXXXXXXXXXXXXXXXXXXXXKESKEQ 143
92 1.000e-13UniRef50_A0A0A9XLB2 Stathmin-2-B n=7 Tax=Neoptera TaxID=33340 RepID=A0A0A9XLB2_LYGHE  ali  30  10.................................................TEIRCKEESKGGLKFDVIIADPATS--PPKRPSSPKDKDLTXXXXXXXXXXXXXXXXXXXXXKMAQIAAKLSKIEEASKNKDEQMSEFIAQTKEALEQKMESHIEKREAYLTDVKAKLKDH................ 128
93 2.000e-13UniRef50_T1FNU7 Uncharacterized protein n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1FNU7_HELRO  ali  31  13........................................................EKTGGIAFELILKEANNKENSPRNISSPMRSALSNELIEKKLLEAQERRHSLEVSKQRNWLKEKNKITEASLRVQEVNDSFSKETEKKLQKRMDAQKEKKDAHMKALMDRLTQHAQKVDEIRKMSDQ... 143
94 2.000e-13UniRef50_L7LVT6 Putative stathmin n=13 Tax=Chelicerata TaxID=6843 RepID=L7LVT6_9ACAR  ali  28  19...............................................MATEVRCKEQSKGGLKYELVLADPCTDSPPLRKPGTSPPKSISXXXXXXXXXXXXXXXXXXXXXKLNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXNYEKKIEAFKENREAHIKSIQEKQREHVSRVEEVRKSLDAQTQ 157
95 4.000e-13UniRef50_UPI00077FA9F3 stathmin-1-A-like n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI00077FA9F3  ali  28  7................................................DVSIKSYKQSKGGIKFELVLSDLSSKAP---TFSSPARKVLSLSDIQERLHAAEKRRQSRIYKLVRKMLERQNYVQEVRKKRMRTMKNFKKNILERYDKKLEAVLRNRAEYLNSIRRKTRE................. 124
96 4.000e-13UniRef50_UPI0009481E54 stathmin-1-A-like isoform X1 n=4 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI0009481E54  ali  49  4VSSTALKEKFTELSLISLLCSCMHNDKVKDEVIKY------------GDMQVKQLDK--SGQAFEVVIKPPSKDA-SEVKLSSPPRSPTCLDXXXXXXXXXXXXXXXXXXXTLKKLAKEREHQMEVLSKAAEVEAAFXXXXXXXXXXXXXXXXXXXXXXXXAKIERLKEMDQRAEVVRQNK..... 171
97 5.000e-13UniRef50_UPI000BA829E4 stathmin-like isoform X1 n=2 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA829E4  ali  35  24...................................................VRATEESRGGLKYELVLAEPSEVTLPPKLTTSPPKCNLSXXXXXXXXXXXXXXXXXXXXXKLNQLSEKRNKEVEVNQKKQEYNSSFXXXXXXXXXXXXXXXXXXXXXXXXXIKEKSRDHVRHAQEVRQNK..... 153
98 2.000e-12UniRef50_UPI0009A0515E stathmin-like n=2 Tax=Euteleostomi TaxID=117571 RepID=UPI0009A0515E  ali  49  2.............................................................LAFEVIL-ELQLRRQGRVPPFSPKKKDLSLEEIQRKLELQRREEESHEAEVLKHLAEKREHEKEVQRKAMEENNNFSKIXXXXXXXXXXXXXXXXXXXXXXMNEKFKEKDKKLEEVRAKKETKE. 135
99 2.000e-12UniRef50_A0A1S3CUM1 Stathmin n=5 Tax=Neoptera TaxID=33340 RepID=A0A1S3CUM1_DIACI  ali  24  1...........................................MADTSATEIRCEEKSKGGIKYDVILAEPAG-TPPPLKTAADTPVILRXXXXXXXXXXXXXXXXXXXXXKIAKNAARRSKIEDAAXXXXXXXXXXXXXXXXXXXXXLEISSEKREALINDKMEKLKDHDRRVEEARLKKEK... 139
100 3.000e-12UniRef50_UPI000A1BD836 stathmin isoform X2 n=4 Tax=Euteleostomi TaxID=117571 RepID=UPI000A1BD836  ali  74  62..........................................................................................................SHEAEVXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKD. 140
101 5.000e-12UniRef50_A0A0A9XUA4 Stathmin-2-B n=25 Tax=Neoptera TaxID=33340 RepID=A0A0A9XUA4_LYGHE  ali  30  10.................................................TEIRCKEESKGGLKFDVIIADPATS--PPKRPSSPKDKDLTXXXXXXXXXXXXXXXXXXXXXKMAQIAAKLSKIEEASKNKDEQMSEFIAQTKEALEQKMESHIEKREAYLTDVKAKLKDH................ 128
