current user: public

If you have questions about the server, please let us know.

Query: 5x41_Q mol:protein length:256 Uncharacterized protein CbiQ, from PDB1018

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# E-value Template Links and tools%idFirst MGSSGSMSIASIDRVAAQGHWRSRPLAEKSLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARVPLRFWASVAVLPLGFLTTGAAVLLIQIGPEGIGLAPDGPAKAAALVMRATAATCCLLFLATTTPAADLLSGLRRWRVPAELIEIALLTYRFVFILAEEAAAMTTAQRARLGHATRRRWLRSTAQVIAALLPRALTRARRLETGLGARNWQGEMRVLSTRPPASARVLGLILTLQAAILAAGVLLLast
1 8.000e-51UniRef50_UPI0004AC86F6 energy-coupling factor transporter ATPase n=1 Tax=Oscillospiraceae bacterium VE202-24 TaxID=1232459 RepID=UPI0004AC86F6  ali  18  287.....MLKDITLGQFFPGNTVAHRLDPRTKILLVVLYIVALFCAKSLLAYGILAAVLAVCVRISRVGIKSLVRGLKPVVFIIVFTGILNLFFTPGGFLRISAEGLQNAVFIVLRIMLLIMGTFLMTYTTSPISLTDGLERLHVPHELAMIMSIALRFIPTLIEETDKIMSAQKARGADGNIIQKAKALIPILVPLFISAFRRADELAVAMECRCYHGGRTKLHVLQYEGRDYLALALGLAVTAGIIVL.. 549
2 1.000e-50UniRef50_A0A1F2WHM0 Cobalt ECF transporter T component CbiQ n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WHM0_9ACTN  ali  19  4......IQHAFLDEYSDLDSVIHKLDPRAKLIGFVALVVLCVSPNLWLAFAVFLALEMTVLFISHVPLRHVLKRMLIVVPFILAVALFIPFFYNLGPLKVSAHGLTILWNVTIKSMVSVFAVILLSSTTPFPDLLHAMEKLKMPRIITTTLSFTYRYVFVLLDELQRMKRARDSRGWSGKWLWQAKVIGHMIGALFLRSYERGERVYAAMLSRGYDGQVQTAYTYRVGVAEIGFLALIVLVPIAVRL... 252
3 1.000e-48UniRef50_D1JAC3 Putative cobalt transport protein, cbiQ family n=6 Tax=Archaea TaxID=2157 RepID=D1JAC3_9ARCH  ali  18  1.....MIEYPEIDRYASRDSLMHRFDPRAKIVAFLFLIFSIVLLNDLKLVLIGFLVSILFLIASKLPFRFVFQHIKAVSLFIIPFLVIMPFTFGFYAIKVTYEGLRYGILVVIKAFSAVMLVFPMIATTKFETTIKALDKLKVPNILVQMLMFTYRYIFVFVNEFQRLLIAMESRGFKLGTRSALRTIGNALGMLFVRSYERAERVYLAMRSRGYAGSQKTLVEFKMCTKDYVFAGFIIAFAVCL..... 247
4 5.000e-48UniRef50_A0A2C6L1C0 Cobalt ABC transporter permease n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6L1C0_9FIRM  ali  27  1........MLQIEKYAYCNPLRGVHPGEKFLFAVATMMTCLALNSLSVSGIVLFLMAGVTVWKGNIPLCFYIKLLSIPLFFLMAGTILWSWQYANLSFGITMESLLACAKLFLRSIATVSCLYFLSLTTPLVEIISILRKLKIPELFLELMSLIYRYLFILLEMAERIYSSQSARQGYSSIKNSYRSMGLLASSLLIRSHQRSLNLYMALEARGYNGTIKVLEQRYQLSKRNLLLIAITELSLILVDYL. 254
5 1.000e-46UniRef50_A0A134CA86 Energy-coupling factor transporter transmembrane protein EcfT n=78 Tax=Terrabacteria group TaxID=1783272 RepID=A0A134CA86_9FIRM :  ali  16  1.....MLTDITLGQYYPGDSFLHRLDPRTKILCTMIFICSIFLANNWWSYGLVTLFTGSCIFISRVPWRMIWKSLRPLWLILVFTLMIHVLTTPGGPIHVSEEGLRNGTLMTLRLVFLIAFSSLLTYTTSPIVLTDGIEALLMPHELAMMMTIALRFIPTLLEETDRIMKAQASRGADGNLWQKAKGLIPLLVPLFISAFRRADDLATAMEARCYRGEGRTKMHQLIYTKRD.................. 245
6 1.000e-45UniRef50_G9YGU0 Energy-coupling factor transporter transmembrane protein EcfT n=22 Tax=Bacteria TaxID=2 RepID=G9YGU0_9FIRM  ali  18  1.....MLTDITLGQYFPGNSFLHRLDPRIKIIATMIVIISVFLAKSFLSYAVLTAFIVFSYLLSRLPAGNVFKSLKPLWGIIFFTMAVHLFTTPGGIIHITKEGIRQGVLMTLRLVYLIVFSSLLTYTTSPIVLTDGIEHLLNPHELAMMMTIAMRFIPTLLEETDRIMKAQTARGANGSLWQRGKNMVPLLVPLFISAFRRADDLATAMESRCYRGGRTRLHELACTWRDGAALCGVVSVTGVLAVL.. 262
7 5.000e-45UniRef50_A0A1G1MXH4 Cobalt ECF transporter T component CbiQ n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1MXH4_9BACT  ali  19  1......MEHAFLDEYSHSDSFIHRLEPRIKIACFFLFVFYVAFQRSIYVYGAYAIVMMSLVRVSRIPLAFVFRRVVSVLPFIVMIALSIPFALGSLKLSVSFEGIVLFVNIVIKACLSIIAMTLLMASTDFSQLLKAFEKLHVPGVLLMVLSFMYRYLFVIEDELMKMRLAKDSRTIGGSKWFHLKAQANMLGVLFIRAYERAEKVYLAMCARGYEGKMRTLYDAKVTLRDVLFCVVFFGVMTII..... 251
8 7.000e-45UniRef50_A0A2G3PZV0 Energy-coupling factor transporter transmembrane protein EcfT n=10 Tax=Firmicutes TaxID=1239 RepID=A0A2G3PZV0_9FIRM  ali  19  1.....MLRDITIGQYYPVDSPIHRMDPRAKILITFAYIIGLFFINHFIGYGFVVLCLYGTIQMSKVPIRYMLKGLRSILFILLFTVALNIFFWSWGFLTITEQGLIIAAQMACRLILLIIGSSLLTLTTSPIQLTDGFRRIGVPHEIAMMMSISLRFIPILLEETDKIMKAQMARGADGNIIRRAKAMIPIMVPLFISAFRRAEELAMAMEARCYRGGVGRTRLHSLHYEKVDYCAFVLASLFFIGCIIL 263
9 6.000e-44UniRef50_G5INM2 Uncharacterized protein n=2 Tax=Hungatella hathewayi TaxID=154046 RepID=G5INM2_9CLOT  ali  22  6.......HVYTIDDYAYRSPFRSWNPALKAGTAMLVLVMGIGISDPAVSCWMVFTGGLIAVLGCRVPVWDYLELLKIPLLFILLGCAAIAVEIGGLRLYLSRESVTEACHVALRTLGAVSVLYGLVLSTPVHEIAAVLRQLHVPKVVTELMILIYRYIFLLVEAQHTMRQAAESRLGYCDFRTSCRTFGNSMSSLLLVSMRKASRYYDAMLSRGYDGELLFWEEEKVVKAWQVLCLAAYAVSLPLVKMIF 251
10 7.000e-44UniRef50_UPI000491DA6C cobalt ECF transporter T component CbiQ n=1 Tax=Proteocatella sphenisci TaxID=181070 RepID=UPI000491DA6C  ali  23  1........MSGTDRYAYASKVRSSDPVTKILVSLGMMFICIVLDDILVSLVTIVAMSACNMWMGGHRARDIWRMLRIPMGFIFLGVITIAFKAGNHLYGISQKGALEAISISAKSLGVISSVYFLVMNTPMTDITLALSKMHVPALFVELLELVYRFIFVLADTAEKIKTAQSSRLGYVDMKTSYRSTADLISRVFMSSFRKADNIYDALESRGYTGELRTVGYEYEIDTNITFVAIAVALLQIGAYMI. 254
11 4.000e-43UniRef50_A0A0B7MBY1 Putative Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Syntrophaceticus schinkii TaxID=499207 RepID=A0A0B7MBY1_9FIR  ali  20  1......MRSPELERYAELNSPVHNWDPRVKIISCIIFLCTIAATGKPSSALAALVATGVLVIISRIPLGFVLGQVKYVIYFLLPLCVIILFSYQEGPLTVTEGGCKKAALLFLRPLAMVLLIFPMLGTMRFDEAINAMESIKVPSNLLQVFAFTYRYIFVLMDEIRRMQRAQAARCFQNKLSLSLRTMGMFIGMIFIRAHERAERVIRAMLSRGYDGKTKVLHQFNIHPSD................... 233
12 5.000e-43UniRef50_A0A2C8F5G6 Nickel transport protein NikQ n=3 Tax=Pseudodesulfovibrio TaxID=2035811 RepID=A0A2C8F5G6_9DELT  ali  16  8..............FAHGESLIHGIDPRIRLICATLLTVPTALLLRIDQSIAMLILGVVLIGTAQLSPARVLSRLAIVNTFIAFLWLFIPFSTPGGPLTVTHEGLVLSTLVTLKSNAIILTLIALLGTIKVQDLGPAMQSLKVPDKLCHLLVFTYRYIFVIHQEYQTMRQAMSARGFPTTNTHTYRTYAWLVGMLLVKSWDRAERVHGAMMCRGFKGKFYSLASFTTSVTDYCFLMGCMVMIIAV..... 245
13 6.000e-43UniRef50_UPI000B88F2EE cobalt ECF transporter T component CbiQ n=1 Tax=Jiangella sp. DSM 45060 TaxID=1798224 RepID=UPI000B88F2EE  ali  25  373............GLYRPGDSLVHRLPAHVKVVALLAFVLVVVATDEFGAFGAYAVLLAGVAALARVPARVVVARMVVEIPFVVFALLMPFVSQGPLGLSLSEHGLLTGWNILAKGTLGVVASILLAATTEVRSLLAGLQRLRVPDRLVEIASFMIRYADVVSGDLRRMRIARESRGFEARHLGHVRVVAQGAGALFVRSYERGERVHLAMLSRGYGGSMPLTATVGASRADWLRGAGL............ 604
14 1.000e-42UniRef50_K4LJX2 Transmembrane component CbiQ of energizing module of cobalt ECF transporter n=20 Tax=Firmicutes TaxID=1239 RepID=K4LJX2_9FIRM  ali  26  1........MIYIDKYAYLSKLKQTNPLQKLVLAILVLGVCLWAESVAVSILTLLIMGWYTVCKGGTPXXXXXXXXXXXXXXXXXXVFVFSVYAFGMYIGVSQSGILSAANLFFKALGAVSCLYYLSLSTPMVDLLAVLRKLKVPRLMVELMGLIYRFIFVFLETADTMFTAQNSRLGYAGLSSGYRSLAALASSLFIRSYQRADELYIALEARGYDGELSVIHEQAETHWTEYIPIVLINLFLIAVALF. 254
15 1.000e-42UniRef50_A0A1S6IWP5 Cobalt ECF transporter T component CbiQ n=2 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1S6IWP5_9FIRM  ali  32  1........MIHLDQYAYGNALRNVHPQEKFFFALATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIPLRFYCKXXXXXXXXXXXXXLLWGCQIFHVYLGVTNQSLLLAAKLFFRAWGAVSCLYFLSLTTPSVEIIAILRKLKVPELFLDLMSLTYRFLFVLMDRADNIHIAQTVRLGYTDIRKGYRSLGQLVANLFLHSYQRSRDLYTALEARGYQGYFRVLEREYRYSKKNLCLILCLEMLLILIAW.. 253
16 1.000e-42UniRef50_B8I0P9 Cobalt ABC transporter, inner membrane subunit CbiQ n=6 Tax=Clostridiales TaxID=186802 RepID=B8I0P9_CLOCE  ali  24  1........MILIDKYAYASKLARISPKVKLIYTMFPLILCISLNSFSVSIVTIFVMAVTTVGVGKIKFSAYLKLLFIPFGFLMVGTITILINIDNYAYGIDRVTLTNSLKLVLNALGGVSCMYCLSLSTPMSDLFQVLRQTKLPAVIVTLMELVYRYIFVLMDEIGRMNIAKNSRLGNCNFKTSLKSTSELIGMLFIRAYNRSDRVYAALESRGYNGQFVTLDEEYINGKR................... 236
17 2.000e-42UniRef50_A0LCD6 Cobalt ABC transporter, inner membrane subunit CbiQ n=2 Tax=Magnetococcus TaxID=162171 RepID=A0LCD6_MAGMM  ali  22  17................PQASWLHRIDPRLRIVCALLFALVQVALHELEPLGAGVAMGLAMVLMARLPWRTIIKRTLGVDLFVVFLLVMLPFSFSVGPWQASWQGLQQAAEIGLKAVGVMLMLLALVGTQEPHQLGHALHRLGVPDKLVLILLFTARYLEVLRMEYGRLRIAMKCRGFPRSNGHTWRSFGYLFGMLLVRSLERSERIYAAMKCRGFTGHFYVLSPMGLGRGD................... 238
18 3.000e-42UniRef50_V7I5D8 Energy-coupling factor transporter transmembrane protein EcfT n=137 Tax=root TaxID=1 RepID=V7I5D8_9CLOT  ali  15  1.....MIKNITIGQYIPGESFIHKLDPRSKILISLLFIINLFLVRNFVGYVAVFAFIVLMVKVAKLSPKYLYKGIRPVFVLILFTAALNLFVTQGSIFKIYREGVYQAMYMTCRLMFLIMGTSVLTLTTSPIELTDGIESLLKPHELAMMMSIALRFIPTLMDETDKIMKAQMARGADRNLIKKAQSLIPLLVPLFISSFRRAEELAMAMEARSYRGEGRTRMKQLKYTKRDGVAFASFAVLFAATF... 263
19 4.000e-42UniRef50_A8ZTE1 Cobalt ABC transporter, inner membrane subunit CbiQ n=9 Tax=root TaxID=1 RepID=A8ZTE1_DESOH  ali  20  6..............FAAGTSFFHRMEPRIRIVCALVYSVAVAVCVSFPPVVFALLFSALMTGAARLNPGLLIRRVAVVNIFILFFWLVLPFTFHVAGLAVTRQGVAFAALLTLKSNAIILGMVALVATMSFVTMGHALGRLGLPDKLVNLLLMTYRYIFVIETEYGRIIRAVKIRGFPRTSLHAYKTYAYIVGMLFVKASERAERVYGAMQCRGFKGKFYTLSRLPFSRGSWVFAGVMGGIIVCIALL.. 246
20 4.000e-42UniRef50_A0A2R4N351 Cobalt/nickel transport system permease protein n=4 Tax=Carboxydocella TaxID=178898 RepID=A0A2R4N351_9FIRM  ali  31  1........MFNIDQFAYNNRLRHVHPLEKLLLTGLTMGAVLSHPQPVVTGLVLLIMNGILWGRAGIPLRYLVRXXXXXXXXXXPVSGIITWKIGPLFAGIDWRQLGLALRVILQALAAVSCLYFLILTTPMVEILGILRRLQIPPLLLELMGLVYRFIFVLAETAVQIQISQASRWGYASLGNSYRSLGQLITALLFKSQQRSRQLYQALEARGYQGELRVLEPEYHWSGANLALIALVQMVLWFMAL.. 253
21 4.000e-42UniRef50_A0A0A3WZ33 Energy-coupling factor transporter transmembrane protein EcfT n=753 Tax=Bacteria TaxID=2 RepID=A0A0A3WZ33_BACCE  ali  17  1......MQQLIIGRYIPGNSLIHQLDPRTKLLIVFLYVFVVFLANNAISYGFLFLYALIALFFAKVPIRYVLSGLKPILWIFLFTFFLHIFTFQLGWFSIYEKGLEQGIYISVRFFVIILMTTLLTLTDGLETLLKPLKRIKVPHEIALMMSISLRFIPTLMDETSKIMKAQASRGIDGPIKDRMKAIISLLVPLFISAFKRAEDLAIAMEARGYQGEGRTKFRQLRWKTSDTVTIVSLFCLACILAWV. 262
22 5.000e-42UniRef50_A0A1Y3QTQ7 Uncharacterized protein n=1 Tax=Firmicutes bacterium ZCTH02-B6 TaxID=1861639 RepID=A0A1Y3QTQ7_9FIRM  ali  20  4.......RDVTLGQYVPGRSPVHRTDPRIKLVLAVVFSATLFVVNGWTGYGALAGYVIACTALARLPWGLVVRSLRPILLLVVLTIVFHGVQTPWGPVEITGEGLTAAVRLAVRLVLLAAGVSLVTLTTSPVAMTDGLERLLSPAEIAFMVSLALRFIPTLAEEFDRIVKAQKARGADGGVFRRARALVPVLVPLFVRAFRRADGLALALESRCWRGEGRTQWRSGRVGARDWLVLVGSLVLFGVVGW.. 262
23 7.000e-42UniRef50_I1ZPQ0 Energy-coupling factor transporter transmembrane protein EcfT n=29 Tax=Streptococcus TaxID=1301 RepID=I1ZPQ0_STRPA  ali  16  1......MNNMILGRYIPGNSIIHQLDPRGKLLSMFLFIFLLFWANNLQTNLLLFGFIFVLMYLTKISVSLYVKGLKSMIFIIAFTTIFQLFLYQWWFLKLTDQGLMQAAIIFCRFILIIFYSTILTVTTTPLSLADAVEKILTPHEIGLMLSMSLRFVPTLVDDTNRIMNAQRARGGEGNLLKRIRSFIPILIPLFASSFKRADALAIAMEARGYGGEGRTRYRSLQWRLKDTLALLVILCLMLFVFYL. 262