102 6.000e-12UniRef50_Q6XJ18 Stathmin (Fragment) n=7 Tax=Drosophila TaxID=2081351 RepID=Q6XJ18_DROYA  ali  32  1................................................ATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSXXXXXXXXXXXXXXXXXXXXXKMADXXXXXXXXXXXXXXXXXXXXXFITQTKEQLESKMELHVEKREAIISDMKEKLKIHAQ.............. 123
103 1.000e-11UniRef50_H0VW37 Stathmin n=1 Tax=Cavia porcellus TaxID=10141 RepID=H0VW37_CAVPO  ali  53  41..................................................................................FPGKKDLSLGETQKKTGGYRERRKSQEAQVLKQLTEKRKQGQEVLQKAFEENSPFSKMAEQEL--KMEQIKENHEANLAAIIELLLLKGEYATEVSRKKELQFE 143
104 1.000e-11UniRef50_E9IHH3 Uncharacterized protein (Fragment) n=21 Tax=Neoptera TaxID=33340 RepID=E9IHH3_SOLIN  ali  33  1..........................................TNGNFTATEIRCQEKSKGGLCYEVILAEP---TVPKRAPSPPQQSPTQQTAIEDKLKAAEERRLSIEANKLAALTAKLSKIEEASRKKDELSAAFITATRESLDAK...................................... 103
105 1.000e-11UniRef50_A0A293LET8 Stathmin (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293LET8_ORNER  ali  24  1............................................MEDSATEVRATEESKGGIKYELVLADPCIDNPVLKSSAPTTPKSLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMLKKIETTEERRDAYIRSIQDKLREHGSHVEEVRKSLDAQSQ 142
106 3.000e-11UniRef50_UPI000CD7ADC3 uncharacterized protein LOC111865848 n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=UPI000CD7ADC3  ali  24  1........................................MADVTNEEPTEMRYQEKLNGDLSYELILAVPVTVTPPKR---PSPRKNVSXXXXXXXXXXXXXXXXXXXXXRLAVVATEISKIEEASKRKKELINNFISKTQEDLERKMKTAIANREMFENDLKSRVREDLEKIK........... 132
107 4.000e-11UniRef50_A0A2F0BDC8 Stathmin (Fragment) n=6 Tax=Gnathostomata TaxID=35060 RepID=A0A2F0BDC8_ESCRO  ali  66  18.......................................................................................................CHQSQEAQVXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVE 100
108 5.000e-11UniRef50_A0A0V1EH83 Coiled-coil domain-containing protein 94 (Fragment) n=7 Tax=Trichinella TaxID=6333 RepID=A0A0V1EH83_TRIPS  ali  22  438................................YHEPTKLISLLSMNPESESSLVMNTSSSGLSFELILRPPTKHAPS--NLNSPCNLKTTXXXXXXXXXXXXXXXXXXXXXKVEK-AKIEERLLEAAERRKALLQKFQEETENEIQSRAKVTSLNREKLFEERIEKIKDHEKHVEEVRRSR..... 584
109 5.000e-11UniRef50_A0A2B4SCS6 Stathmin n=3 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SCS6_STYPI  ali  32  20......................................................SKQLASSVAFEVFLSPKVQNARKPRLTPLKGKENLNIQLLEEKQLAAEKRRKSMEGEFLAKAASRSEHVVQVQQNKQQTVAEKSRMAEEKLKQKMCTHSENKEAQIKALYSRLHAKEQHIKEVQANLRE... 148
110 6.000e-11UniRef50_UPI0007E7F32D stathmin isoform X2 n=1 Tax=Drosophila elegans TaxID=30023 RepID=UPI0007E7F32D  ali  29  3.........................................NTTGNTEATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSXXXXXXXXXXXXXXXXXXXXXKMADXXXXXXXXXXXXXXXXXXXXXFITQTKEQLESKMEQHVEKRDAIISDM....................... 123
111 1.000e-10UniRef50_Q7PMA7 AGAP009940-PA n=84 Tax=Neoptera TaxID=33340 RepID=Q7PMA7_ANOGA  ali  17  9.............SVMQCFCHTCRAPVLPKPTKTRTKQPKASKKVKFITTEIRCQEKSKGGLCYEVILAEPAVNVALPKLPPT-QGKNVSXXXXXXXXXXXXXXXXXXXXXKMADWSAKMAKXXXXXXXXXXXXXXXXXXXXXVLHTKMEQYEEKRVQQLSEI....................... 167
112 4.000e-10UniRef50_A0A060YUF0 Stathmin n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060YUF0_ONCMY  ali  78  38.....................................DAVDLGWCVIKDVEVIELNKRSSGQAFEVILKPPSFDGVPEFNATMPQRRELSMEKIQKKLEAAEE................................................................................... 103