24 7.000e-42UniRef50_A0A1G6PFK4 Energy-coupling factor transporter transmembrane protein EcfT n=4 Tax=Thermoactinomycetaceae TaxID=186824 RepID=A0A1G6PFK4_9BACL  ali  20  4......LNHPVIGQYIPADSFLHRLDPRAKLVFVFVFMMIVFLAKNAAGYSLLVGVALSGVLLSRIPLPMILRGIKPVLYLIILTALLHLVWWELGPITVYEQGVVQATVISLRFLILVLMGTLLTLTTSPMELTDGLERLLCPQDLALMMSIALRFIPTLWEEMDKIMMAQRARGADGHLLRRVKSYIPVLIPLFISAFRRAEELALAMEARGYRGKGRTRIRELRWKKEDTILLVVLAVLSISLWWL. 265
25 1.000e-41UniRef50_A0A2S6FY66 Energy-coupling factor transporter transmembrane protein EcfT n=8 Tax=Firmicutes TaxID=1239 RepID=A0A2S6FY66_9CLOT  ali  16  1.....MIKDITIGQYVPGESFVHKLDPRTKILISLLFIIQLFLIKSFSGYIFVVAFILATVSVAKLSPTYLYKGLKPVFILIVVTAILNLFVFQWKFIKIYKEGLSTAGFMVLRLIFLIIGTSLLTLTTSPIELTDGIERLLSPHELAMMMTIALRFIPTLMDETDKIMKAQMARGADGNIINKAKGLIPLLVPLFISSFRRADELAMAMESRCYRGG................................ 231
26 1.000e-41UniRef50_A0A252F334 Cobalt ECF transporter T component CbiQ n=1 Tax=Butyricicoccus porcorum TaxID=1945634 RepID=A0A252F334_9CLOT  ali  26  4............DRYAYASRLAHVSPQSKLLVMAVTTVLCLCLDCISVSVVTILAMGAATVCLGGVRLREFRRMLLVPAGFMILATLTIFISLGTHGYGVTAASAVQGISICLRALGVVASMYFLAMNTPMTDITGVLRQLHVPELLVELMELIYRFIFVLYETMHRIHTAQTSRLGYDGLVNVYHSTGTLAAMLFVRAWQKSDRVYAALESRGGGQSVRTLAEEYESGRAVYLMC.............. 240
27 1.000e-41UniRef50_A0A1Q6DQY7 Cobalt ECF transporter T component CbiQ n=1 Tax=Desulfobulbaceae bacterium DB1 TaxID=1920419 RepID=A0A1Q6DQY7_9DELT  ali  18  42.GATADWTLPALDAYADRSSFFHGWDPRVKIATIFFYCFAVASLKSLLWSAMALCIGIVAVIACRIPLRRTVKRLGAMAGFLAMFLFVVPFTSPLHGIPFHGHGFAVALRIVLKACAIGLMMEPLLATAALPVTLQALSRLGIPDSISQMLLLTHRYIFVFLHETKRIYRSMRVRGFRPTDIATMHSMGNFFGMLFVRSFDRTQRVYDAMLSRGYNGSFPSFTHFATTRKDWCKALLWAMIGLALIWL.. 301
28 2.000e-41UniRef50_B8I813 Energy-coupling factor transporter transmembrane protein EcfT n=879 Tax=root TaxID=1 RepID=ECFT_CLOCE  ali  16  1.....MIRDITIGQYVPGNSLLHKADPRTKXXXXXXXXXXXXXXXXXXXXXXXXXXTAITVVSSNIPVKFVLKGLKPILFIVVFAGIINIFIWSWGFLSITYEGINVAIKMAIRLFLLIITASLLTYTTTPIALTDALKRIKVPHEIAMMMTIALRFIPTLLDETDKIIKAQSSRGADGNMIERAKSFIPVLIPLFISAFRRADELATAMEARCYRGEGRTRMKQLRFTRFDVLVTGITVVFMTWVILM. 262
29 2.000e-41UniRef50_K8ELH8 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Desulfotomaculum hydrothermale Lam5 = DSM 18033 TaxID=1121428 RepID=K8ELH  ali  31  1........MLPIERLAYCNGLRGIHPGEKFLLTSCFLLTCLALNVPVVSGLVLLTMSVITLRQGKIPLGFYLKLLSVPMFFLMAGTVLWSWQWGGLKLGVTSSSLLACAKLILRSLAAVTCLYFLALTTPLIEIIGILRKLKVPPLFIELMSLVYRYLFIWLATATGIYTSQTARQGYSCLKNSYRSLGLLASSLLVRSQQRAQELYTALEARCYQGTIEVLEQTYPLSKKN.................. 237
30 3.000e-41UniRef50_UPI00098418F3 cobalt ECF transporter T component CbiQ n=1 Tax=Massilimaliae massiliensis TaxID=1852384 RepID=UPI00098418F3  ali  29  1........MNQIDKIAYSSRIARLDPKGKLCFSLFPLCLCIGTRSIAAGLITLFAMAALTCMLTGLTLKRYLHFLLIPCGFLLIGTLTIFITIGQYQYGISPDSLFQGIRLCSTALGAVCCMYFLSFNTPMTSLFQCLRGSPLPGVLVSLMELIYRYIFVIWEEAARMKTAQEARLGYRGLRQSIQSAGTLIGTLFFRAYSRCGRICAALEARGFEGDLNALQETYAPSKKWYGYTLAFCLVLGAAAL.. 253
31 3.000e-41UniRef50_A0A1C7IBF6 Energy-coupling factor transporter transmembrane protein EcfT n=19 Tax=Clostridiales TaxID=186802 RepID=A0A1C7IBF6_9FIRM  ali  17  1.....MIRDITIGQYYPADSHLHRLDPRVKFVGTIMFLVSLFXXXXXXXXXXXXXXXXXXXXXSKVPVKFMLKGLKPLFFILLITVAFNLFLWQFWIFEITKEGILQAVRIGIRLIYLVIGSSVMTLTTTPNQLTDGLERLMRPHDIAMMMSIALRFIPILMEETDKIMKAQIARGADGGLIQKAKNLLPLLVPLFISAFRRADDLAMAMEARCYGGENRTSMKPLIYHSRDISAYVCIFLYLAA..... 258
32 4.000e-41UniRef50_Q67JX5 Cobalt ABC transporter permease protein n=8 Tax=Terrabacteria group TaxID=1783272 RepID=Q67JX5_SYMTH  ali  25  6..........AIGQYYPGNSLLHRLDPRVKITGVFLLSIAIFLPRAWPGHLAAVLFTLALVALGRVPLKQILRGLRPILIFLVITALFNLFLTPGGPAVATREGLRLVAVTSTRLLLLVTIASILTLTTSPIRLTDGLEMMLRPHELALMMTIALRFIPTLAEEADRIMRAQQARGASGSLVSRVRSLVPVLVPLFVAAFRRADELATAMEARGYRGEGRTRMKELTFTARD.................. 245
33 4.000e-41UniRef50_A0A2N2DKW7 Cobalt ECF transporter T component CbiQ n=1 Tax=Firmicutes bacterium HGW-Firmicutes-14 TaxID=2013775 RepID=A0A2N2DKW7_9FIRM  ali  28  1........MLNIDGFAYTNRLKNVHPTEKAVFALLTLFLCLVFSSFTVSCLTLLLMTVVTVRRAGIPYRAYFRXXXXXXXXXXXXXWLGSLTAAGVTFGVTSGSIIKAAELAGKSLAAVSCLYFLALTTPVVDLTAAMRKLRIPSLFIELTELTYRFIFVLQETAEDIYLSQSVRWGYSSLKNSYKSLGSLTATLFLRAHHRSGMIFTALTARGYNGQLSVLAPEYRVSTANILMITVVELLLLSVGVI. 256
34 4.000e-41UniRef50_A6NSD6 Cobalt ABC transporter, permease protein CbiQ n=8 Tax=Clostridiales TaxID=186802 RepID=A6NSD6_9FIRM  ali  27  4............DRYAYQSKLRRVSPMPKLLLTAVSLLLCLCCDSIAVGLATLVGMGLLTRMLGGLSLRVYLHFLKIPLAFLLIGSITVLFHVGSRLWGFDAAALQQASTLFCKAMGAVACMYFLTLNTPVTDVTMALEKLHVPRLLVELMELIYRFIFVLAETAANIRIAQESRLGYQGLRRSISSLGTLISMVFLRAWRKADRVYTALESRGYANHLTTLSSGYRSGRWLYPATAGVALGQLLVFCL. 253
35 4.000e-41UniRef50_A0A0M2RBU9 Cobalt ABC transporter permease n=5 Tax=Kiloniella TaxID=454159 RepID=A0A0M2RBU9_9PROT  ali  21  24....................FLKSLDPRVRLVSCVLFAFLISAMHDLGALTLALGIGLGLSLSSRLPLWTTIRKVIVVDSFIVVLMLTLPFTFSVWGWDASKEGLYRAAEVGLKANAILFSLMGLVGIMEPSVLGHALYRLRVPAKLVHLFLFTVRYIDVFYKEYKTMRMAMKARGFPRTNIHTLRSIGYLIGMMLVRSLERSDRIMEAMKCRGFDGRFHVLNNMKIEKRDRVFAVCVAVVILSLIAV.. 258
36 4.000e-41UniRef50_A0A2G2DYQ1 Cobalt ECF transporter T component CbiQ n=1 Tax=Desulfotalea sp. TaxID=2030813 RepID=A0A2G2DYQ1_9DELT  ali  16  4............EDFAKGNSLLHSIDPRVKIVVALFFVLIIAVTDNFRVVGVALIGALAMTILARLPLTLVGKRLLAANSFIIFIWITLPVTYGGGPFPFSREGILLSSLITLKTNTIVLIMTSLLATSTIASLGHALEGLGLPGRLSFLLLFSYRYIFVIHGEYQRLVRAAQMRCFQPTTIHTYKTFAYLFGMTLVKSYNRGDRIHQAMLLRGFNGHLYPLAQHKITRTDIVFLCGGLTATTALVFL.. 246
37 6.000e-41UniRef50_A0A173YE34 Cobalt ABC transporter inner membrane subunit CbiQ n=5 Tax=Clostridia TaxID=186801 RepID=A0A173YE34_9CLOT  ali  19  6...NSIYEINTLDDLAKKDTIIHIHPLVKLITTFLYLICVVSFNKYEISLIPFVFYPILITSLGEIPLAPILKRVLIAAPFILGVGVINLFYMNVAGIIINS-GWITFLSLSIKILLTVVVSILLIATTGMENLACALRMIKVPKIFVMQILLTYRYISVLVEEASRMMKAYYLR-APGQKGVKMKDLGSFIGQMLLRTYDRAQRVYEAMKLRGFNGEYNSTASLKIKLSDYLYLTIWCLFFIVARNF.. 254
38 6.000e-41UniRef50_A0A1D7XGF3 Energy-coupling factor transporter transmembrane protein EcfT n=22 Tax=Bacteria TaxID=2 RepID=A0A1D7XGF3_9CLOT  ali  17  1.....MLKDITIGQYIPGESFIHKLDPRTKIMISILFIVCLFIINKFIGYTFIFLFLASIILIAKIPLRFIFNGLKPVFLLIALTAILNIFMISIGFLSIYVEGVKLAGFMALRLIFLIVGTSILTLTTSPIELTDGIEKLIRPHELAMMMTIALRFIPTLMDETDKIMKAQKARGADGNIINKAKSLVPLLVPLFISSFRRADELAMAMEARGYRGGRTRMKILKFTSKD................... 246
39 6.000e-41UniRef50_A0A1I2LFA3 Cobalt/nickel transport system permease protein n=3 Tax=Clostridium TaxID=1485 RepID=A0A1I2LFA3_9CLOT  ali  23  1........MNSIDKYAYKSKICDIDPKSKIVVSMVTXXXXXXXXXXXXXXXXXXXXGYESIRCSGISIKKYIKLLMIPTVFLLIGTITIIVNIGEYNYGVNVNSLQYGFTLIFKALGAVSSMYFLTLNTPMIDLFEFFRGTHLPNLIISLMELIYRFIFIISEETENMKIAQDSRLGNLTFKSSIRSTAEMISMIFLRSYRRADRIYTALESRGYEDNVQFMKENYKSGKKIYITGISINIFIIAVGII. 254
40 9.000e-41UniRef50_A0A0F0CV29 Cobalt ABC transporter CbiQ, permease subunit n=1 Tax=Candidatus Omnitrophus magneticus TaxID=1609969 RepID=A0A0F0CV29_9BACT  ali  20  1......MHHSYLDKYSYIKSPIHRLDARVKTITFLIFILFIIAPDYYLSFLIYGLILSILITLSKIPLRFVVTKTLVLVPFVLMIAVFIPFFKQGEILAITGAGLIMFWAVIIKAYLSMLCVILLISTTVFTSFLKALEKLYMPKVFIMIMSFMYRYIFIILDELMKMNQAKLARGAKNRGWFNVKVLSNMLGVLFVRAYEKGENVYLAMNARGFQGDIRTLEQFRITKFDIMFLIIIISCLSGIKIF.. 254
41 9.000e-41UniRef50_A5N2T3 CbiQ n=24 Tax=Firmicutes TaxID=1239 RepID=A5N2T3_CLOK5  ali  25  1........MISIDKLAYTSQLRSSNPMEKFIFSIFTMVLCVLLNNIVYSVIITVFMGVVAIFKGKIPIRSXXXXXXXXXXXXXXXXVLFSFTILNIKLGCTRESVEMSSKIFFKALAAVSCLYFLALSTPIFEVLMVLRRLKVPKLFVELMGLIYRFIFVLLDTANMIFISQNSRLGYSTIKASYNSLGKLISCLFISSYKRSQDIYTAMESRCYDGEINLIENSYKISYKNML................ 239
42 1.000e-40UniRef50_A0A1H0F7V9 Energy-coupling factor transporter transmembrane protein EcfT n=20 Tax=Bacillales TaxID=1385 RepID=A0A1H0F7V9_9BACI  ali  17  1.....MMGSFMVGQYIPGESLIHRLDPRLKIVMVFIYVIVVFTSETFISYLVLFAFAFLSTLLTRIPLKFVIKGLKPVWWLIAITFVLHVLWIEIIGFPIYKESIIQAVKISVRFFLLILMTTILTLSTTPIAITDAVESLLHPHELALMMSISLRFIPTLMQEADKISKAQASRGLDGKIKDRVQAIIPLILPLFVNAFKRAEDLAIAMEARGYQGEGRTKSRELAFRRRDYIAGFMFILMMFIYFIL. 263
43 1.000e-40UniRef50_A0A1Q9K2E2 Cobalt ECF transporter T component CbiQ n=1 Tax=Anaerostipes sp. 992a TaxID=1261637 RepID=A0A1Q9K2E2_9FIRM  ali  26  1........MNQMDAIASRSDLREIHPRVKMIYTGITLAICLWASDVLVSILLLGLNTVLITLISKAPVKSYRKVMQIPLVFLLFTALGMMIHIPWTTRYLVPDAIRVA-ELMLRVWAGCSSMFFLSFTTPIFDIITCLHQWKVPEFLTDLMLYMYRFIFLLLDVGDVMQISQRARLGYDSKKSWIHSTANVAVSLFIIAYQKSEQLYIAMECRLYDGKMRYYGEEGREEAGWYVGIAVIAVLLILL.... 237
44 1.000e-40UniRef50_A0A1I2Q9B5 Cobalt/nickel transport system permease protein n=1 Tax=Desulfotomaculum arcticum TaxID=341036 RepID=A0A1I2Q9B5_9FIRM  ali  24  1........MLLMDYYAYNNKLSYVHPGEKFIFFAGTLTVCFALNTAITCLAITLLMSLAVVVLSGVPWRFYXXXXXXXXXXXXXXXFIWATRLGYYTIGVTNQSLDNAVDLLLRSLGAVSCLYFLSLTTPLTDIVLIMKRLRVPLLVVELITLIYRFIFILLDMAGKIYIAQSSRLGYKTAPTGFNSLSRLLLSMFIKSYRHSQAIYDSLASRCYNGDLHFFTEQRHWSWRNIGLIIVIDGALVVCSL.. 253
45 1.000e-40UniRef50_A0A1I2F584 Energy-coupling factor transporter transmembrane protein EcfT n=10 Tax=Bacillales TaxID=1385 RepID=A0A1I2F584_9BACI  ali  16  1.....MFKHIIIGQYLPGNSFLHRMDARAKLIAVLLMIMVIFLADTWRGYGAVTVGTVGVWMISGVPLRYILKGMYPILILIVGTFLLHAFLTQVGAFSVYSGGIEQGLFIGLRLFFLVLVTSLLTLTDGLEQMLQPLKRFGVPHEVALMMSIAIRFIPTLFQEAEKIIKAQTARGAKGSMKQRTQAMISLLVPLFIRAFKRAEDLALAMEARGYNGEKRTKLRALTWRRKDTIACLIVAVSAVLLFFF. 263
46 1.000e-40UniRef50_C9KPD9 Energy-coupling factor transporter transmembrane protein EcfT n=14 Tax=Firmicutes TaxID=1239 RepID=C9KPD9_9FIRM  ali  15  2.....MLSDITIGQYFPGSSILHRLDPRTKVVLLFFYLVLIFLCKSAISYAIVTVLTVTLMVLSKVPMRMMLRSLKPLWWIILFTFVIHVFSTPGLFLSVTWEGIVEGFYICLRLVLLILLSSLLTFTTSPLKLTDAMEALLAPHELAMMMTIALRFVPTLIQETDRIMKAQQSRGADGSIMKRLRAFVPVLVPLFLSAFRRADDLAMAMEARCYRGGRTQMKALRVTSIDYVAWGFSAVLIAAVLAL.. 263
47 2.000e-40UniRef50_A0A2E7FSH6 Cobalt ECF transporter T component CbiQ n=11 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E7FSH6_9RHIZ  ali  23  22.........................DPRFRIVAVGGFAIVVISLDSFGALGVALAVALATLIQARLPLARTVQQVATVDTFMVFVIISMPFTIPGTPLSASWEGLWEALRITLKANAVVLAMLTLVGTIGPVELGHALARLKVPHAFVHLLLFTIRYIEVLHAEYGRLRIAMRTRCFAGTNVHTLKTFGYLIGMLLIRALERSERIMAAMRCRGFNGTFPLIHTEQFSPRRDLGFAFGVVALCCALI... 250
48 2.000e-40UniRef50_A0A2A7WLM8 Cobalt ECF transporter T component CbiQ n=34 Tax=Bacillales TaxID=1385 RepID=A0A2A7WLM8_9BACI  ali  25  1........MLLIDKYAYFNRLKHVHPLEKMIFALSLLLFSLAVRDTTVSLITFTVMSAFIIFGAKIPISYYLKLLLLPGFFVLSGTITILFSFGSWQIFISEDSIKTVIGLIVVVLSSISCLYFLTLTTPITVILYVLRKLKLPSLLIDLIELTYRFIFIFLDTAMAIHQSQSSRLGYSSVRKGIRSLGLLISSLFLGVFQRSEQLTMAMNARGYQENISFIDDSYTYSSRNWLITIVTLVSLFFIY... 255
49 3.000e-40UniRef50_A0A124FKD7 Cobalt ABC transport system permease CbiQ n=3 Tax=Thermacetogenium phaeum TaxID=85874 RepID=A0A124FKD7_9THEO  ali  20  5........HIHLDEFAHLQSFFHRFDPRAKIISCLFLLVVAVSLKTPTGLGFTLCGIFLLTFLARLPAGRILMRLGFVIPIVVVLCLFLPFARPGIPLNYTLQGLQASGLFFLRLLCAALIIILVTFTTPFHILLRSLIDLKVPAIFIQLIQFTLRYFFVLYDEVIRMSRARRSRNFRPGNRQTFSTLGGLMGVLFIRSYDRGERIYYAMLARGYRGEVRVLDDLQVSSKDFAIGTALVVYGIVSLII.. 258
50 3.000e-40UniRef50_D6XVS2 Energy-coupling factor transporter transmembrane protein EcfT n=19 Tax=Bacillales TaxID=1385 RepID=ECFT_BACIE  ali  20  1.....MFDSIIIGQYVPGDSVVHRLDPRVKLTAVFIFLVFMFMTRDPLLLTVAVLLSFGGLLASRVPLSFYAKGMRFISIIIVLTFVLHLFMTGGGFATIYSGGLIEGFMLAMKLAMIITIASLLTLTTTPIDLTDGMERMLAPHELALMMSIALRFIPTLIEETRTIVLAQLARGSEGSLWKRLKALIPILVPLFTQSFKRAEELATAMEARGYGGEGRTKYRQLHWGLKDSVVLAVFLLFAAAVM... 261
51 3.000e-40UniRef50_A0A1H6TYP2 Cobalt/nickel transport system permease protein n=11 Tax=Bacteria TaxID=2 RepID=A0A1H6TYP2_9FIRM  ali  21  27.......................LHPVVKLVTTILYILVLVSFPKYVVPCFVMCIYLILLFSLGDLSIRDGIRRMKLILPLVCVVGIFNPFFITRVGGYVLTGGMLSMLSLMMKGIYAVLASYLLIATTSIEDICYALRWFHVPKILVTVILLIDRYFFILGEEAGRMMDAYKLRAPKQNGIH-YKAWGPLVGQWLLRSMDRAEMVYESMSLRGFQGEFRYGKRRHFRWRDFVYLMAWVMVFWLLRF... 254
52 3.000e-40UniRef50_A0A1C7I6N4 Cobalt ECF transporter T component CbiQ n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1C7I6N4_9FIRM  ali  25  1........MITIDKLCYNSKLRYENAGEKFAFAMITLLFCVMSRSIVVACMVLAVTGILTVYKGGIPFSRYXXXXXXXXXXXXXXXXLFAVSMGSWYLTGSVDALLYALQLILTALSAVSCLYFLSMTTPIPDILNVLGKLHCPKLMIELMLLIYRFIFVLLDTAYYISTSQNSRLGNRNYKTSLKSFGALGSVLMIRAVKRSNALYSAMEARCYDGTIHVLNETYPPKKKVIVWIVLFEIILFSITIW. 253
53 4.000e-40UniRef50_B0TC89 Energy-coupling factor transporter transmembrane protein EcfT n=79 Tax=Bacteria TaxID=2 RepID=ECFT_HELMI  ali  17  1.....MLKDITLGQYVPLDSPVHRLDPRTKVIATLLFSIALFLLPTLRSVTLAGLPIIIAIVATRLPIHYILRGIKPLWIFIVFTLLVHLLSTPGGPFAITWEGLRQGAMVSQRLIWLYAATSLLTLTTSPIALTDGLELLLSPHEFAMMTSIALRFIPTLIEETEKIMKAQSSRGADGSLVARVKSLVPLMVPLLLSAFRRADELAMAMEARCYRGEGRTRMRPLVMSGKDYAVTVAVSGVFILICLW. 262
54 5.000e-40UniRef50_D7DQZ8 Cobalt ABC transporter, inner membrane subunit CbiQ n=2 Tax=Methanococcaceae TaxID=2183 RepID=D7DQZ8_METV3  ali  24  1.....MVQKLLIDDIAHSNGLYHINPQLKVIFSMISLFVVLLFNSPTICILMAISMIILTIFKAKVPKGIYFKXXXXXXXXXXXTDVWFSINVGNFSIPLYYEGFNLGYHALFRMFAGVSCTLFLALTTPITQLFTVLKDLKIPQSVIEITMLIYRYIFILIDEALMIENAQKTRFGYSGFKNSYKSMGILAGVMLLRSLDKGDNLYTTMCARGYDGNIHHFGEKQSIAK.................... 235
55 5.000e-40UniRef50_A0A1I5AR99 Cobalt/nickel transport system permease protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1I5AR99_9RHIZ  ali  18  21..........SIGAIFSHRLWIRELDPRVRIVAVFVFSICVVQLDKLLPLGIAFLGGLFLLLQARMPFVTSLKRVLTVDSFIILLLVMLPFTTPGFGFSASYEGLRQAIVILLRANAIVMASLALLATIDAVTFGQALAKLKVPERLVHLLLFTVRYVEVLHAEYLRLKTAMKCRGFPGNNLHTYKSVGYLVGMLLIRSFERSERILMAMKCRGFNGQFHLLKDFDYTRRDLTFSMIACLFVLSLLAL.. 265
56 6.000e-40UniRef50_A0A1E3AEV8 Cobalt transport protein CbiQ n=9 Tax=Clostridiales TaxID=186802 RepID=A0A1E3AEV8_9FIRM  ali  23  9.......ENMKIDYYAYHSGMNGWNTGLKMLLAVGTLCLTIALDKPAVSLFVLLTMSLLTLIKGKIPGKAYLHFLSVPLAFVIMSGAAIALHLFFFYLCFYRSSLLLAGAVFLKAMAGISALYMLSLSTPVNQLVLVLQKLHLPSLLVELMNLIYRYIFILIDAADQMQTAAKARFGYVTFRQSCRSFALVAGNLFLVSLKKAGTYYDALLSRGYEGRLEFLTEETAPAPGQLVFTGVYLLTVIVLGCVL 263
57 6.000e-40UniRef50_UPI000C07D227 energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Anaerococcus sp. Marseille-P3625 TaxID=1977277 RepID=UPI  ali  19  1......MNKISIGQYLPYDTFIHRLDPRVKIIGVFAFIITIFFVDNLINFIPFVILVGLMVHIGKIPIKSVVKSLKPLIFIIVITAVINLFTTPGGPLNITDEGIYRTAFTMLRLILIIISTSILTYTTSPMELTYGLEKLFSPGELAMMISISLRFIPTLFDEANKIKMAQMARGADGNIINRAVSMVPLLVPLFLNSFNRSDELATAMEARLYRGEERTLNEIFMEKTDYLTLFLFLGFCLVIIIL.. 261
58 6.000e-40UniRef50_A0A2N0WZ48 Cobalt ECF transporter T component CbiQ n=14 Tax=Proteobacteria TaxID=1224 RepID=A0A2N0WZ48_9GAMM  ali  22  22...................SWIDAVDARVRILCSAFFALVVVSSPHFLPVLLGLFIALFLVKISRLNIKRALRRVVAMDLFMLTLICVLPFTTPGFGLSASWQGLAHALLITFKANAVLLVLFSLVATMSASTLGHALAHLKVPDKLVHLLLFMVRYLDVISDEYKKMRRAMQARAFMQTNRHTWKSMGYLFGMLLIRSIERAERIANAMKCRGFCGRFYLNDELKLNRIDRQFSAFFICFLVLLIGL.. 257
59 6.000e-40UniRef50_P70972 Energy-coupling factor transporter transmembrane protein EcfT n=950 Tax=Bacteria TaxID=2 RepID=ECFT_BACSU  ali  16  1.....MMDSMIIGKYVPGTSLVHRLDPRTKLITIFLFVCIVFLANNVQTYALLGLFTIGVVSLTRVPFSFLMKGLKPIIWIVLFTFLLHPIIFQIGFFKVYEGGLVQGIFISLRFVYXXXXXXXXXXXXXPIEITDGMEQLLNPHELALMMSISLRFIPTLMEETDKIMKAQMARGVDGPVKERVKAIVPLLVPLFVSAFKRAEELAVAMEARGYQGEGRTKYRKLVWTGKDTSVIVSLIVLAALLFFL. 263
60 6.000e-40UniRef50_A0A1I6WCD8 Energy-coupling factor transporter transmembrane protein EcfT n=21 Tax=Bacillales TaxID=1385 RepID=A0A1I6WCD8_9BACI  ali  17  1......MQQLIIGRYIPGESAIHRLDPRTKLLMVFLYVFVVFLANNAISYGLLFLYALIALFFAKVPIRYILSGLKPILWIFLFTFFLHIFTVQFGWFSIYEKGLEQGIYISIRFLVIILMTTLLTLTDGMETLLHPLKRIKVPHEIALMMSISLRFIPTLMDETSKIMKAQASRGIDGPMKDRVKAIISLLVPLFISAFKRAEDLAIAMEARGYQSNGYRTKFRQLEWKWIDTLTLLSLFGLACILIL. 261
61 8.000e-40UniRef50_A0A174B2H6 Energy-coupling factor transporter transmembrane protein EcfT n=9 Tax=Clostridiales TaxID=186802 RepID=A0A174B2H6_9FIRM  ali  16  1.....MIRDITIGQYYSGNSVIHRMDPRTKLAITFLYAISLFLCKDWIMILAATAFLCIYVAVSRVPITYICRGLKVIWMFILFTAIFSVFLWSWHRLRITDNSVMTTVLVVIRLVYLIIGSSVMTYTTRPMNLANGLEKIKVPSDMAMMLMIALRFIPIFMEELDKIMKAQLSRGADGNIFKRIKSYVPVFVPLFVSAIRRATDLAQAMDARCFDGGRSRMNPLKYSGTDYVSYAIVLVYLGCMIVY.. 262
62 8.000e-40UniRef50_A0A120HPK8 Cobalt ABC transporter, permease protein CbiQ n=41 Tax=Bacillales TaxID=1385 RepID=A0A120HPK8_9BACL  ali  22  1........MIPIDQYAYTNRLSNVHPLEKMVLALSFLLFAVITKDVLISLITFFVMSTFILFAAKIPLSLYCKXXXXXXXXXXXXXXXWSMSFGSVQLFIGKASVDTAFHLFFSVLASISCLYFIALTTPISAITYAMRQLKIPIIFIELCELTYRFIFVFLQSMQAIYEAQQSRLGYQKKRRWFQSVGYLVTAMFKDVFRRSKQLHEAMASRCYNEDISSHYVTYQTERRNWLGIGVSLCLLGAVYL.. 254
63 9.000e-40UniRef50_A0A259UXN4 Energy-coupling factor transporter transmembrane protein EcfT n=3 Tax=Sporomusa TaxID=2375 RepID=A0A259UXN4_9FIRM  ali  19  5..EANWIDLRYLDALASQNFIHRLNPCVKLLATLVFILAVTSFPKYITGLFPFFLFPAVLLAAGNLPTAPILKRLLLVAPFVLFIGIFNPLFDHIGSVMVT-GGWVSFFSITIRLCLTITSALILVATTGIDAIGSALLKLGVPKIIVVQLLFMYRYLHVLVEEFVRSATAYSLRSFHGDGI-RFRAWGSLLGQLLIRSIDRANRIYQSMLCRGFDGEVRLLRASTFTSADAGYFAFWLVFFVLIRLF.. 255
64 1.000e-39UniRef50_A0A2U0RZG8 Cobalt ECF transporter T component CbiQ n=1 Tax=Candidatus Bathyarchaeota archaeon TaxID=2026714 RepID=A0A2U0RZG8_9ARCH  ali  32  32...........IDRYAYTNNLAKTAPATKXXXXXXXXXXXXXXXXXXXXXXXXXXNTILILNYAKIPVKVYGKMLLYPLATALLSCVLIAFFFGWFSLTVFKSGVTMAIATFFRVLGGLSCLYFLVLTTTMTDILITLRRIRVPLILIEMSLLIYRYIFLLLEIATQMNTAQELRLGHSGWKNKIRSTALLAGNLFIRTLEQGERTFTAMSARGYDGEIRTLDDLP........................ 257
65 1.000e-39UniRef50_F8ADK8 Cobalt ABC transporter, inner membrane subunit CbiQ n=3 Tax=Thermodesulfatator TaxID=241192 RepID=F8ADK8_THEID  ali  14  8...............IRKNAFLRTCDPRVKFILALGYAILVALTYNFKFLALASVFSIICLFLSGLPLGYYLKRLGLVNIFLLIVLITLPFTTPGKFLTASKEGLKLALLIFLKSNLIILTTTALLSTSSIFELAHALHHLYLPSKLVQLLFFTFRYLHVIDKEFTRLKEAAALRCFPRTNLFTYRTTAYLVGSLIVRSYDRSQRVYEAMLCRGFSGTFPVYHHFCLRKKDLLFGVFSATYLATILIF.. 247
66 1.000e-39UniRef50_H0UQU3 tRNA pseudouridine synthase A n=1 Tax=Thermanaerovibrio velox DSM 12556 TaxID=926567 RepID=H0UQU3_9BACT  ali  15  2....SFVDKIALGQYVPCESPVHSLDPRVKILSTLILLFSLFGVKDXXXXXXXXXXXXXXXXXXXXSFSMVLRSVRPVLWLLLFTVVLHVFFTPGHWIKVSREGLHMASLMGVRLLLLVAFAGLLTLTTSPMELADGMERLMSPHEMAMMMTIALRFIPTLLEETDRILKAQVSRGADGSIVRRLRAFVPVLVPLFIIVFQRAEDLALAMESRCYGGGAR.............................. 234
67 1.000e-39UniRef50_A0A1G3LFE1 Cobalt ECF transporter T component CbiQ n=1 Tax=Spirochaetes bacterium GWB1_27_13 TaxID=1802173 RepID=A0A1G3LFE1_9SPIR  ali  22  1........MIYFDKYSYFTKLKNTHPAEKFVFSVGSIIIASFSKSIVLSFCVFFTVSLLIVFFAKIKLTVYLKSLSVPLYFLVPSCIVLAFSLPFLNLAISHKSLINSIFLLFKSLSIVSLLYFLILTTSLTEILNIFTKLKFPKLLIEIASLTYRFIFILLDCANNIYISQNSRCGYGTIKNSFKSLGYLITNLFSISLQKSNLIYNSLESRCYNGEFNFLQKKYLFSLKN.................. 233
68 1.000e-39UniRef50_B3QW25 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) TaxID=517418 RepID=  ali  29  1........MFNLDNQAYLSRLREIDPMQKMLFALPALAICLWASKPAISLVVLGVMAVGSVQIGKTSVRIFLKXXXXXXXXXXXTFIASIMLYRGVHVGISEIGLSKAVEVFFKALGAVSCLYFLALSTPMIDLLNALRKLRVPKLLCELMSLIYRFTFLFLETAEIISTAQNARLGNATLKSRFRSFGTLVSRLFVRAYSASEALYTGLEARGYQGDLRTVSHEYRTPWQGYAISLVTHTLLIALTV.. 254
69 1.000e-39UniRef50_A0A0N0HGI2 Energy-coupling factor transporter transmembrane protein EcfT n=7 Tax=Bacillales TaxID=1385 RepID=A0A0N0HGI2_THEVU  ali  20  1......MTPVVIGQYVPVDSFLHRLDPRGKLVFVFAFMFLVLFAERWPSYLLLTLFVLLSVKGARIPLALFLRAVKPVLFLIILTSLLHLFTTKGGGFSVHEAGVEQAVLMSLRLFVLMAMATLLTCTTSPMEITNAIEQLLRPHELAMMMSIALRFIPTLWGETEKIKKAQMARGVDGSLLRRIMNHIPILIPLLISSFRRAEDLAMAMEARGYRGEGRTRWRELVFARRDLWLIPTAATLWLALWYL. 262
70 1.000e-39UniRef50_G7V834 Cobalt ABC transporter, inner membrane subunit CbiQ n=3 Tax=Synergistales TaxID=649776 RepID=G7V834_THELD  ali  19  16.................GSSYLHLMDPRLKVLASFILALSVALTRDWGSLVLLLGLSTLLVFWSRIPLTKVIRRLAAFDSVLIILWLTLPFSAGGGGVSIYAEGIKLALAITLRSNAAFLGFLALLGTTPIHENLKALRALGIPHKLVLLLHFTYRYGHVLMQEAIKVQQAMALRGFQPGFLFTMKTYGNFVGVIFLKAFKRAERVTQAMVLRGFEGTFPELAAPKRMSFKEVASCAVLCLLFWGCTLV. 253
71 2.000e-39UniRef50_A0A231VLS8 Cobalt ECF transporter T component CbiQ n=2 Tax=Thermoanaerobacterium thermosaccharolyticum TaxID=1517 RepID=A0A231VLS8_THETR  ali  26  1.........MPIDNYSYTNRMYNVHPVEKLLFAFLTMILCFVF-DIYTNIAVIILMFMITVLKAKIPGKVYXXXXXXXXXXXXXSAALISLNIFGVTLGITPKGISTAVTLFFRTLAVVSCLYFLVLTTPVVDIIDILKKLKIPSLFLELLQLTYRLIFVLFDTAGEIYTSQNSRLGYATLENSYRSLGLLISSLFIKSYKDSQDLYVALEARCYNRGLKVISKDYRFCYRNLIFIVLIELVLISTSILL 253
72 2.000e-39UniRef50_D2RNY0 Energy-coupling factor transporter transmembrane protein EcfT n=178 Tax=Firmicutes TaxID=1239 RepID=ECFT_ACIFV  ali  14  1.....MLTDITLGQYYPGNSCIHRLDPRTKILAVLFYMVMVFLANSPLSYGILIGFIVLGAALAKLPAGLLLRSIKPLWIIILLTMVIHFVTWHWKFITVTREGIVLGVKMSLRLVLLLLVSSLMTFTTSPIVLTDGIESLLRPHELAMMMTIALRFIPTLLEETDRIMKAQMSRGADGNIMKRAKNMLPILIPLFISSFRRADELALAMEARCYRGEGRTRMHELVYGKAD.................. 245