113 7.000e-10UniRef50_UPI0007E60B4C stathmin-2-like n=1 Tax=Drosophila takahashii TaxID=29030 RepID=UPI0007E60B4C  ali  37  4......................................TVFFNFLSFTATEIRCQEKSRGGLSYEVILAEPAPNVAVPKRPVTPGK-NVSVEEIEQKLKAAEERR................................................................................. 69
114 1.000e-09UniRef50_A0A2J7PS38 Uncharacterized protein n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7PS38_9NEOP  ali  29  2..........................................................KCGVSYEVILAEPVTVAPPKQ---SSPRKEVSMDNIEEKFKAAAKRKLSLEAGRMVNLAIMMSKIEEASERRKEQENYFISQTXXXXXXXXXXXXXXXXXXXXXLKSRLKEHWEIVEKTRRSLEMQK. 125
115 1.000e-09UniRef50_A0A0B7AQT6 Uncharacterized protein n=13 Tax=Gastropoda TaxID=6448 RepID=A0A0B7AQT6_9EUPU  ali  27  12.....................CMREQQKKKTVQHRIHPNRQAYDAIVVWKGKENQKAKQGGISFDVILKPAAAETMKPPIQFSPXXXXXXXXXXXXXXXXXXXXXXXXXXXKLEQLAKERQKVIEVVTKAQSASEQFSKKTKEKLRRSMEIRQENRESQ........................... 153
116 1.000e-09UniRef50_UPI000B4F5B0D stathmin-4-like n=2 Tax=Oncorhynchus TaxID=8016 RepID=UPI000B4F5B0D  ali  85  186.....................................DAVDLGWCVIKDVEVIELNKRSSGQAFEVILKPPSFDGVPEFNATMP---------------------QCQEAELLKHLAEKREHEREVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLERLQEK................ 297
117 2.000e-09UniRef50_UPI00099FFEFC LOW QUALITY PROTEIN: stathmin-2-like n=3 Tax=Gnathostomata TaxID=35060 RepID=UPI00099FFEFC  ali  60  1................................................................................................RLEEREGKQRSQEAQVLRALSEKXEHERDVLLKAMEENSNFSKMAEEKLTMKMEQIKENRQAYLASIMERLQEKERHAQVVRRNKELREE 90
118 3.000e-09UniRef50_A0A060YZK5 Stathmin (Fragment) n=2 Tax=Euteleostomi TaxID=117571 RepID=A0A060YZK5_ONCMY  ali  80  1..................................................................................MPQRRELSXXXXXXXXXXXXXXXXXXXXXLLKHLAEKREHEREVIQKAFEDNNNFIKNVKEKLEHKMEANKKNREALLAAMLERLQEK................ 88
119 3.000e-09UniRef50_V5HC57 Putative stathmin (Fragment) n=1 Tax=Ixodes ricinus TaxID=34613 RepID=V5HC57_IXORI  ali  27  1..............................................................KYDLVLAEPNTTESPIKRPTTPPKS-ISXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMSRLAEVNQKKEGSVQEFQEAARQNYEKKIEAFKENREAHIKSIQDKQR.................. 105
120 6.000e-09UniRef50_A0A2G8KUP3 Stathmin n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8KUP3_STIJA  ali  26  7....................................................RKEIKSPGGVAFELVWEKPSKDPAKVLNSPPSKDDINVEKRIKEKQIAAEERRKSMECSRQQQAQKNNQKIMEARAKAEALDKKFKEEAEVKLMEKLQRIEGNQKAC........................... 113
121 6.000e-09UniRef50_A0A0B7BQ71 Stathmin n=1 Tax=Arion vulgaris TaxID=1028688 RepID=A0A0B7BQ71_9EUPU  ali  34  1.................................................MAAENQKPKPGGISFDVILKPASVETPLQLSPSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXXSEQFSQKTKEKLRRSMEIRRENRETQIKALQERLREHANHINEVCQASENR.. 138
122 1.000e-08UniRef50_C3ZNB9 Stathmin (Fragment) n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3ZNB9_BRAFL  ali  46  7LSIQALKEKFTELSLISLLCSCMHNDKDEVIKY-------------GADMQVKQLDK--SGKAFEVVIKPPSKDA-SEVKLSSPPRSPTCLDXXXXXXXXXXXXXXXXXXXTLKKLAKEREHQTEVLSK......................................................... 121