73 2.000e-39UniRef50_UPI0006B690BE cobalt ECF transporter T component CbiQ n=1 Tax=Niameybacter massiliensis TaxID=1658108 RepID=UPI0006B690BE  ali  18  15..ESALQELYRMDRLTHRNHWMQLHPVVKLIVTIGYMISVVSTPKYLVRLIYFMSYPVVMFALSQLSLWKAIKRMKLVFPFLLIMGIFNPFFGQVGHIVITL-GMVSMLTLMLKGLLCIVASYLLIATTSIEAIGYGLYRLKVPSIIVTQFLMTYRYINVLLKEMKCMSESYAMRAPRQKGIH-FRVWGVFCGQLLIQTIDRAEQVYESMTLRGYQGQYDPIEERHYLKRDVLYLVVCLSEFFILW.... 263
74 3.000e-39UniRef50_UPI0006861433 cobalt ECF transporter T component CbiQ n=1 Tax=Oscillibacter ruminantium TaxID=1263547 RepID=UPI0006861433  ali  18  1.....MRSFCSLEQLAEGDSFHRLSPGAKLTITVVYAVCVISFPRSLSALVPFAAYPILAMALSGTPWKTLLQRIAVAAPFVVFTALSNLLLYFLGPIPVS-GGLLSCLSILIKAFLCVSAVLLLVSTTSMTALTAQLIELHVPKIFCLQLTLTYRYISVLIQQAQQMYTAYQLRSCSRRGI-QMRDMGCFLGQLLLRSYDQASRIYCAMKCRGYDGTYHVRNQPPAAAKDILTAGGAAAFFF....... 243
75 3.000e-39UniRef50_A0A261G1Z3 ABC transporter, ATP binding protein n=2 Tax=Bifidobacterium aquikefiri TaxID=1653207 RepID=A0A261G1Z3_9BIFI  ali  15  568..............IAKKSSWIHLLDPRVKMVSALVMMFTAFAIHSLWQLAWAAVVVCGIVGMSRLGIRHVLQTVKILLAMLVVMGVLNLLLFQWGIVMVTDAGIMSAVLYTCRFALVVMLGAVVMQTTTPTEMTDSMESLLSPQELALVMSLALRFIPTLTREARQIIDAQAARGGSGSPIERVKALASIVVPVFAGALRHADNVSLALDARCYEGGGRTHFRMLKTHKKDY................. 805
76 3.000e-39UniRef50_UPI00030543E3 cobalt ECF transporter T component CbiQ n=1 Tax=Clostridium tunisiense TaxID=219748 RepID=UPI00030543E3  ali  20  6...NSFYNLRALEELSEKNTIHRINPTVKILTTLVFLFVTVSFSKYISAMLPLIFYPIISGSVGEVPVKELMKRTLITMPLVIGIGILNPFFVSLFTLNIT-AGWISFVSILIRGFLAIMAAQLLIATTGIINISRGLKRLRVPNIFIMQLIFTYRYISLFMEEIGRTTRAYSFRS-YEGKGISFNHWGSLVGGLLLRTLDRAERIHKAMLARGFQGEYRIGKEFKIEKKDLIYLILWCGYFILVRRY.. 255
77 3.000e-39UniRef50_A0A0Q8PU10 Cobalt ABC transporter permease n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q8PU10_9ACTN  ali  24  10.............HFHGHSPVHRAPAHLKILALLAFVLVVVATPREWLAYAGYLAVLVVVIGVSRVPFLYLLPRMVIEVPFLVFAALIPFVLVGGWELSLSESGLVAAWGLAAKGTLGVLASLTLAATTEPSAVLRGLQRLHLPELLVQIMGFMVRYLDVVSADLGRMITAMRSRGVDPRSPRHWPALARTLGALFVRSYERGERVHLAMLARGYDGTLP.............................. 226
78 3.000e-39UniRef50_H0UG54 Energy-coupling factor transporter transmembrane protein EcfT n=21 Tax=Firmicutes TaxID=1239 RepID=H0UG54_BRELA  ali  20  2....SMLQNFAIGQYIPGDSFVHRLDPRSKFLFIIVFAMVVFMANKAEIYGFLVAILLLCLFMSKLSLSYILRGLKPVWFLLLLTVILQLVYVRWGWFSIEEEGVRQALFVSMRLGLLVVISSLLTLTTSPIDLTDGLKKWGLPHEMALMLSIAIRFIPTLLEETDKIMKAQMARGANGTLLSRAKAMVAIVIPLFISAFRRAEDLALAMEARGYRGDI............................... 234
79 3.000e-39UniRef50_U2CEG2 Cobalt ABC transporter, permease protein CbiQ n=4 Tax=Clostridiales TaxID=186802 RepID=U2CEG2_9CLOT  ali  24  1.........MKIDYYAYRSGMRCWNAGLKMFLAVMTLCLVIAFDKPAVSIYVILTMGALTLMKGKIPWKAYIHFMTVPLAFMVFSGAAIAVEFGFFWICFYQENLILAGRVFLKAMAGMSALYMISLATPVSELVLVLQRLHLPRLLVELMNLIYRYIFILIDVSEQMQIAAKARLGCHSFRQSCKSFAQIAGNLFLVSLKKANAYYDALLSRGYDGKLEFLSEENP....................... 230
80 3.000e-39UniRef50_A0A1V5DSF3 Nickel transport protein NikQ n=27 Tax=root TaxID=1 RepID=A0A1V5DSF3_9DELT  ali  17  4..DSQYYNVGYLDRLSYQDTFVHRLDPRTKLITTLLFLFTVISFSKYAALFPFLLFPAIFLTVGEIPPGFILKKVLLVSPFAIFIGIFNPLLDHGXXXXXXXXXXXXXXXXXXKFFLTVSMALLLIATTSFPTICHALRRLGLPSIFVSQLLFLYRYIFVLGEEVMRIVRARDMRS-YGRKGTEIKVFVRIAGVLFLRTVERAERIYFAMLARGYEGDMPVSKKYHLTTSDLAFALSVIVCLFIFRCY.. 254
81 3.000e-39UniRef50_G4Q8X3 Energy-coupling factor transporter transmembrane protein EcfT n=29 Tax=Bacteria TaxID=2 RepID=G4Q8X3_ACIIR  ali  15  1.....MLTEITLGQYYPGSSPIHHLDPRTKILGVLFYMVMVFLASDPLGYGLLIAFLVLAAGLAKLPPGLLLKSIKPLWVIILLTLLIHFFTWHWKFLSLTKEGIIMGVKMSLRLVLLLLVSSLMTFTTSPIVLTDGIESLLRPHELAMMMTIALRFIPTLLEETDRIMKAQMSRGADGNLVQRAKNLLPILIPLFISSFRRADELALAMEARCYGGEGRTRMHELVYGKRD.................. 245
82 3.000e-39UniRef50_S0J6I7 Cobalt ABC transporter, permease CbiQ n=1 Tax=Eubacterium sp. 14-2 TaxID=1235790 RepID=S0J6I7_9FIRM  ali  23  15..........SMDYYASQSGICHWNDSYKVISACSILLLCILLNQPVVSITVIFTMGFVNIKANGVSFSDYTGFLKIPVAFLILGSAAIAISLNWFYVYTTGKRIKEAAELFLKAMGAVSAMYFLALSTPANELTGVLKKAHVPRIIVELMDMIYRFIFILTEVQGRMKTAAASRLGYVDFKTSCYSFGQTGGNLFLISLKKANACYDAMISRGYEGELPFWEEEKQLKLWQIGLLLVYEISLIMLSVFL 266
83 5.000e-39UniRef50_UPI00030C6BBD energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Firmicutes TaxID=1239 RepID=UPI00030C6BBD  ali  18  1......MNKITIGQYLPYDTFVHRLDPRVKIISVFAYXXXXXXXXXXXXXXXXXXXXAAMLYTAKIPFKSIIRSLKPLLFIILITAIINLFTSPGGPFTITDQGIYKTAFTVLRLILIIISTSVLTYTTSPMELTYGLEKLFGPGELAMMISISIRFIPTLFEEAQKIQMAQKARGADGNIINRAKNMIPLLVPLFINSFKRSDDLATAMEARMYREERTRLNDIAMTRVDY.................. 245
84 5.000e-39UniRef50_D1B5U2 Energy-coupling factor transporter transmembrane protein EcfT n=10 Tax=Synergistaceae TaxID=649777 RepID=ECFT_THEAS  ali  18  2....SISEKVTLGQYVPADSPVHSLDPRTKILSTLVLLFALFGVRDPRFFLGWGVLLAFIVFLSRVSLRTVLRSVRPVLWLLVFTVLLHALFTPGHFIKVSREGLHMAALMGVRLVLLVAFAGLLTLTTSPMELADGMESLMSPHEMAMMMTIALRFIPTLLEETDRILKAQISRGADGGVVKRLRAFVPVLVPLFLIVFQRAEDLALAMESRCYVGGRTRMRPLRWCLEDWVALGLMSVSVAGLLFL.. 264
85 5.000e-39UniRef50_A0A1Z5HVN6 Cobalt ABC transporter permease n=1 Tax=Calderihabitans maritimus TaxID=1246530 RepID=A0A1Z5HVN6_9THEO  ali  26  1........MFKIDQYAYANKLLSVHPGEKFAFALITMAVGLIFDTINTSMIIIIMMSGATIILAGVRWRLYVKXXXXXXXXXXXXXVVSGFTVGRFLVGVQPGDLYLALRLFFKALGAVSCLYFLALTTPMTDIIIILRKLKAPPLFVELMSLIYRFIFVLLETAGRIHLSQASRCGYFSFASTYRSLGALLSNLFIRTYWRSRISFTALLSRGYTGSINVLEPRYSVSYKNILAIAAVEALLIVLGL.. 253
86 6.000e-39UniRef50_A0A2H6GN55 Nickel transport protein NikQ n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6GN55_9BACT  ali  18  1.........MHLEEFAVGRSVWHRMDPRVKIAGVTAFAVVTAVSSGMWALVFAFTLSMGALAAARLEIRQVVIRLSVVNGFVLFLWLFLPFTTPWGWLTVHRAGLLLAVSITLKANAIAAATIALLGTSTVFDLVHGMVHLRMPSKLVQLFFFTYRYLSVIHREYLRLRAGMRVRCFHGTNLHTYRSYAYLMGMLFVRSFDRSERIYHAMILRGFSGTFWTLNHFRMRRSDWVALGLMALGIGVEIGL.. 246
87 6.000e-39UniRef50_A0A174WVR6 Cobalt ABC transporter permease CbiQ n=18 Tax=Clostridiales TaxID=186802 RepID=A0A174WVR6_9FIRM  ali  28  4............DRYAYQSRLRRISPMPKLLLTGSALVLCLLCDSVTVGLVTLLGMWGLVTALGGLSPRVFLRFLCIPMAFLAVGCVTILINSYPQGWGFDGAALLRAGRLFCKALGAVGAMYFLALNTPVTDVTMALERLHVPHLMVELMELIYRFIFVLTETASRIRLAQESRLGYQGLRRSLSSLGTLASMVFLRAWRKADRVYTALESRGYSGSLVTLS........................... 227
88 7.000e-39UniRef50_A0A1G9V8K8 Energy-coupling factor transporter transmembrane protein EcfT n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1G9V8K8_9FIRM  ali  18  1.....MLKDITLGQYYPGKSVVHRIDPRMKIILTTAYXXXXXXXXXXXXXXXXXXXXAVGYGAAKIPLRLMFKSLKPVLPIILFTAILNIFFIDWWIFKITQEGLLLAAVMAARILCLIAGTSLLTYTTSPIVLTDGLEQLMAPHELAMMMTIALRFIPTLIEETDKIMSAQKARGADGGLIKRAKALIPILIPLFVSAFRRADELALAMECRCYRGG................................ 230
89 7.000e-39UniRef50_D8F1I2 Cobalt ABC transporter, permease protein CbiQ n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=D8F1I2_9DELT  ali  18  3............ESFALGNSLVHRLDPRFKIVMATLYAFAVALSNRFPALFLGLAFSFVLMGISRLPLWEVVKRVALVNGFVLFFWFVIPFTYPGGPLTATRDGVLICARITLKSNXXXXXXXXXXXXXXXXXXXXXXGNLGVPEKMVHLLLLNYRYIFVMEEEYHRLVRSLTVRGFQPSTRHTYKTFAYLVGMLFVRASERAERVYMAMLCRGFCGKFHSLHEFDRSRGDLFWLCCTMTIIAGILIL.. 245
90 7.000e-39UniRef50_R7XZR6 Cobalt ABC transporter, inner membrane subunit n=9 Tax=Actinobacteria TaxID=201174 RepID=R7XZR6_9ACTN  ali  25  10.............HFHAHSPIHRAPAHLKIVALVVFMLVVVATPRQYAVFAVEAAALVGVVLLSRVPAPYLAKRMVIEVPFAVFAVLVPFVAYGPLGVSVSEPGLLAAGALLIKGTLGVLASLTLAATTEPQDVLRGLERLRMPDLIVQIMGFMIRYLDVVTAELARMMVAMRSRGCEPRSPKHWPTLARAMGSLFIRSYERGERVHLAMLSRGYDGRLP.............................. 221
91 8.000e-39UniRef50_A0A1G2X5M1 Cobalt ECF transporter T component CbiQ n=5 Tax=Planctomycetes TaxID=203682 RepID=A0A1G2X5M1_9BACT  ali  17  3................RTNSLLENLDPRSKIISFLAIIFCMILTTRLKDFGLYFLVILVMAFISRIPPRQLLKRVCVLIPFILFIAMFVPFVKQGWELGVTYEGIWTFLNIVIKSSLSVLLLVIASSTTTFSDFLKGLDLLRIPQLMIMITSFMYRYIFVLFDEAKRLMRARSIRYFGSRYKEQFRVIGYMIGVLFIRTYERAERIYNAMIVRGFNGKAISINHLR........................ 224
92 8.000e-39UniRef50_A0A1M4XCX8 Cobalt/nickel transport system permease protein n=2 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1M4XCX8_9FIRM  ali  37  1........MFRIDQYAYTSRLRHVHPGEKFAFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVPARFYFRXXXXXXXXXXXXXAVYGLVIGGVTLGVTGPALNQAALIFTKSLGAVSCLYFLSLTTPMVEIISILHRLRVPALLVEMMGLIYRFIFVIMETAGMMYVSQGSRCGYAGIRTSFRSMAQLVANLFARSYHRSRALYTALLARGYTGEIRMWEEPRPVSAKHLVLIA............. 242
93 9.000e-39UniRef50_D5WWA8 Cobalt transport protein n=13 Tax=Bacillales TaxID=1385 RepID=D5WWA8_KYRT2  ali  25  1MSSFELTRYVTIGQYIPADSAVHRLDPRVKIILFAMLVLTAAFASTYTGNVVMAAACLLVLIVSRVPVGYGLSGLRPALPFVVVLFILQVLFWQAGWFSVTADGLKIAVVAVMRFLEILCLVSVLTLTTTVNDLARGLARIRFPHEVTLILTITVRFVPTFAMEMEKLVKAQASRGADFGHFRWWKQTFPVIIPLFVSAMHRAEDLITAMEARGYVGARRTTYTEYRMQARDGVAAVLVVAFCAAMWLI. 274
94 9.000e-39UniRef50_A0A0L6JQ99 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 TaxID=398512 R  ali  26  1........MINIDKYAYNSKLKKVSVIRKLLFSLFXXXXXXXXXXXXXXXXXXXXXXXXXXKKGEVPLGFILKLMLVPFVFLLMSTLAITISIAGLQIGATIEGIKDALNIFFKALGTISCLYFLSLSTPMLELMAVLRKLKVPKLLIELMGLTYRFIFILLETAENIFVSQRARLGYEGLSSGFRSVKILFSSLFIRSFKRSDEIYRSLEARGYDGELNFLEEEIRFCCKDVINPAMFAFLMVLLTLSL 259
95 9.000e-39UniRef50_A0A1M6QEA4 Cobalt/nickel transport system permease protein n=1 Tax=Hathewaya proteolytica DSM 3090 TaxID=1121331 RepID=A0A1M6QEA4_9CLOT  ali  23  29........IIFMDMYAQKSNMRDVNSQLKLVSSMLLLIYCVSVDXXXXXXXXXXXXXXXXXXXXKIPRGYYFNLIKLPIAFILISCITIIFKIGTVFLCVTKTGLLESLKLFFKAYGAVTCLYFLSLTTPMQDIIESLKKIHLPTVVIELMYLIYRYIFLLQDVQNAMTTSAMCRLGYDGGKNAWYTFTHISGNVLVNSFKRSRDSFNAMEARCYEGDLCFLSEEHKVKNKHLLFVLVYAICIILCTIFL 282
96 1.000e-38UniRef50_UPI000B4B5AD4 cobalt ECF transporter T component CbiQ n=1 Tax=Kineosporia sp. A_224 TaxID=1962180 RepID=UPI000B4B5AD4  ali  21  422..................SPVHRLSPQSKLAATVLFVFVVVATPRAXXXXXXXXXXXXXXXXXXXXPAGLVLRRMVVEVPFVLFAVLMPFLSVDVLGVSLSVGGLWSAWNVLAKATLGVVCSILLAATTDLRALLVGLERLKMPSLLVQIMSFMVRYGDVIGDEMHRMRIARESRGFTGGDLRALPVVARSAGALFIRSYERGERVHLAMLSRGYTGTLPLQGEATTAAQWRTALVLPAGALVVAL.... 654
97 1.000e-38UniRef50_A0A087CGV6 ABC transporter, ATP binding protein n=3 Tax=Bifidobacterium psychraerophilum TaxID=218140 RepID=A0A087CGV6_9BIFI  ali  18  545.................RQSLMTRLDPRAKMLGTLAMMLTAFFITSPAQLALGAVMTLAVTLASRIPPLRILRSVRVFLMMFVIMGILNLFLFSWGPFTLSSGGLWSAVLYSCRFAFVIILGAVVLQTTTPTQMTDAFESLLRPHEISLVMSLALRFIPILTKEASSVMDAQAARGGSGSPMQRMRAATAIIVPVFAGTLRHADNLGLALDARCYEGGAHRTHFRLLRMSRWDAYFAIPVLCYLFALLLI 795