123 1.000e-08UniRef50_UPI00085457DE stathmin-1-A n=2 Tax=root TaxID=1 RepID=UPI00085457DE  ali  50  1............................................MDDADIKVKELEKCASGQAFELILSPPSTDAAPDLLIASPKKKECSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNNFSKMAEEKLTSKME.................................... 106
124 1.000e-08UniRef50_UPI000CD7BF07 trichoplein keratin filament-binding protein-like n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=UPI000CD7BF07  ali  29  2..........................................................KCGVSYEVILAEPVTVAPPKQ---SSPRKEVSMDNIEEKFKAAAKRKLSLEAGRMVNLAIMMSKIEEASERRKEQENYFISQTXXXXXXXXXXXXXXXXXXXXXLKSRLKEHWEIVEKTRRSLEMQ.. 124
125 2.000e-08UniRef50_S9XJG5 Uncharacterized protein n=3 Tax=Laurasiatheria TaxID=314145 RepID=S9XJG5_CAMFR  ali  50  2..PTAYKEKMKELSVLSLICSCFYSQPHPNTIYQYGGPAR.................................................................................................................................................. 39
126 2.000e-08UniRef50_UPI00094E062D stathmin-like n=2 Tax=root TaxID=1 RepID=UPI00094E062D  ali  50  1...........................................MAHIADIQVKELNKRASGHAFELILRPTSPDAKVQFPLSPVKKKETSXXXXXXXXXXXXXXXXXXXXXLLKNLAEKREHEKQVIQRAIDECCNFSKNT............................................. 98
127 2.000e-08UniRef50_A0A226F6Y5 Stathmin n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226F6Y5_FOLCA  ali  27  15.............................................NGLDLNVCASEASKGGLKFEVVLSQATVPTPPRSMSPTHQRPLVSXXXXXXXXXXXXXXXXXXXXXKLASLQEKWKKIDEAAXXXXXXXXXXXXXXXXXXXXXMEAVTGNRETIMTDLKVKLSNHNNHLQEVRQNLES... 155
128 2.000e-08UniRef50_T1GXK5 Uncharacterized protein n=1 Tax=Megaselia scalaris TaxID=36166 RepID=T1GXK5_MEGSC  ali  30  10..............FMRCFCHSCKAPILP------------------AATEIRCQEKSKGGLSYEVVLSKNGVSNVIVPKRPAVLDKNISSQEIDRKLRAAEERR................................................................................. 82
129 2.000e-08UniRef50_A0A091CW01 Metastasis-associated protein MTA1 n=3 Tax=Amniota TaxID=32524 RepID=A0A091CW01_FUKDA  ali  38  107...............................LQTQDWNPTTSTSTLTMDVKVKQINKHVSGQAFEL---SPSFISEAPQTLASPKKKDWSLEEIQKKMEVASETRKSQEAHP.......................................................................... 184
130 3.000e-08UniRef50_A0A0V1P6J9 Stathmin-2-A (Fragment) n=3 Tax=Trichinella TaxID=6333 RepID=A0A0V1P6J9_9BILA  ali  25  18.........................................................SSGNLSFELILRPPTKHAPA--NLSSPCNLKTTXXXXXXXXXXXXXXXXXXXXXKVEK-AKIEERLLEVAERRKALLQKFQEETEKEIQNRAKVTSLNREKLFEERIEKIKDHEKHVEEVRRSR..... 138
131 3.000e-08UniRef50_A0A151MMG6 Stathmin n=2 Tax=Amniota TaxID=32524 RepID=A0A151MMG6_ALLMI  ali  47  79..........................................SDMATSDIQVKELEKRASGQAFELILSPRSKEAVPEFPLSPPKKKDVS................................................................................................ 126
132 4.000e-08UniRef50_A0A0F8CLP9 Stathmin n=2 Tax=Larimichthys crocea TaxID=215358 RepID=A0A0F8CLP9_LARCR  ali  43  11............................................MEEEDIQVKELDKRASGQAFEVILATPAPDAKGDFPLSPPKKKDVS................................................................................................ 56
133 4.000e-08UniRef50_K1QY21 Stathmin n=13 Tax=Pteriomorphia TaxID=6545 RepID=K1QY21_CRAGI  ali  32  117.............................................................................................LRRSMEITKENRELQIMSLQEKLREHLAKVQEV----CKNSESMSKELEERLIQKYEAYEENRNNQLQSVVKRLQDHAKHIEEVCKASETMS. 204