98 1.000e-38UniRef50_B8D0U1 Energy-coupling factor transporter transmembrane protein EcfT n=25 Tax=Firmicutes TaxID=1239 RepID=B8D0U1_HALOH  ali  16  1.....MLTDITIGQYIPGNTIVHNLDPRIKIIISIILITALFFIKSFTGFLYFLLYITFIIFLAKLPVKRIIKGLKPILFLVILTLLLHVLFWQWWVIRIDEHGLFTGLFMASRILLLIAFTSLLTLTTSPLQLTDGIEYLLSPNELAMMMTIALRFIPTLMEEAEKIMKAQKARGADGSIVQRARNLIPLLVPLFISAFRRADDLALAMESRCYRGEGRTRLHELQIQRRDIFSLIMSTIIAIFISFF. 263
99 2.000e-38UniRef50_UPI0009FE63F4 cobalt ECF transporter T component CbiQ n=1 Tax=Desulfovibrio bastinii TaxID=47157 RepID=UPI0009FE63F4  ali  17  3..............................IVCAFLFSVAGAIASNINSGLSILISGILFVILARLDFWLLLRRLLAVNFFIAFLWIFIPFSFKIYGLTATREGVELALIITLKSNGIVLALTSFLATMPVQTLGAGMQCLHLPDSFCRLFSFTYRYVHVIREEYTRLHRAAVMRGFAGNNLRTYRTYAWLVGMLLVRSFDRAHRVWQAMLCRGFNGRFHTLRKFRLCSADWMLLGFVVCVSLGAVFL.. 227
100 2.000e-38UniRef50_R7BRL2 Cobalt transport protein n=7 Tax=Bacteria TaxID=2 RepID=R7BRL2_9FIRM  ali  17  1.....MFKDVSFGQYYPTNSPVHRLDARVKLLLTLMYVIGIFFVKSYFGFMLTAVVLIAIIMLAKLPMASVLKSVKGVLFIVLFTAILNLFLIHWQIFTITKTGVHTTIKMVLRLVLLISGASLLSLTTTPVELADGVESLMSPRDIAMIMSIALRFIPTLFEETNKIISAQKARGASGGLFSRAKALLPVLIPLFVNSFRRADELAFAMDARCYNAEKRTKMKQAKLGVGDLIATVFMCAFFVVILL.. 262
101 2.000e-38UniRef50_A0A261FHR0 Cobalt ABC transporter n=2 Tax=Bifidobacterium TaxID=1678 RepID=A0A261FHR0_9BIFI  ali  15  653................RRHSPIHRLDPRVKMVGFLAAMFTMFAVNTPVQLALGVTLTLAVMLFARLNPIRVLASIHPILALLILMSLCNLILVAWGPFSITDQGVTIAVLYACRFALVIILGAVFLATTTPTAMTDAFEALLRPQEIALVMSLALRFIPTLTDETRSIVDAQAARGGSGSLTQRIKAMSAIIVPVFAGTLRHADNLSLALDARCYEEGITHWRVFAPGPKDAIFAVAVIGYIAAIVAL.. 904
102 2.000e-38UniRef50_A0A1M7LWX7 Cobalt/nickel transport system permease protein n=5 Tax=Halanaerobium congolense TaxID=54121 RepID=A0A1M7LWX7_9FIRM  ali  17  4............EKLAAGSSWIHKLDPRAKLVVGLFFSFLIALSNELKTLSLFFALAVILIISIEIDFKYLLKRXXXXXXXXXXXXXXXXXXXXGWQFSVSREGLFYALKITLRSNSIILLVISLLSTSPVLDLIHAMSRLRIPPKLIYLLFFVYRYLYVIKKEFNTIHQAMLLRGFKATNLHTYRSYAYLIAMLLIKSYERSQKVYQAMICRGFKGDFVMIDHFKFKQKDYLFIIVSSLFLIFLLAI.. 246
103 2.000e-38UniRef50_A0A1C5YV60 Energy-coupling factor transporter transmembrane protein CbiQ n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C5YV60_9CLOT  ali  28  9.........RSVDHLAYCSGMNDWNPGFKVVLSLGTLAICLAADRAVVSLAVIAVLAWLQNVRGGVRLSAYIGLLRAPLVFLLLGGLAWSLPLPGFYLCTDWDRARFACGLVLKALGAVSAMYLLALTTTACELVSVLHRVRLPSLLTELMYLTYRFIFVLLDTYGRMYDAAAARLGWRDFRTSCRSFGGTAANLLVVALRRSRNYSNAMAARGYDGALHFLEEKKPLRRAQVAWTLVFWTALLAMRL.. 259
104 2.000e-38UniRef50_A0A2V8TSM9 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8TSM9_9BACT  ali  24  130..EHLVLHHVVVERWSRRSSPLHARDARAKLGALLAFLVAISTTPPARAFVAYSALLAVAIVSARLPFQGLLGRAALVLPLSATFAAVTWWSGDP----------ARAIALAVKSFISGLAALLLVATTPLTQLLNALESLGVPRPLILVVQFLYRYLFVISEQAQHMRLAARCRGLGLDRRSRFYAAAGALGVLFARSWERADGIYRAMLARGFSGRFSPLAPARFGARDFAFLCAAVAASTAIRL... 367
105 2.000e-38UniRef50_A0A0C7P2F3 ABC-type cobalt transport protein, permease component n=23 Tax=Thermotogae TaxID=200918 RepID=A0A0C7P2F3_9BACT  ali  18  2.....LSDNIALGRYVEKDSFMHSLDPRVKLLGLFVLAGFAFSINSFFDVSLMFGYTLILMILSGLSLAYYLKSLKSVLFIVAFAFVIQLFTFQIGFIRISDLGLFNAFIISFRIIFAVLLSSVLTLTTSPTSLAHALRWFFIPQKFAMVMTIAIRFIPVIANEADRIMKAQLSRGADRKFSGKVKGAISIIVPLLVSALRRAEDLSIAMEARGYNGGRTRFKQFKWKLKDTLFLISFIVLCFVIIFV.. 263
106 2.000e-38UniRef50_UPI000486E25F energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Lachnospiraceae bacterium P6B14 TaxID=1410631 RepID=UPI0  ali  20  1.....MIRNMTIGMYYPVDSPIHRLDPRVKLIAVLVFLVSLFLFSDFMGYAVVSVVLLTVIFLSKVPLSHILKGMRAIVFLLIFTSFFNIFFWEWQFIHITYQGLRQALFMAMRLIYLVIGSSMLTYTTTPGKLTDAIESLRVPHDFAMMMSLALRFIPLLLAEANRILDAQSARGADGGIVKKLRTMVSIIVPLLVSATRRAYELGLAMEARCYGGKPTKLKPLRFRFSDFLMLPLMVAYVIAILYV.. 262
107 2.000e-38UniRef50_A0A2U3L977 Cobalt ABC transporter, inner membrane subunit CbiQ n=2 Tax=Syntrophobacter sp. SbD1 TaxID=2043167 RepID=A0A2U3L977_9DELT  ali  21  8..DSSFFDIGRLDALSKDSPVHRIDPRLKVLTTLYFIAIAISFDKYPAGPVPLLVYPMTLMIIGEIPFSYIAKKLLIASPFVLSVALFNPILLNLGPISVS-GGLVSFASIMTKYVLTVSAVLALIACTGLDSICSALARMGVPKAFTIQLLFLYRYIFVLGEEAARMTRARALRSF-GGKGLGMSVYSSMIGHLLLRTVDRAQRIHLAMLCRGFDGEIRHGEPSKIRLSDLLFLAGWCALFTLLRLY.. 258
108 3.000e-38UniRef50_G7WA74 Cobalt ABC transporter, permease protein CbiQ n=22 Tax=Firmicutes TaxID=1239 RepID=G7WA74_DESOD  ali  18  6...NSLYNMRLLDDLAQGTGIHKLHPLMKLLTTVIYLTVVVSFGRYEIGLLPLLLFPIMIFTLAELPVKPILLRILIVSPFILGIGILNPLFDQQSIIIGGREGWITFISILLKSGLTVTAALLLIATTGMDRLAGALRMLKVPRLFVLQLLLTYRYISVLMEEVARTLRAYSLRAPEQKGVHK-SAWGSLAGQLILRTFDRAQRIYEAMCLRGFDGEYHTGEVKGIRGWDWLYFISWVSFFLLARMY.. 254
109 3.000e-38UniRef50_N1ZRN0 Cobalt ABC transporter, permease CbiQ n=1 Tax=Eubacterium plexicaudatum ASF492 TaxID=1235802 RepID=N1ZRN0_9FIRM  ali  16  5..DSSLCDIHYMDVIVERNRWLHIYPLIKLVVTICFITTTISFSKYDLAGILMGVYPIIVFVLGEVSFQDALRKLRVILPVVCLIGIFNPFFLEIAGVTVTT-GMVSMFTLMVKGIYSVLASYLLIATTPIEKICHALRLLRVPVVIVTQILLTYRYIRLLMNEARHTIQAYSLRAPNQKGLH-FKVWGSLVGQLLLKSIDRADGVYESMLLRGYNGEFYYDTRISCRAKDYAYLATWCTVFYCLRVII. 256
110 3.000e-38UniRef50_A0A1F1LN03 Energy-coupling factor transporter transmembrane protein EcfT n=11 Tax=Lactobacillales TaxID=186826 RepID=A0A1F1LN03_9LACT  ali  16  1.....MLDKMLLGRYINMDSWVHRLDPRTKLLASFYXXXXXXXXXXXXXXXXXXXXTLLAIKLTGLSFKFFINGVKPMIWLILFTVVFQILFWQWGPFVLSTGGLESGAFIFMRLVLIIMMSTILTLTTAPLELTDGIEHLLRPHELALMLAIALRYVPTLMDEAQKIMNAQRSRGVQGSLMQRMKAVVPILVPLFISAFNRAEEMATAMEARGYRGEGRTKYRQLAYSPAD.................. 246
111 4.000e-38UniRef50_C8W4G7 Cobalt ABC transporter, inner membrane subunit CbiQ n=3 Tax=Desulfotomaculum TaxID=1562 RepID=C8W4G7_DESAS  ali  18  11..................NSPLYKVDARAKVVAILIFIAFTSTLRALPVLGAAAVFMLSLAAAAKITPGIILKXXXXXXXXXXXXXAVFQLNFGLFILTATDQGISHAVMLSLRVFVAVMAVTLLVSTTKFNEITRALISLKVPTIFVELIEFTIRYIFVLTDEVARMKTARRARNFQNGGRHTFKTLGNSVAVLFIRSYERGERIYNAMLARCYAGHVRTNEQLSMRTADWCWSLSIAAAGLCLRLV.. 254
112 4.000e-38UniRef50_A0A1G1DWL7 Cobalt ECF transporter T component CbiQ n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_12_39_16 TaxID=1801690 RepID=A0A1G1DWL7_9BACT :  ali  22  1......MKHAFLDKYSSIESPIHRLDPSVKIISFLWIIVISVTSKNFNHFGIYLSVVFTLIFLSKVPISFILSR----------SAXXXXXXXXXXXXXXXXXXXXXAWNVVIKSYIGVLCLILLSSTTPFPALLNGFRRLKVPNIFILLTSFTYRYLFVLLDEVMRIRQACDSRCFKGRWIWHAKTIGNMIGVLFVRSYERGERVYMAMASRGFEGNLKVARYQ......................... 211
113 4.000e-38UniRef50_A0A174L6P1 Energy-coupling factor transporter transmembrane protein CbiQ n=3 Tax=Clostridiales TaxID=186802 RepID=A0A174L6P1_9FIRM  ali  26  1........MIVVDKLCYRSRLRYVNAGEKFAFSMITLLFCVVSRSLIVAGVVFAVNTYLTVKKGRIAAGQYGKXXXXXXXXXXXXXXXXAIPVGSFFITGSYHSLLFGIQLIATAMASVSCLYFLSLNTTMTDILDVLAKLHCPEILTELMLLIYRFIFVLMETASAMMVSQKSRLGNKDLRTSVSSFGKMGAGLLLRAFKRSNALYDAMESRCYDGRIRVLAEHHPARKKEVAAIAVFELILLALTIW. 253
114 6.000e-38UniRef50_D3ERJ1 Energy-coupling factor transporter transmembrane protein EcfT n=387 Tax=root TaxID=1 RepID=ECFT_STAA4  ali  17  1.....MKNKLIIGRYLPINSFVHHLDPRAKLMFVFLFIILIFFCHSPLTYLWVFALILFIMRLAKIQLWFLIKGLTPIFFFLIFTLMMHIFLVEWHGITIETNGILEGLYISLRLIGIVMIATIMTLSTSPIDLTDAFERLLAPHQLSMIMSIALRFIPTLMDELDKIILAQKSRGSEGNIATRIKSFIPLLVPLFISAFQRAEELAVAMEVRGYDANVKRTSYRQLKWQLRDTISLTMIIPIAIILFVL 263
115 7.000e-38UniRef50_A0A0B5QJN4 Energy-coupling factor transporter transmembrane protein EcfT n=20 Tax=Firmicutes TaxID=1239 RepID=A0A0B5QJN4_CLOBE  ali  16  1.....MLKNITIGQYLPGESFVHKLDPRTKILISILFIACLFIINKXXXXXXXXXXXXXXXXXXXXPFRFIFNGLKPIFLLIVLTAALNIFVFSIGFLKAYPEGLSIAAFMAIRLILLIVGTSLLTLTTSPIELTDGIEKLLRPHELAMMMTIALRFIPTLIDETDKIMKAQKARGADGGIIKKAKSLVPLLVPLFISSFRRADELAMAMEARGYRGG................................ 231
116 7.000e-38UniRef50_A0A127AKL2 Cobalt ABC transporter CbiQ, permease subunit n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A127AKL2_9DELT  ali  16  4............EKFSKGNSSIHKLDPRVKIITFSFFSVVVATSYKFPVIFISFLYPLSLILVSKVNLKEVLKXXXXXXXXXXXXXXXXXXXXDLGPLTVFKDRIEYVALITLKSNIIILSMITLIATSSVFSIVHALHHLHIPDKLVHLTFFTFRYTHVLYKEYKKLTNAMKLRGFPGTNIHTYRSYAYLIGNLILRSFDRAEMVWKAMVCRGFKGTFPLLYHFKMEGKDRVFLVLSLIYICFLATL.. 246
117 7.000e-38UniRef50_A0A1M7G553 Cobalt/nickel transport system permease protein n=1 Tax=Anaerosporobacter mobilis DSM 15930 TaxID=1120996 RepID=A0A1M7G553_9FIRM  ali  27  1........MIMMDKWAYSSKLRERNPYSKLLFGVGNLLICVLCRXXXXXXXXXXXXXXXXXXXXKMPFRAYLRLLCIPLIFLVISTITVIFEVGGGHIYMTKWSLTRGIQLFLSSFASVTCLYFLAVTTPVIDMIQVLRSLHLPKIVIELMYLIYRFIFLLLETGNAIVVAQDCRLGYKDRKTSVQSTSKMAAVLFVRAYQKADALFCSMESRGYDGDLCVLSTERPRVPEVIVMLAITLLEGIVCYYFL 255
118 7.000e-38UniRef50_I9AR73 Cobalt ABC transporter, inner membrane subunit CbiQ n=3 Tax=Pelosinus TaxID=365348 RepID=I9AR73_9FIRM  ali  15  5..ESTWLDLRTIDDLAQKTFIHSLNSCTKLITTLVFVVLVTSFSKYVTSLFPLLFYPVALMSLGNLPYKPIVKRLILIAPFIVFIGLFNPVFDQLGSFLIT-GGWLSFLSITIKLLLTVTSALILVATTGMNSICTAMSQIGVPKPIVIQILFLYRYLHVLLEEFLKTNQAYNLRSFKTAGIH-YKAWGSLLGQLLLRTMDRAQRIYQAMLCRGFDGKVPLRSAARWTKKD................... 238
119 9.000e-38UniRef50_U2K5D1 Cobalt ABC transporter, permease protein CbiQ n=2 Tax=Ruminococcus callidus TaxID=40519 RepID=U2K5D1_9FIRM  ali  27  1.......................................................MLTAMTAIGKTRWHHVIHLMQIPLAFVVLGCIMILLQIGSWYFGITGESLHQFGQVFLQCLAAVSCLYFLSATTPMTELFTALRRLHLPAFLVEMMELVYRYIFVLMESASQIRNAQECRLGYGSLKTSFYSMGQLVSNLFLRAYRQADRTYTAMESRGYTDEVRTLGLTYETTGWQKGLAVGYSVLLTGAVLF. 207
120 1.000e-37UniRef50_A0A1G7RKN6 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Facklamia miroungae TaxID=120956 RepID=A0A1G7RKN6_9LACT  ali  19  1.....MNDKILIGRYIQIDSWVHSLDPRTKLIATFYFILLVFFANNILGYGTLFLVLLFGIKLSRLDLKFFFKGLKXXXXXXXXXXXXXXXYFNWGPISITSLGLLGGFYIFMRLFLIIMMSTILTLTTAPLELTDGIEHLLRPHEVALMLSIALRYVPTLLDEAQTIMNAQRSRGVEGSMMDRMKAIVPILVPLFVSAFNRAEELATAMESRGYHG................................. 230
121 1.000e-37UniRef50_A0A0T5X8V4 Cobalt ABC transporter, permease protein CbiQ n=3 Tax=Acetomicrobium TaxID=49894 RepID=A0A0T5X8V4_9BACT  ali  21  1.....MINVSYINYHSPKGSFLERIPPYVKLLLTFSVALCVALLNSLMAQIFLLMYSIALVGLSGVPVKRLLKRLMAVDGFVLMLWLTLPFS--------SEGGVATATLITIRIHAAVLAFMALLQTTSMPEILQALCQLRFPSKLVALLHFTYRYIHVLAEEASRIHRSMALRGFEPSLLRTFRAYGYLIGMLLLRSFVRSQRVYNAMLLRGFNGTYTFLTFKSRLSRPDFLKLAVLYALLVGCLMV. 238