134 5.000e-08UniRef50_UPI00099F47AB stathmin-2-like n=1 Tax=Oncorhynchus kisutch TaxID=8019 RepID=UPI00099F47AB  ali  42  112..............................KERHAPRQHTYTSHLAVAGMEVKPINKRASGQAFEVILKPPSPVSDAAHCVTSPPKREVSLEDIQKKLEAAEDRRRT............................................................................... 188
135 6.000e-08UniRef50_A0A1W2WGQ9 stathmin-1-A-like n=2 Tax=Ciona intestinalis TaxID=7719 RepID=A0A1W2WGQ9_CIOIN  ali  28  3............................................AQREDIKVKEICKGNSGEAFEVILKLPNGDGVASPLKSLTPKKEVSXXXXXXXXXXXXXXXXXXXXXKVTQQKAEEEKILKAKQKKAEVNDSFSQWAEQHLKKQMCQYQENHIAQLEAKIKKFKALNMKPEEMKEKVQREVD 146
136 7.000e-08UniRef50_A0A1L1RJK1 Stathmin n=1 Tax=Gallus gallus TaxID=9031 RepID=A0A1L1RJK1_CHICK  ali  60  1............................................MATSDIQVKELEKRASGQAFELILGPRSKEAAPEFPLSPPKKKDLSLEEIQKKLEAAEERRKV............................................................................... 63
137 7.000e-08UniRef50_H1A3Z1 Stathmin n=5 Tax=Amniota TaxID=32524 RepID=H1A3Z1_TAEGU  ali  55  1............................................MATSDIQVKELEKRASGQAFELILSPRSKEAVAEFPLSPPKKKDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNNNFNKMAEEKL......................................... 101
138 8.000e-08UniRef50_UPI000719E31E caldesmon-like isoform X1 n=2 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719E31E  ali  39  1...............................................MSQEVKASN--NGNMAFDVILAPAS----SPRPNSPPKRKVLSMDDISSRLLAAEERRKSLEASKLTSXXXXXXXXXXXXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXQFRALQDRLKEHERHVEEVRLAGEKYVD 133
139 1.000e-07UniRef50_A0A085N7U6 Stathmin n=3 Tax=Trichuris TaxID=36086 RepID=A0A085N7U6_9BILA  ali  28  16..........................................................SGNVSFEVIFKPPKNASLPSVVASSPTTPTTXXXXXXXXXXXXXXXXXXXXXKVDKAKVEERMAEAAVRRKAMQL--EFQQTTQQDIACRMTATQEKRNKLVEQRLERIKIHHKRIDGARNKTEEERD 141
140 1.000e-07UniRef50_A0A2P2I258 Eukaryotic translation initiation factor 5B-like (Fragment) n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A2P2I258_9CRUS  ali  34  1............................................................................................DINAKLQLAENRRKTLEAERVASVGERLGRLEEAARKRHDCNDEFVKATAAALEQKLDAVTTNREAHLDGLRAKVAEHLNTVQVVRKSVEEQTE 94
141 2.000e-07UniRef50_P79325 Stathmin (Fragment) n=1 Tax=Sus scrofa TaxID=9823 RepID=P79325_PIG  ali  71  7....................................................................................................................PKKKDLSLEEIQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKD. 75
142 3.000e-07UniRef50_B5G334 Putative stathmin 1/oncoprotein 18 variant 8 n=1 Tax=Taeniopygia guttata TaxID=59729 RepID=B5G334_TAEGU  ali  36  1............................................MATSDIQVKELEKRASGQAFELILSPRSKEAVAEFPLAPPPRRRMSHWRRSRRSWKQQRRDAS............................................................................... 63
143 3.000e-07UniRef50_H9J951 Uncharacterized protein n=20 Tax=Neoptera TaxID=33340 RepID=H9J951_BOMMO  ali  28  2.........................................................SKGGLAYEVILAEPVGVPVPRRADS--PEKTPSXXXXXXXXXXXXXXXXXXXXXKMAAIAQKMAKIEEASRIRSEQTNNFIVATXXXXXXXXXXXXXXXXXXXXXLRSRLKDHLEGVEKTRLTLEQQT. 127