122 1.000e-37UniRef50_UPI000B34B897 cobalt ECF transporter T component CbiQ n=1 Tax=Intestinibacillus massiliensis TaxID=1871029 RepID=UPI000B34B897  ali  23  1........MIGTDKYSYQSRLKTVDPTAKIVLTASSMVLCLGTNXXXXXXXXXXXXXXXXXXXXXTAVNTFLRLMRAPLFFLLVGTVTVIFSIGDWIYGLSIASLFRGVRLVARAMGCVASVYFTVLSTPITDLMLAFRRMHLPQLFLSLMELIYRFIFLLYETAQRIHTAQASRLGYNGLKRSYESLGMLISMVFMKAYRKSDKIYTSLEARGYTGELCTLAPLYESGRRMYWVCAGLTAVQLALFLI. 254
123 1.000e-37UniRef50_A0A1F4MQC3 Cobalt ECF transporter T component CbiQ n=1 Tax=Caldithrix sp. RBG_13_44_9 TaxID=1797576 RepID=A0A1F4MQC3_9BACT  ali  19  1......MKHEFLDHHREGNSLVHLFDPRLKLLMMMVFIIMVVTVSYERWLLFYLVIPIAFAGLSRISILHFLSKLFKLYPMIFLITILIPFFPQFFGIAISISGLQKFFLINAKSILVLFISIVLTITTDFMMLLKGLEKLRVPPIMTAIVSFMYRFIFLLIDEVERMLMAYQSRYLRLSLGKRLKIIANMIGMLFIRTYERGERIYLAMESRGFQGTIHTLNDLRWKKTD................... 234
124 1.000e-37UniRef50_A0A2N6R7Q5 Energy-coupling factor transporter transmembrane protein EcfT n=3 Tax=Bacillus TaxID=55087 RepID=A0A2N6R7Q5_9BACI  ali  16  1.....MMNSMIIGKYVPGDSPVHRMDPRAKLLMIFAFVFIVFLANNLFTYLLLGIYTLAIVFMTKLPVRFLIKGLKPVLWIILFTFFLHLFLLDLGFLKIYEEGLFQGIYISLRFLFXXXXXXXXXXXXXPIEITDGMESLLGPHELALMMSISLRFIPTLMEETDKILKAQMARGVDGPIKDRFKAIVPLLVPLFISAFKRAEELATAMEARGYRGG................................ 231
125 1.000e-37UniRef50_H6LFU6 Cobalt/nickel ABC transport system substrate binding protein CbiQ2 n=3 Tax=Clostridiales TaxID=186802 RepID=H6LFU6_ACEWD  ali  16  5..TDSMNTINSLEEMAEGNTIHHLHPMVKLITTILYLVLVISFDPYITGLMVFAFYPVILMALSEIPYKPLLKRMLVALPFSFFAGLSNIIFDQIGTIPVSY-GVISFTTIIVKTVFTVMAVLILIATTSLPQISYQLLAIKVPKIIVEQIMLTYRYISVLLEQVSNMYTAYILRAPDAKGIK-MKDMGIFVGQLLLKSFDRAENIYYAMKCRGYDGNYLYAKPNKINQIDWTYLLVVGVVLLLMRFF.. 255
126 2.000e-37UniRef50_A0A1M4N9F0 Energy-coupling factor transporter transmembrane protein CbiQ n=2 Tax=Clostridium TaxID=1485 RepID=A0A1M4N9F0_9CLOT  ali  27  1........MISMDKYAYSSKLRCIQPMEKLIFSLLTLVVGLWADNVXXXXXXXXXXXXXXXXXXXXPIKKYFKXXXXXXXXXXXXXFFWFFRVGKFFIGCSKSGFFKALHLIFKVISSVSCLYFISLSTPFIDLLSTLRKLKAPKLILEMTALTYKFIFIIMNTAEIIFIAQNSRLGYINLSTAYQSLGTLISTLFIRSYKRAKELYIALESRGYDGELNVLDEEYKSSKKLYFY............... 240
127 2.000e-37UniRef50_I3VYN5 Cobalt ABC transporter, inner membrane subunit CbiQ n=13 Tax=Thermoanaerobacterales TaxID=68295 RepID=I3VYN5_THESW  ali  25  1.........MEIDSYSYINRMSKIHPVEKLLFAIMTMLLCFWFDRY-TNLLVVFMMFIIIVYIAKIPYKVYXXXXXXXXXXXXXSVAIISIKVFGAFIGITSDGINTAFNLTSRTLALVSCLYFLTLTTPITDIVDVLEKIKIPMLFLELIQITYRLIFVLLNAAKEIYISQDSRLGYSKVKNGYRSLGFLISSLFVKSYRDSQNLYLALEARGYKGDLKVISKKQKINIRN.................. 235
128 2.000e-37UniRef50_U2EC39 Energy-coupling factor transporter transmembrane protein EcfT n=2 Tax=Bacteria TaxID=2 RepID=U2EC39_9BACT  ali  17  1.....MLDNIKLGQYLQGDSWFYRLDPRIKIIGTFTFIVIIFLAKDWT-YGIITLFSLIVILTSGISLKFFYRSIRPIFFLMLFTFVLNLFFIKEGDVLVTEGALTRGAQIILRLILIVSFTSLLTFTTKPTDLTVGLESVFSPAELALMISISLRFIPTLLEETQKIMKAQTSRGADGKLKEKVLQIVSLLVPMFIISFKRAEDLANAMEARGYGKERTRLNQLKLKLRDYLYLTSFLVVTALLVLYRL 265
129 2.000e-37UniRef50_F1TB72 Cobalt transport protein n=1 Tax=[Clostridium] papyrosolvens DSM 2782 TaxID=588581 RepID=F1TB72_9FIRM  ali  17  1.....MSKGLTFGRFYPSISVLHQLDPRVKLISTLMFLVELFVFNSLTCYIMSTVFLAVIIAAAKIPLKFILRGSKFILVVILFTSTVNLFIIDGGKLHITNKGLNTAILISVRLMYIYISSSIMMITTSPNNLTDGMDKLLEPHDLSMITSITLRFIPVLSDEATKIIKAQTARGVNKNIIKRIRNYIPIMIPMFVSSFRRSNELAMAMESRGYRGDNGRSKMRPLCYQKNDIIAYFILLFFLVAQIV. 261
130 2.000e-37UniRef50_A0A222FBE9 Cobalt ECF transporter T component CbiQ n=6 Tax=Rhodobacterales TaxID=204455 RepID=A0A222FBE9_9RHOB  ali  17  18...............ARSSRTLDGLDPRSRVLAAICFAIVIVSLKSLPVLALGFGLSIAVLLATRLPLKATLRRMAAMDGFILVMLALLPFTVPGFGFGFSMEGLLRAVEIALKANAVILMLMVLVGTLEPVTLGHALHRLKTPETLVHLLMFTVRYISVLHQEYLRLRSAMKVRSFWRNSLHTYKSIGYLVGMMLVRSIDRSERILSAMKCRGFNGTIPLLDAMRFTGRDAWFAGLVLMAVATLLVL.. 257
131 2.000e-37UniRef50_A0A249LL05 Cobalt/nickel transport system permease protein n=11 Tax=Candidatus Planktophila TaxID=622681 RepID=A0A249LL05_9ACTN  ali  18  6..............YLHRHSVTHSLPSHVKILTVLVFISVSVATTRWPAFIAFFSLLIFTAVMSKIPILLLFKRALIEIPFVFFAILMPFFKFSIFGVMVYRDGLLAGTSIVVKGTLGVLAAVILSTTTTAREILRGLEKLKLPMIMVQIASFMLRYINVISDEMERMKVARESRGFIATGIKHWKVLATAAAALFIRSYERGERVHLAMLSRGFDGALPSLDSHSVTTREWF................. 230
132 2.000e-37UniRef50_A0A0J1L0F0 Cobalt ABC transporter ATP-binding protein n=11 Tax=Bacteria TaxID=2 RepID=A0A0J1L0F0_BACCI  ali  16  1......MNKLILGRYFPGESWLHQLDARAKMISVXXXXXXXXXXXXXXXXXXXXXXTLFIMHLSQVPFRTYVRGVKPMIWLILFTVILQVLFTSWGPITISEYGLINGIFIFSRFVLIVFLSTVLTLTTKPIDLTDGINKLLSPLRFIIMLSISLRFIPNLLDETQKVMDAQKARGGQGSLFQQMKTLVPIFLPLFVSSLNRAEDMANMMDVKGYRSGIKRSAFRRIYWQKQDTWCLCSVCFIGVITVLL 262
133 2.000e-37UniRef50_E3I4Y3 Cobalt ABC transporter, inner membrane subunit CbiQ n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=E3I4Y3_RHOVT  ali  20  31................QRNFVQSVDPGLRLLVCAVFCLVVVSL-KSLTALSLALGIATLAVAAARQSPGTALRRMAALDGFMLMVLAMLPFSTPGAGLPASREGALLGAMILLKANAVVLMILALLSSMEPALLGRAMNRLRLPSKFVLLFLFTLRYIDVLGREYRRLRVAMKARGFRMRDLHTWRSIGYLVGMLLVRSIERSERIVAAMRCRGFNGTFPALSENAPLSLRDGAFAGLSLGVCLGLALV. 269
134 2.000e-37UniRef50_A0A1J5NAQ5 Nickel transport protein NikQ n=12 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1J5NAQ5_9DELT  ali  20  8..............FASGDSFLHGMDPRIRLLAALVLTVPVAVLPEPRPAWLALAAGLILVKMARLNMLVVLNRXXXXXXXXXXXXXXXXXXFDLGPLHATAQGIDRALLITVKSNAVVVSLMALLGTISIQNLGPAMQQLGVPDKLCHILLFTHRYIFSIYQEYTTMRQAMRARGFKRTDTHTYRTFAWLVGMLLVKSWDRAERVHGAMLCRGFRGRFYSLAAFRTRPADYLFLLACAALSASLIYM.. 248
135 2.000e-37UniRef50_A3TL68 Putative integral membrane transport protein n=12 Tax=Actinobacteria TaxID=201174 RepID=A3TL68_9MICO  ali  25  13.................GDSVVHRLPAHVKLVGLVTFVLLVVARDAHVARLVMLAVAAAVVVTTRVPLRHVAARLVVETPFVVFALVLPFVATGPGPFTVSRDGVEASIALLLTATTSVLMAVAFATTTSSRDLVRALQHLRLPDRLVQILAFMVRYLGVVGSQAQRMKVARESRAFTARSVRSWPVIASSAGALFIRSYERGERVHLAMMSRGYNGRMPVTDPLHAHRGDWSRGLVPATLALVALI... 248
136 3.000e-37UniRef50_A0A2A4RZD2 Cobalt ECF transporter T component CbiQ n=7 Tax=Bacteria TaxID=2 RepID=A0A2A4RZD2_9GAMM  ali  20  3.........LDIDRFAKRASALQRWDPRVKLFTLGIFVFSVALLKTLPIACVAFCLAVGILRLSNLPYDFVASSVKWVIFFLLPFFFIMPLSYPGIGLPFAWEGLQLATLIFIKAVAIILTTFSMFGTARFDVSMIALQHLKCPKILVQMLLFTYRYTFVFLEEMRRMQIAMRARGFMKTDMKTMQTMGNFVGTLLVRSFERSERVYKAMLSKGYQGELHTMVKFSSERRDYIKSILILSTSVMILAL.. 248
137 3.000e-37UniRef50_A0A1G1DFN2 Cobalt ECF transporter T component CbiQ n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_02_39_17 TaxID=1801684 RepID=A0A1G1DFN2_9BACT :  ali  17  1.....MIDPSYIDRYSNIDAIYQKLDARVKLLITIIFIIVVFVGDNPLRIIPFFIFIVILSAMSKLSPKVLFRRSLPAFPFLFFASLTLWFSKGNHP----------AISVFLKGLVSVLSVIILVSTTNFSNLLRGLEGLKTPSLIVSMLSFVYRYVFIITDEYSHIKIARESRNFGGSKRWQWKTIGYSMGSLFLHSYERGNWVYSAMAARGYNGNIRV............................. 208
138 3.000e-37UniRef50_A0A011NWX8 Energy-coupling factor transporter transmembrane protein NikQ n=16 Tax=Bacteria TaxID=2 RepID=A0A011NWX8_9PROT  ali  21  5..DASSSHLSYLDSLAYRDSPIHRLDPRVKLITTLLFIVCVFAKYEVSALLPFAIYPLILLALARLPPGYILRHLLLAVPFALCIGLFNPLFLHVGSIGIS-GGWISFASIMLRFALTVSAALILVASTGFDSLCLALARLGVPRPFVVQLLLLYRYLFVLVDEAMRLSRARAQRSFGRRGME-LSVVASLLAQLLLRTLDRAQRIYLAMQCRGFDGEVRLLRPLRIGGRDVAFLTGWTAVLLGLRFL.. 255
139 4.000e-37UniRef50_I4C1I5 Cobalt ABC transporter, permease protein CbiQ n=12 Tax=root TaxID=1 RepID=I4C1I5_DESTA  ali  14  1.........MELEEFALGDSWVHNLDPRAKILVTFIFSVVVALNQHLPGTALSLVLPLILLACARVSFGKVLSRXXXXXXXXXXXXXXXXXXXXGGPLTVQSEGILAALLITLKSNSIILMVIALLGTSSIFTLVHALSHLWVPDKLVHLFFFCFRYIHVIHEEYHRLVNAMKMRGFKPTDMHTYRAYAYLVGMLLVRSFDRSKRILQSMRCRGFRGKFYILHHYEMKRSDYALAGTSVVFSVLLLA... 245
140 4.000e-37UniRef50_W4BBA2 Cobalt transport protein n=9 Tax=Paenibacillus TaxID=44249 RepID=W4BBA2_9BACL  ali  17  2....SLSQSFIIGQYVHRNSIIHRLDPRAKLVIAFLFMLSVMLLNSWLSYVLSAVFVVCVVTISQIPPSYIVRGLKPVWLIVIVTSVFHIFLTQGGQLSIYEEGVIKAGNIAIRIILLLVMASLLTLTTKLGDLAQAIERLGVPQEFALMISWTIRFIPILLNETDNVMKAQRARGVRGNIVRRLQSFIPIVVPILLLAFQKAESASLAVEARGYSPGMNRTQLRTLAFKKLDYQVLIISIFCFALLLAL 265
141 4.000e-37UniRef50_A0A0S8I928 Uncharacterized protein n=1 Tax=Anaerolineae bacterium SM23_ 63 TaxID=1703387 RepID=A0A0S8I928_9CHLR  ali  22  1......MHYDLSDQYHHRSSPIHHLDPRVKVVVTFFYILALSLTXXXXXXXXXXXXXXXXXXXXXXDLTFTIKRSFIVLPFVLAAVALPLLKIPGLGWTVTEPGMIRFLSILARSWQAVQAAILLTATTRFPDLLWALSALRFPKPLVSTIGFMYRYLFIVADEALRMIRARTARSARPSIRWHGRVAGSMVGSLFLRTLARSERVYAAMIARGYDGHMRSLIRFRMTNIDWIASVLTVLLL........ 251
142 4.000e-37UniRef50_A0A2M7PA59 Cobalt ECF transporter T component CbiQ n=9 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2M7PA59_9DELT  ali  17  5..............FATGDSLMHRLDPRVRILAALAYSIPXXXXXXXXXXXXXXXXXXXXXXXXXXQVKALFKRLIVVNSIILLFWIVVPFTFDGGPLAATREGIIYAASVTIKSNAIFLAFLALVATMPVAAAGHAMQGLGFPVKVVTLLLLTYRYVFVIEEEYNRLLRAIRIRGFKRTSLHTYRTYAYLIGMLFVRSWDRAERVHQAMKCRGFEGKFYCLTQYRVSLEDIFFSVAMSVGVCAI..... 242
143 4.000e-37UniRef50_A0A2N6C8P0 Cobalt ECF transporter T component CbiQ n=1 Tax=Desulfobulbaceae bacterium TaxID=2053307 RepID=A0A2N6C8P0_9DELT  ali  18  57...........LDDCSDLDSVFHKWDPRLKIFSILVYCFLVAALTKIIWAFCALIISLAAVKLAKIPFRNTKRRXXXXXXXXXXXXXXLLLFFQPIPVPFNVRGLLVAIRIILKAFAIALIMEPLLNTAPLPVTIQALRHLRVPDMICQMILLSHRYIFVFLNEANRMYTGMRVRGFRKTNLATLHTMGNFLGMLFVSSFNRTQRVYEAMLSRGYNGTFPVYTDFFARPKDWLFGIAWI........... 296
144 4.000e-37UniRef50_A0A1F2PE69 Putative HMP/thiamine permease protein YkoC n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1F2PE69_9FIRM  ali  17  5..TDSMNTISSLEEMADGNTIIHRHPMVKLITTMLYLVLVISFNPYITGLMVFAFYPVILMALAEIPYKPLLKRLLVALPFSFFAGLSNIIFLMIGPMPISY-GVLSFISIMVKTIFTVMAVMILIATTSLPKISYQLLSIKVPKIIVEQIMLTYRYISVLLEQVSNMYTAYILR-APAAKGIKMKDMGVFVGQLLLKSFDRAESIYVAMKCRGYDGNYLYAKPSPIQKGDWLFLVLASGILCLMRFF.. 255
145 4.000e-37UniRef50_D9RZP4 Energy-coupling factor transporter transmembrane protein EcfT n=164 Tax=root TaxID=1 RepID=ECFT_THEOJ  ali  16  1......MREITIGQYIPGNSVIHRLDPRTKILITTAFMVLLFVIDDXXXXXXXXXXXXXXXXXXXXXXKYMMRGLRPLVIIIVLTFVLNLFMIKGGPLDITYEGLYQGTFMVLRLIMLIVGTSLLTLTTSPIALTDGIESLLKPHELAMMMTIALRFIPTLMEETDKIMKAQMARGADGNVVQRARSLVPLLVPLFINAFRRADDLAMAMESRCYRGNRTRMKQLRMTSADLAAFIATGLLAVGSIM... 260
146 5.000e-37UniRef50_UPI000B988DF0 cobalt ECF transporter T component CbiQ n=1 Tax=Clostridiales bacterium SK-Y3 TaxID=1792311 RepID=UPI000B988DF0  ali  28  1........MIYIDKYAYVNKL-KASPMEKFTFAFLTMAICLLSKSITVSLITIFVPALIVIFKAKIPAGFYIKXXXXXXXXXXXXXIIVSHNFFRYNIGITYESMETAMRLVFKSLGAVSCLYFLALTTPMIQLISVLRKLKCPVILLELMGLIYKFTFVMLETANRIYISQDARLGYCSVKRGYHSFAQLISALFIRSLYRSQALYTSLESRGYDGALNVLEPRYK....................... 231
147 5.000e-37UniRef50_W6S0B7 Cobalt ABC transporter permease CbiQ n=1 Tax=Clostridium bornimense TaxID=1216932 RepID=W6S0B7_9CLOT  ali  20  1MRTHKHNGINSIDYYSYISKINHWNPSFKIILGFSSLLICIIADSILISVYITIAMTFISIYKGKINIRNYLSLLKIPLTFMILSTIAITLSFSFFYLHSSNASILVAIKIIIKAFGAISSMYMVTLSTSTIEIISFLRRAHIPSIIIELMNMIYRFIFVLMDIHSKMKTSAKSRLGYVDFKTSCLSFGRTAGNLLILSIKKANGYYDAIESRCYNGEMLFLEEAKPLK..................... 241
148 5.000e-37UniRef50_A0A1G1J513 Cobalt ECF transporter T component CbiQ n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1J513_9BACT  ali  17  1......MHHPYIDKYAELDSPIHRIDPRVKIICAILIILGIIFPTSAVSFICYGIFLSILVILSRIPVSXXXXXXXXXXXXXXXXXXXXAYSFGTLKLTVTYNGLVILLNVLVKSYLSVLCMTVFTASLKFSVLLKAFERLKFPNLLIMIFSFMYRYIFVVIDELMHVKQAKDSRTVGGGRLSHTKTLANVLGVLFVRSYERAESVYIAMRSRGFNGTINTLYDFRLRVAD................... 237
149 6.000e-37UniRef50_I8R1W4 Cobalt ABC transporter, permease protein CbiQ n=1 Tax=Thermoanaerobacter siderophilus SR4 TaxID=880478 RepID=I8R1W4_9THEO  ali  15  116..QSVFEDMFYSDAISVKKGIMQSLDTRIKLISIFVLLIIVNFGKTIPFMTIFLIYTFLLAYFSKIPLKAYVVRVSAVSIFFTGIVLIQPLVYFTKNFYITKEGLESAIVFMMRSFISLSFVYILALSTKWVEILKALRVFKLPHIFTATLEMALRYIFLLLEIAINMFLARKSRNGKSDSSEGRKFVASAMANVLIRSQQLSDDVYNAMVSRGYKGEYKTITTFKITFYDYIWIGFNITFLSILWYI.. 372
150 6.000e-37UniRef50_Q3A9U8 Cobalt ABC transporter, permease protein n=4 Tax=Carboxydothermus TaxID=129957 RepID=Q3A9U8_CARHZ  ali  15  1.....MLNVNTIGQYIPGNSFIHRLDPRTKFFSLLVAVFLVFFLDXXXXXXXXXXXXXXXXXXXXXKPKMFWQALKPVVFILVLALILQLFFTPGGPLKITREGLVNSGIVFLRLVVMLLSAYLLTATTSPTELTNGLESLLKPGEIALMLTIALRFIPTLTAEAERLIKAQESRGADRGFSNKAKMMLPLIIPLFINAFKRADELAVAMEARGYRIGAPRLKPLKFAAKDY.................. 246
151 6.000e-37UniRef50_A0A090JYN3 Cobalt ABC transporter permease protein CbiQ3 n=10 Tax=Methanobacteriales TaxID=2158 RepID=A0A090JYN3_METFO  ali  16  1.....MKGLTEIDREARKESFMNNLDGRIKLISAMLIIVYAVTNTNLLILSIMEVYLLFLIYLSNVSPGYALKRIALVIPFGGFVALIQPFFQPGGILHMTDYGLFFGVLLLFRVTVSVTSIVFLSSSTSMQDLVASAQKLGVPHQLAMLLNLTVRYLFFFYEQLMNILNAQSTRCFDIPYKWRLKKVGETITMMFLRAYEQGETVYMSMMCRGYSENTRIYRAKAQLDKKDFAFIGTTIFILLSLQL.. 256
152 7.000e-37UniRef50_A0A1X7DGH9 Cobalt/nickel transport system permease protein n=2 Tax=Desulfovibrio TaxID=872 RepID=A0A1X7DGH9_9DELT  ali  21  57...............................................................ARLPMLSLMKRLLYVNGFIFFLWLFLPFSFTVGPFTASAEGVLYAAIITLKSNGIVLAATALISTMPVQLMGAGMQSLKLPDKLCRLFLFTWRYVHVMGEEYEKMKRAAVMRGFPRNSMRTYRTYAWLLGMLLVRSWDRAQVVWQAMLCRGFTGKFYTLNVFKVRRSDWLLFGMTVLLATAAIVF.. 248
153 7.000e-37UniRef50_A0A143PD92 Energy-coupling factor transporter transmembrane protein EcfT n=9 Tax=Staphylococcus TaxID=1279 RepID=A0A143PD92_9STAP  ali  15  1.....MKNKFIIGRYLPLDSMIHNLDPRAKLSFVFFYIILVFFCHNFAMYGWMLLILLILMYCSKIKLFYLLKGLTPILFFLIFTFLMHLFLFQWKFISIETGGIIEGIYICCRLMFIMMISTIMTLTTSPIALTDAFDKILAPQQLSMMMSIALRFIPTLMEELDKIILAQKSRGSEGTIGQRIKAFIPLLIPLFISAFQRAEDLAIAMEVRGYDAKRTSYRKLKWHWKDTLLIFLLIPIAVVLFAL.. 263
154 8.000e-37UniRef50_A0A1E7IRC8 Cobalt ECF transporter T component CbiQ n=7 Tax=root TaxID=1 RepID=A0A1E7IRC8_9DELT  ali  19  1.........MIIEEVAGGDSLLKRLDPRVKIAVALFFSVVVAVSNRFLVLGSALAVSLGIVLTARIPEREIIRRXXXXXXXXXXXXXXXXXLFSFGLLVGTVEGVLYAVRISIKSNAIMLMLIALVASTPIFTLGHAMHELRIPKKLVHLFFFTYRYLHVMHREYVRLVNSMKARGFPGTNLHTYKTFAYMVGILLVKSFDRAQRVHNAMLCRGFKGNLYSLSELSIKKVD................... 229
155 8.000e-37UniRef50_A0A1F6Q480 Cobalt ECF transporter T component CbiQ n=5 Tax=root TaxID=1 RepID=A0A1F6Q480_9BACT  ali  21  1........MLNIDKCAYSNNLINVHPMEKFIFVMVTIIVCLSSNSIITPILILLTVSSLTILKAGVPAKFYFKXXXXXXXXXXXXXXXXXXXXPALSFSITQQSIETASKLFFRALGSASCLYFFSLTTPLVDFTSVLKKLKLPDXXXXXXXXXXXXXXXXXXXXGRIHTAQSSRLGYSSLKNQFRSLSQLVSSMFILSYKKANDLFISLESRCYNGNLNILEKQYCFSAKNIVFIIVIELFFILM.... 241
156 8.000e-37UniRef50_C7HSK7 Cobalt transport protein n=15 Tax=Tissierellia TaxID=1737404 RepID=C7HSK7_9FIRM  ali  18  1......MSNIAIGQYLPYDTFIHRLDPRVKLIASLXXXXXXXXXXXXXXXXXXXXXXXXXVSIGKIPVKSLIKSIKPLIWILLITGLINLFTTSGFSLTATYEGLYKTIFMFVRIIMIVVSTSVLTFTTSPMELTDGLEKLLGPGELAMMVSISLRFIPTLFEEAQRIKMAQMARGADGNIINRAKNMIPLLVPLFINSFKRSDDLATAMEARLYRRERTRLNEIKMTKTDSLVLILFILFCSVVII... 260
157 8.000e-37UniRef50_C0ZIL1 Energy-coupling factor transporter transmembrane protein EcfT n=19 Tax=Bacilli TaxID=91061 RepID=ECFT_BREBN  ali  16  1.....MLQNIAIGQYVPGQSFLHRADPRSKLLFIILFATLIFLANNTVTYAILIGFTLYAALLSRLSLSYILKSLKPVWILILFTVVLHIFYFQWGWFTVEEQGVRQAIFISLRLGLLILISSLLTLTTSPIDLTEGLERLLGPHDIALMMSIALRFIPTLMEETDKIIKAQTARGANGSLVRRAKNLIPIAIPLFVSAFRRAEELALAMEARGYRGGVGRTRLNKLT...................... 241
158 9.000e-37UniRef50_UPI0009D73240 cobalt ECF transporter T component CbiQ n=1 Tax=Leptolinea tardivitalis TaxID=229920 RepID=UPI0009D73240  ali  15  19........NNLLEQYRDRNSLIHVHARVKIIFTLVFILAVLTXXXXXXXXXXXXXXXXXXXXXXRLGIRYVLKRSLFALPFILSAIPLHIWLLNRVQVPFSLVGLERCISITLKAWLSVQAAIVLTGTTPFSSIIEGFRQIHVPLILISIIELMWRYLFVIVDEVTRMMRARTSRSSGGSVLWRAQVTGNMAGSLFLRSIERSERVYAAMLSRGYTGEPLSVSSTNLSKKDQWITVFSCMMILAVFIFSL 279
159 1.000e-36UniRef50_A0A2N6DEZ5 Cobalt ECF transporter T component CbiQ n=2 Tax=Denitrovibrio TaxID=117999 RepID=A0A2N6DEZ5_9BACT  ali  18  5..EKQFIQISYMDELAEKSPLHRLHPLSKLLTSIIFIVFIVSFNRYSVTLLPFFIFPALLIVIGELPAGYLGKTLLIVSPFALMVGFGNIFIASHFGMKIT-GGYISFASIMLKFTLSVLCVLILICTTGFYRVCGALGSLYVPDIFVNQLMFLYRYIFVLSEEAGRMFMAKDIR--QCGRKTGVKIYSSIFGQLLLRTIDRAGRMHQAMYSRGFNGNLNIEQRGGFAVKDWAFVFLWCTVFVVF..... 251
160 1.000e-36UniRef50_A0A1C6B6K7 Energy-coupling factor transporter transmembrane protein CbiQ n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1C6B6K7_9CLOT  ali  25  1.........MIIDKLAYNSKLRNIAPISKLLFSMSVLVICIWANXXXXXXXXXXXXXXXXXXXXKTSYKNXXXXXXXXXXXXXXXXMLFSLHFGNTYFGVSHTSLLSAVRVMIKCFGAVSCMYFLSLTTPMVDLFTLLRKSIIPNFIIEIAELIYRYIFVLFDVSHRIHTAQDARLGYSNLRVSYHSTAQLASNLFIRSFNQAEKTYTAMESRGYDGEINVIMPKINHSVKFNVFAVIYVVITTAIAIF. 253
161 1.000e-36UniRef50_A0A1V5E2E9 Nickel transport protein NikQ n=1 Tax=Syntrophaceae bacterium PtaU1.Bin231 TaxID=1811718 RepID=A0A1V5E2E9_9DELT  ali  23  1......MNHAYIDEYSRIDSFINRLDPRIKIVSLLAFVLFVISSKPXXXXXXXXXXXXXXXXXXXXXXRFFLKRXXXXXXXXXXXXXXXXVLSGPFQAVGSHEGWILFRTVVIKAVLSLLCITLFITGTPFPELLQGLERMKIPRLITMILSFMYRYIFLIQDEAMRMWRAKKSRSAGASAWLDLKATANLIGVLFIRSFERAETVYLSMCSRGFDGTIRSAERLRLKRRDLVFLCAMLICLI....... 248
162 1.000e-36UniRef50_A0A2C1KFZ0 Cobalt ECF transporter T component CbiQ n=2 Tax=Bacillaceae TaxID=186817 RepID=A0A2C1KFZ0_9BACI  ali  24  1........MLKIDQYAYINGLKHVHPAEKVAFAFVFLLFTIITKNKSIACLTFFIMSISVVLAAKIPLSQYIKXXXXXXPISSMADPLWQIEIGSWSIYTSLANLKQAFDLGTTVIASISCLYFLILTTSINQILWVLKQLRLPILFIELVGMTYRFIFVLLDKTHEIFLAQSSRLGYQNHKDWITSVAQLIVSLFIKSSQSAKELQTAIESRGGEEGLYDIEIGIAINRSRCAGILVVVVGLLTFSIL. 256
163 1.000e-36UniRef50_UPI0008F85A2F cobalt ECF transporter T component CbiQ n=1 Tax=Ruminococcaceae bacterium Marseille-P2935 TaxID=1852383 RepID=UPI0008F85A2F :_  ali  21  1........MIWMDRLADDSRLKGLSPAIKGVLSMFTLLLCLGVDSTPFSLLVLLIGTISCTAGAGLSVKYYVKXXXXXXXXXXXXXXFFSLPVLGYYLCISKAAIWQAAGLFLKSLACVSCVYFFYVSTPMPQVFGLLQRMHLPAILIEMMMMIYRFIFILLRIAEDMSISQKSRLGNQTFGSSFRSLSILASSVFVKALQKSTDVLNAMESRGYDGAIRYNTGLQKSLPQYWAVTAGYCMFLVLLVLLI 254
164 1.000e-36UniRef50_A0A1V5T5L1 Energy-coupling factor transporter transmembrane protein EcfT n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5T5L1_9BACT  ali  18  6.........IAIGQFIPIESPVHRLDPRVKILVSAILIVALFIVKEWLSFLFIGCFIILLTITARIPISYIGKSLKPILFLLAFTLVLQVFFTPGGFLHVSREGLIRGLFIIVRLCLLILCTALLTLTTSPVELTDGLESLMSPHELAMMMTIAIRFIPTLMEEADRIIKAQQARGADGSLIQRAKNLIPLLVPLFINSFKRADDLAIAMESRCYRGGI............................... 232
165 1.000e-36UniRef50_A0A255I9B2 Cobalt ECF transporter T component CbiQ n=2 Tax=Peptostreptococcaceae TaxID=186804 RepID=A0A255I9B2_9FIRM  ali  17  5..TDSIYKIKSIDTLGKKDTIHRINPLSKLIVTIIYILTILSFNKYVINILPLILYQIVIICLGDVPFSLIIKLTLVGIPFIFGIGIFNVIFFRLGKLIIT-AGLISFISIIIKGILTITSGVLLICTTCIEDLAKSLRRIGIPKIFVSQILFTYRYIYVLIENAEQIYNAYMLR-APKQKGVNFRIWGSLLGQLLLRSFDRAQRIYNAMSIRGFDGEFHTDNARKFKMKDFIYILLWSIFFILSC.... 253
166 1.000e-36UniRef50_A0A2V9J7U7 Cobalt ECF transporter T component CbiQ n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9J7U7_9BACT  ali  25  86.......RHNFIDRYANLDSPLHVLEARTKILGYLSLIAALLLMRNDXXXXXXXXXXXXXXXXXXXXXGYIAGRSLVILPFVLLAGIAAPWTNSFDG--------ARFMALATRSFLSVTILLLMTSTTPFPELLRGLQKLGCPRILILNLGFLYRYLFVLTEEVLRMRQARDCRAGRAPPRVELKLLGSMLGSLVLRSFERAERMYQAMLSRGYAGEFPVLAPRRFTWRDLTFLAGIALLIV....... 316
167 1.000e-36UniRef50_A0A1V4IF13 Cobalt transport protein CbiQ n=3 Tax=Clostridium TaxID=1485 RepID=A0A1V4IF13_9CLOT  ali  20  19..........SIDFYAYASKIRHWNASFKVYLSVLTLILCIALDNPYVSVGVIIAMAYITVVKGEIPLNEYXXXXXXXXXXXXXXXXXXXLYIGFCYVFTSTVQIKKMTFLILKIFAATSALQMMTLSTPSSEIIYVLRKAYVPKIIVELMSLIYRYIFILMDVSTKMKNSAKSRQGYCDFKTSCYTFGSIASNMLIVSLKKANAYYDAMEARCYDGELVFLEEDKNIEVKHIVIASVFIIFLILLW... 267
168 1.000e-36UniRef50_A0A1H9CFV6 Energy-coupling factor transport system permease protein n=1 Tax=Lachnospiraceae bacterium RM5 TaxID=1200721 RepID=A0A1H9CFV6_9FI  ali  16  1......MSNITLGQYYKQKSFLHDLDPRTKLFSTFIFFVMVFLCDNVYKYLAAALFTGLVIYLSKIPLKHIFRGLKPVLYILVITAFFNMFFTRGYEVIISKEGLYFAFTMTARIILVVLFSSLLTYTTTPKKIVDGLKKIKIPGEIAMIMLIAMRFIPVMSNEARKIMDAQRIRGMDGNFLERGKKYISIVIPLFVATIKKGDLLATAMECRCYN.................................. 231
169 2.000e-36UniRef50_A0A1V6FMB4 Cobalt transport protein CbiQ n=1 Tax=Lentisphaerae bacterium ADurb.Bin082 TaxID=1852899 RepID=A0A1V6FMB4_9BACT  ali  21  5..DTAISDVDALDRLARGSPIHRLDPRAKLVVTALFLLTVVSYPKYVVEMTPLFLYLAALLALGRIPALMLARYLLLACPFALLAGLFNPLITYLGPLAVT-GGWLSFVSILIRFTLTVSAVLLLLASTGYVAVCAALGKLGAPRLLVIQFLMLYRFIFILTDEAERMVRAHSLRNPDEPN-PPLRAWGSLAGHLLLRAYDRGQRVHTAMLARGFDGTLRLPQGFHWSMADTLFVAGSSGFLLLARY... 254
170 2.000e-36UniRef50_A0A1T5BUK0 Cobalt/nickel transport system permease protein n=1 Tax=Acetoanaerobium noterae TaxID=745369 RepID=A0A1T5BUK0_9FIRM  ali  15  6...KSSQNLRWMDNQSDKNTIIHRNPVVKLVVSLIYIFTIISFDNYSPQLIPFIFYIFIVSSLAEISLIHLLKLSAVSLPLIIGIGIFNPIFYYIGSIPISF-GMLSFCTLFIKSLMTVISGLLLVATTGINNLGMALRKIGLPKIFAVQIMLTYRYITVFMEEVNTTLTAHSLRA--NNKGVSYKSYGYLVGNILLRTIDRSQKIYEAMCLRGFHGDYVTGKNPKINKTDIIYLAVWSSLFIFIRYF.. 254