144 3.000e-07UniRef50_A0A0L8I3H2 Uncharacterized protein n=3 Tax=Octopus TaxID=6643 RepID=A0A0L8I3H2_OCTBM  ali  28  18.............................KKIQHQVHPDQQPFDALIIWRE--KAKESTGGVAYEVILKPASNYT--PHKPGSPPKETRSLTSTKEKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSDACKNSEMVSKDLEEKINQKFEKYDQNRRVQMQLLLDRLREHDKHIKEVNNACETM.. 217
145 5.000e-07UniRef50_B7PB95 Stathmin n=1 Tax=Ixodes scapularis TaxID=6945 RepID=B7PB95_IXOSC  ali  28  9.........................................................RARTPKYELVLAEPSMTESPIRRPTTPPKS-ISXXXXXXXXXXXXXXXXXXXXXXXXXXXXKMSRLAEVNQKKEGSVQEFQEAARQNYEKKIEAFKENREAHIKSIQDKQREH................ 120
146 9.000e-07UniRef50_UPI000B8EFCB6 stathmin-like n=1 Tax=Acanthochromis polyacanthus TaxID=80966 RepID=UPI000B8EFCB6  ali  44  1...........................................MAASEDIQVKELDKRASGQAFEVILGAPAPDAKGEFPLSPPKKKDVS................................................................................................ 47
147 1.000e-06UniRef50_A0A023FGL0 Putative stathmin (Fragment) n=1 Tax=Amblyomma cajennense TaxID=34607 RepID=A0A023FGL0_9ACAR  ali  35  69......................................................................................................................KMSRLAEVNQKKEGLGEEFQETARQNYEKKIEAFKENREAHIKSIQERQREHVSRVEEVRKSLDAQTQ 136
148 2.000e-06UniRef50_G5AWJ9 Stathmin-2 n=1 Tax=Heterocephalus glaber TaxID=10181 RepID=G5AWJ9_HETGA  ali  48  4.TAMGYKEKMKELSMLSLICCCFCLEPCNINIYTCD...................................................................................................................................................... 38
149 2.000e-06UniRef50_UPI00077A62DD centrosomal protein of 83 kDa-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077A62DD  ali  27  17............................................................GVAYDLILSPKVENARKPHL--TPLKGKENXXXXXXXXXXXXXXXXXXXXXKQAKVAVEMERVNQVQTKKQLIEEEKSKLVKEKQEQKMYIHIENKEAQIKALLDRLHAKGQHIKEMQIKLQKLSE 140
150 2.000e-06UniRef50_A0A087TJH6 Stathmin (Fragment) n=3 Tax=Chelicerata TaxID=6843 RepID=A0A087TJH6_9ARAC  ali  34  1..............................................MSDSAVRATETAKGGIKYELVLSEPSVNDPPKKDQITSPPKTMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIQSTKETLEQKMEIFESNREA............................ 112
151 3.000e-06UniRef50_UPI0008F995BA uncharacterized protein LOC109034174 n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F995BA  ali  27  11.....................................................KVEEKKGGIKFELIESPA--NTPPPKTKSSSPTRTISSENIDEKLKAAAERRLSLEAKKIKQLSNQLSKIEHAMKKRDEISKEFSVRSXXXXXXXXXXXXXXXXXXXXXVLCKLKKQFENGEKT......... 132
152 7.000e-06UniRef50_Q09005 Stathmin-1-B (Fragment) n=29 Tax=Euteleostomi TaxID=117571 RepID=STM1B_XENLA  ali  74  1......................................................................................................................KREHEKEVLQKAIEENNNFSKMAEEKLTTKMEAIKENREAQMAAKLERLREKDKKLEEIRKGKECKE. 67
153 9.000e-06UniRef50_F6U7K1 Stathmin (Fragment) n=2 Tax=Macaca TaxID=9539 RepID=F6U7K1_MACMU  ali  47  1............................................TSTSILKVKQINKRAFRQAFKLILRPPS-----PFCLACXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLKPLPERREHKQEVFEKALE-NDTFISMVEEKLIVKVEKIKENEEANLAATM...................... 114
154 4.000e-05UniRef50_T1FU76 Stathmin n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1FU76_HELRO  ali  33  13...........................................................GGVAFEVIIKPASSDVAPP--SPSKDRPAISXXXXXXXXXXXXXXXXXXXXXRLQAVLKEKDKVVEVNLKNKDIEEAFSKEVEKKLADKLVASEELKKAQEAAKLEK.................... 117
155 4.000e-05UniRef50_UPI0006618AB5 uncharacterized protein LOC105016735 n=1 Tax=Esox lucius TaxID=8010 RepID=UPI0006618AB5  ali  45  4.TLSAYSDKIKEMSMLSLICSCFYSQPHPNSLAQYGGN.................................................................................................................................................... 40
156 1.000e-04UniRef50_UPI000B901394 stathmin-1-B-like n=1 Tax=Acanthochromis polyacanthus TaxID=80966 RepID=UPI000B901394  ali  76  21.........................................................................................................QNHEAEVLKHLAEKREHEKEVQQKAVEENNNFSKMAEEKLNQKMEANKENRTAIXXXXXXXXXXXXXXXXXXXXXKETKE. 100
157 3.000e-04UniRef50_A0A0E9UQZ2 Uncharacterized protein n=1 Tax=Anguilla anguilla TaxID=7936 RepID=A0A0E9UQZ2_ANGAN  ali  38  1.........MKELSVLSLICSCFYPEARNKLVCEFEGSKADSECCFTN.......................................................................................................................................... 39
158 4.000e-04UniRef50_F7EUJ1 Stathmin n=3 Tax=Gnathostomata TaxID=35060 RepID=F7EUJ1_XENTR  ali  66  1.........................................................................................................QSHEAEIXXXXXXXXXXXXXXXXXXXXXNNNFSKMAEEKLTTKMETIKENRDAQMAAKLERLREKDKKVEEIRKGKECKE. 80
159 7.000e-04UniRef50_A0A212C6B7 Stathmin n=1 Tax=Cervus elaphus hippelaphus TaxID=46360 RepID=A0A212C6B7_CEREH  ali  66  34...............................................................................................................VLKQLGEKRESEKEVLQKTIEKNNNVSKMAEEKLTHKMEASKENRGAH........................... 81
160 0.002UniRef50_A0A0U2UEN9 Stathmin-4-like isoform 2 n=2 Tax=Calanoida TaxID=6833 RepID=A0A0U2UEN9_ACAPC  ali  25  97.....................................................ETENKEGGLRYDVVLSPAVRTAPKLTPSSSP----LTXXXXXXXXXXXXXXXXXXXXXRMKNLSDQLAKIEIVQQKREDLDAEKKTKAAESLTAKLSTAEENRLAQLKEVKDRLSDHMVKIETAHKELEAHLE 225
161 0.003UniRef50_UPI0008F9A05B golgin subfamily A member 6-like protein 2 isoform X2 n=2 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9A05B  ali  25  157.....................................................KVEEKKGGIKFELIESPA--NTPPPKTKSSSPTRTISSENIDEKLXXXXXXXXXXXXXXXXXXXXXLSKIEHAMKKRDEISKEFS................................................ 239
162 0.003UniRef50_K1PS63 Stathmin n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1PS63_CRAGI  ali  35  6.................................................................................................................KSLSPQLAKVQEV----CRNSESMSKELEERLIQKYEAYEENRNNQLQSVVKRLQDHAKHIEEVCKASETMS. 73
163 0.004UniRef50_UPI00094818FB stathmin-2-B-like n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI00094818FB  ali  25  1.................................................MDVKQEKRSSGGQAFEIVLGDAAGPPPRPSTPAKSPRS-VTQEDITRKMQEAEDRRKARQSQIMEKLQQEDQKRDEVLKRAAE...................................................... 82
164 0.004UniRef50_A0A2F0AV64 Stathmin (Fragment) n=2 Tax=Euteleostomi TaxID=117571 RepID=A0A2F0AV64_ESCRO  ali  48  1.................................................MEVKQLDKRASGQSFEVILKSPSDSPESPMLSSPPKRKDTSXXXXXXXXXXXXXXXXXXXXXEVRRNKEQRE................................................................. 73

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.