171 2.000e-36UniRef50_A0A1C6DQE0 Energy-coupling factor transporter transmembrane protein CbiQ n=2 Tax=Ruminococcus TaxID=1263 RepID=A0A1C6DQE0_9FIRM  ali  19  2..KHNHFGARSIDEYAYSSKLKNWNSSLKVLCSFIIMILSICSQNVIVPILIAVSAGVITVYNGKIHTREYXXXXXXXXXXXXXXXXXXXXDFGGFSVKVLPENIYRAVHISCRAIGAVSAMYLMSLSTPVTEIIAVLGKLKLPFVIIELMNLMYKYIFILLDSQAKMKNSAAARLGYCNFRTSLKTFGLICGNLFAVSLRRASDYYNAIESRCSGGKIKFMCQKKTIKSKQVIFFVVYV.......... 242
172 2.000e-36UniRef50_A0A096DKU9 Uncharacterized protein n=2 Tax=Caloranaerobacter azorensis TaxID=116090 RepID=A0A096DKU9_9CLOT  ali  26  1........MILIDKYSYMNNIRKIHPMEKVLFGLFPLFTCIISKXXXXXXXXXXXXXXXXXXXXKIPIKYYXXXXXXXXXXXXXXVLDYFIKIKSLYIGFKKEGLNTGIHLFFRVFASINCLYFISLTTPMNDVIWVLRRMKLPKIFVEIFMIIYRFIFVLLDTAGDIKNSQLCRLGYSSIKRGYYSLGKLISNVFIKSFHIYRMLFLSMISRGYDGEINVLEEEYEYSFKNKILISIYFAFTIVIAFF. 254
173 2.000e-36UniRef50_A0A1H9Z921 Cobalt/nickel transport system permease protein n=1 Tax=[Clostridium] polysaccharolyticum TaxID=29364 RepID=A0A1H9Z921_9FIRM  ali  19  5.......HHHALDEYSYISGMRQWNGTLKAVFSIAALLAVICRNSLKVSLLTLLYMCVLSVLAGKVHFRDXXXXXXXXXYFCLFGSIPICISIFGTKFYITKESFWLAVNVGCKALGSISAMYMLTLSTPLAEILNIFRKMHVPDLIIELMHLIYRYIFILSDSNRLQRDAAVSRLGYRNYQTSIRSFSKGLANLLVISLKRAQSCYDAMEARGYDGTLRIMEEQHKITCKQVLWMAGYVLVIIISSFV. 266
174 2.000e-36UniRef50_B5YI81 Cobalt ABC transporter, permease protein CbiQ n=13 Tax=Bacteria TaxID=2 RepID=B5YI81_THEYD  ali  13  1.........MHLEEFSEGNSFLHKADPRVKILVFALFSILCAISSGIKTPMLYLFYSLTLLLITRIKAKPLISRXXXXXXXXXXXXXXXXXYITLGFIKISHEGINYALSITIKCNAIIIATITLLSTSSVFSLAHAMLHLKMPKKLVTVFFLFYRYITVIHEEYLKIKRAVALRGFPKTNLHTYKTYAYIVGGMLIKSYERAEEIYRAMLCRGFQGFFPLFEHFQIRKSDIIFGVISTAIFILFWV... 245
175 2.000e-36UniRef50_A0A212M0F1 Cobalt ABC transport system permease CbiQ n=4 Tax=Sporomusaceae TaxID=1843490 RepID=A0A212M0F1_9FIRM  ali  19  5..EANWIDLRYLDTLATKSPVHHLNPVVKLIVTLVFIITVTSFPKYEISXXXXXXXXXXXXXXXXXXXXXXCKRLLLVAPFIIFIGIFNPLLDHLGPFVLT-GGWLSFASITIRLYLTVTAALILVATTGMNALGAALARIGIPRIIVVQILFMYRYLHVLLEEFVRSIQAYSLRSFHGDGI-RFRAWGSLLGQLLLRSIDRANRIYQAMLCRGFDGEMRLMHRSALHAADILYLTFWTVFFLSARSL.. 255
176 2.000e-36UniRef50_A0A2H6GNF0 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=bacterium BMS3Abin14 TaxID=2005722 RepID=A0A2H6GNF0_9BACT :  ali  15  3.....WFQDITLGNYYPADSVVHRLDPRLKMTAMALLMGMTFAVSNPWAILLQSLAIIAAVRLSRIPMTYFLRSLRFFVWLFFFTAVLHLFFTPGGFIRVTYEGIAEGGLISWRLITVIALSSIFTSTTTPLEITRGMESILSPQDFSLMMMMAIRFIPVLSDETQKIWKAQKSRGGHGGIKRRTRALVSILLPVFVGIFRRADDLAKALEARGYVGKRRTSMKELIWTGRESMALIIILILSFSLL... 265
177 2.000e-36UniRef50_UPI00051B6814 cobalt ECF transporter T component CbiQ n=1 Tax=Clostridium sp. KNHs205 TaxID=1449050 RepID=UPI00051B6814  ali  24  1........MLLIDKLSYSSRLRDKSPVLKAFLAVTTLLICVAARSVLFSFLVLTLMTGLTVILGGTSIFDYIRLMRVPLAFLLISTVTILFGISGLFYYFESGKLIFGLQLISSAFGAVACLYFLSLTTPFTDILRVLQLLRCPTVISELLLLIYRYIFVLYETAAGITTAQESRLGNRSFKTALKGSTGLFSILFIRAMKKSSLLYDAMEARCYDGTIKVLWEKKNAGKGEIAAVILLVTVLGICSCYL 254
178 2.000e-36UniRef50_A0A0S7X6W9 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A0S7X6W9_9BACT  ali  21  1......MHLPEIDKYAHLDSPLHSWDPRVKIVSLFCLILSXXXXXXXXXXXXXXXXXXXXXXXXXXPFXXXXXXXXXXXXXXXXXXXXXXXXXXGHFLSISRRGLELASLIGLRAFSAVLLVFPMIGTMKFSSTTAALQRLKLPNKLVQMIIFTYRYIFVALDEMGRMFMAARARGFRGTNLHTLKTVGNLIGMLFVRSYERTEHIHRAMVSRGYDGTLRVLDEFALAKKDFLKAALVVALALGLYF... 248
179 2.000e-36UniRef50_A0A1I2QEK8 Energy-coupling factor transport system permease protein n=1 Tax=Planifilum fulgidum TaxID=201973 RepID=A0A1I2QEK8_9BACL  ali  21  9...........LGQYVPGDSPLHRLDPRTKILFVSVYLPLVLLADSAADLALLSAVALGGALLSRISPGVLYGMLKPLLFLIALTALFHLMFWQWGPLALHEAGVKQAAWTAARFFLMVLTASLLPLTTAPLALTDGLERLLSPHELALMMSITLRFIPTVQEEAEKIRLAQRARGGRGSLFRRLKHAVSLLIPLFVSAIRRAEELAVSMESRCWRGG................................ 233
180 2.000e-36UniRef50_D0DD31 Cobalt ABC transporter, permease protein CbiQ n=65 Tax=Proteobacteria TaxID=1224 RepID=D0DD31_9RHOB  ali  19  66...............................................................SKLPPGPTLRRMAMMDGFILFMLVMLPFTVPGWGFTASWQGLRQATEIALTANAVILALMVLVGTLEPVTLGHALHRLRCPERLVHLLMFTIRYIEVLRHEYLRLRAAMKVRGFRPGNWHTYRSFGYLVGMMLVRAIERSERILSAMRCRGFSGRFPLLGDFALTARDRRVAVVFCGLCTALLGV.. 257
181 2.000e-36UniRef50_A0A2E8WK55 Transporter n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E8WK55_9BACT  ali  22  56.........ISIGRFLPMDSPLHALDARTKVLCSVGLVASLFWAPASTAWGFALGSLAPVVVGARIPFSYLLGNLRPLAPIVILTVVLNGIYTPGTGLPLTAEGLVRGGELGLRLVVIVTVTALLSLTTSPLDLADGLSRLRIPHELALTTTIALRLIPLLSDEALRIRTAQLARGAQGGLTRKLKDLSAILIPLFIAAFGRSERLAEAMAVRGYSGEGRTRYRMSRLGPKDLAAVVTTTIILWLAF... 308
182 3.000e-36UniRef50_A0A2P4TTW9 Cobalt ECF transporter T component CbiQ n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2P4TTW9_9PSED  ali  43  15.........LSIDQYAHLSRWRERPVLEKXXXXXXXXXXXXXXXXXXXXXCIIASVLGVTLLGARVPLRLWLRCALIPAGFLLTAGLTMLFDVGRHDLSFSAAGLPVVCGLLLRSFAGICCLLLLALTTPVTDILASLRKIGLPREIAEISLIMYRLVFLLLDTASAMHTAQAARLGQRNRKQQLRSLGLLLANLFPRAMDRAGRMENGLAARGWNGEFKVLRRTRPLSLARLTWTSLLLGSVLLMGSLF 255
183 3.000e-36UniRef50_UPI0008362ABD cobalt ECF transporter T component CbiQ n=1 Tax=Clostridium sp. AT4 TaxID=1720194 RepID=UPI0008362ABD  ali  25  13.......QILLMDQYAVCSQMASWNPDWKIMLGLISLLGCIGSKTGLISVAVGLCMAVLTHKWGGVEWPVYGRMLTIPLFFVILSGAVIALDF-------TKEAVMEAVFVTVKVLTGTACLYMISLTTPVYEVVGTLRRWHLPEVMLELMILMYRFLFGLLELYEQMKQSAQARLGDIGIRQGYRSFFGICANLLVLAFRRASDSFNAMEARSYDGELRFLEEKKLVTGRQRLGIVLYGVLLAAGLL.. 246
184 3.000e-36UniRef50_A0A1C6K5C2 Energy-coupling factor transporter transmembrane protein CbiQ n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1C6K5C2_9FIRM  ali  28  4.......KILSIDYYAQQTGLGRWCGGYKLAITVGTLALCIATDSAAFSLAVLLCMAVLALGPGRAPVKLWAKLMAAPLVFVTISCAVVALSFPSRYIAVTASSLHTAGLLFCRAMGAVCCLYALTLTTPSHQVIGVLRRLHVPALLTELMSLTYHFIFVLLDTQSRMHTAAVSRMGQNGFYIHLRSTAAIFANLFLAAMAKSSSVYSAMESRLYTGSIQFLEERPPLRPVQVAGAVAYFVVLLVLRRIF 258
185 3.000e-36UniRef50_A0A094QYJ2 Uncharacterized protein n=2 Tax=root TaxID=1 RepID=A0A094QYJ2_9ZZZZ  ali  22  1..............................................................MAKIPLRLLFTRALIEVPFVFFAVLMPFFQVSFGPFNLYEEGLIAAAGILIKGTLGVLTAITLSTSTTAREILRGLEKLKLPTLMVQIASFMLRYINVVNDEMERMKVARESRGFNATGIKHWKVLATAAGALFIRSYERGERVHLAMLSRGYEGVLPHDEPPKLSK..................... 171
186 3.000e-36UniRef50_A0A1H9SFF1 Energy-coupling factor transporter transmembrane protein EcfT n=13 Tax=Bacilli TaxID=91061 RepID=A0A1H9SFF1_9LACT  ali  18  1......MDKLILGRYIPGDSIVHQLDPRVKLLGSIYFIFLLFFANNWQSYLFLAVFILVAIKLSKISLGFFLRGLKPLLWLIIFTVSLQLLFFSFGPIAISQFGLINAALIFCRFVFIIFMSTLLTLTTIPLELTDAIEFILSPHEIALMISIALRFVPTLMDETTKIMNAQRARGGEGNLFQQMKSIIPLLIPLFVSSFNRAEELATAMEARGYRGGEGRTKYRVLNWEVTDTMAVIVFAFVTVGVILL 262
187 3.000e-36UniRef50_A0A173XLP0 Energy-coupling factor transporter transmembrane protein EcfT n=9 Tax=Clostridiales TaxID=186802 RepID=A0A173XLP0_9FIRM  ali  18  1.....MIRDITIGRYYDSESVIHRMDPRTKLMGVLVYIISLFLVKNVWWYLGCLIVMLVLYRLARVPVGYLLKGLRGILVLLCFTFLFRMLYTPGWIFTITKQGIWKAVQMTARIALMITGASLLSYTSTPKELADGLEKIGVPHEMAVIVMIAFRFIPIMLEELNVLMDAQAARGARGNVVEKCKGVMTLLFPLFLMTVRRSSDLAMAMEARGYTGSTETSRMYPLTYKK................... 243
188 3.000e-36UniRef50_A0A2M7KPC9 Cobalt ECF transporter T component CbiQ n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7K  ali  21  1......MTADAFEQYVPGDSFLHRAAPVVKVCGAGAFILCVVLASSWPRSVACASIPLLAALAAGVPGRWMLARXXXXXXXXXXXXXXXLWQVPGTTWAVPLSAVELFASILLKSTLCVLAVALLLATTGFHRLLGALQLLRVPALFVSLLCFMYRYLFVLWDETVRMTRARNARAPRQRPLERLRTVGHMAGSLFLRSYERAERVAHAMVARGFDGTMRLTEQSAGSAAQWLAVGGFTAACAAMVVW.. 254
189 4.000e-36UniRef50_A0A0M2UB45 Uncharacterized protein n=1 Tax=Clostridiales bacterium PH28_bin88 TaxID=1605376 RepID=A0A0M2UB45_9FIRM  ali  27  15........................LDPRIQLGFVVLALAAVLTSASLKTPALLTGFGLVGACRQGIKIRELFRRSAAPVIMALVMLVTHVLFIGPVGLTGYLEGWRKGVTLVFRITAGISLMLYLSTTTPVHRLIAAVRWFRLPQPLVEVLELAYRYLFVLREEAGRINQAQKARLGYAHWRVGLKSGSTLGGVVLIRAFDRGERLYQSMCCRGYRGQF............................... 219
190 4.000e-36UniRef50_A0A1H8A6D3 Cobalt/nickel transport system permease protein n=1 Tax=Hydrogenoanaerobacterium saccharovorans TaxID=474960 RepID=A0A1H8A6D3_9FI  ali  23  1........MITMDRLAYSSKIKDVSPAFKAGLSISALVYTLLVDNALFSIGIFALMALLCTLLSGLPMRRFLKMCAIPFGFLLIGTVFISLPFWGNYLVITQAGAILAVNVFLKSMASISCLYFLYVSTPIGCLLGLLDRMHTPKLLTELMMMIYRFIFILIGMAEQMALAQKARLGNITYGASFRSISVLASSVFVGAFQKSTKLYDAMESRGYNGDFAFTGELAGMSNRQKTVLAVYELVLLVTAVL. 253
191 4.000e-36UniRef50_F9VLW6 Cobalt ABC transporter, permease protein n=4 Tax=Candidatus Arthromitus TaxID=49082 RepID=F9VLW6_ARTSS  ali  15  1.....MIESIIIGQYLKIDSFIHRLDPRVKIILNIVYIIGIFFIDSVFKYLFYLIMIFLITLGARIKFYYILNSIKVVSLFIIFAAFFNVFFFKLGFLSIYDKAIETSIFISLRVIFLILGSTILTLTTSPVELTDGLRKLNVPGEISLMVSISLRFIPILLNETDKIIKAQKSRGVDGGIISRVKNIVPILIPLFINSFRRADELAIAMESRCYNGEDRFKFKVLKFNIRDYLSLILFILFVILIYFL. 263
192 4.000e-36UniRef50_C8WZI9 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Desulfohalobium retbaense (strain ATCC 49708 / DSM 5692 / JCM 16813 / HR1  ali  20  4............ETLHHGHSFFHRRDPRAKILSAAAVAWAIALCQSFPPLILATGGAATALFAAQLPWRDLAKRXXXXXXXXXXXXXXXXXXWAPHTWQLSSDGLLLCLAITLKANAITGFLVVLLATSSIPEIGRGLHQLRLPDKLVFLLLFTYRYIHVIAEEWQRLFRAAQLRGFPGTNRRTYTTLGHMLSQVFVRSFDRSQRIYQAMLLRGFTGRFHPLTASLMRPADWILALSCIALAGGLVGW.. 246
193 4.000e-36UniRef50_R5DX34 Cobalt ABC transporter permease protein CbiQ n=2 Tax=Eubacterium TaxID=1730 RepID=R5DX34_9FIRM  ali  14  10.......RMRRLEVTAQKRGWLNIHPTSKLFVTLACIILVISINQYLPGLLGMCIYPVVLFVIGEISIKEFLYRLRMILPLVCLVGIFNPVFFYIGSVCVTY-GVISMITLMLKGVLTISAAYLLASTTPIEKICAALRHLHFPKMIVTVILLIYRYMSLLMSEASRMTQAYMLR-APGHKGIHIKAWGSFAGNLLIRSIDKAKTVYDSMILRGFDGEINYTGYKKMSVNDYVYMMAWFVVLLVIRTFM. 256
194 4.000e-36UniRef50_A0A225QB57 Cobalt ECF transporter T component CbiQ n=8 Tax=Rhodobacterales TaxID=204455 RepID=A0A225QB57_9RHOB  ali  19  27........................LDPRVRILSAIAYGVFVVALDNLVALTAALALSLTLLALSRLPPARTLKRVAMVDGFILFMLLLLPFTVPGWGYSASWQGLARAIQIGLTANAVVLALITLVGTMEPVTLGHALYRLKTPETLVHLMMFTIRYVEVLRQEYLRLRAAMKVRGFRPGNWHSYRSFGYLVGMMMVRAIERSERLLGAMKCRGFSGRIVLLQEFRCTRADALFALVLFGAFA....... 252
195 5.000e-36UniRef50_A5UPQ3 Cobalt ABC transporter, inner membrane subunit CbiQ n=7 Tax=Chloroflexi TaxID=200795 RepID=A5UPQ3_ROSS1  ali  20  1.....MKHIHLSDRYQNGSRIHRLEPRVKVIVTLLFIVSNVTLPDXXXXXXXXXXXXXXXXXXXNIGIFFALKRSFVALPFAL-VAVTVVFTTPGQPLAATDAGLVRFLSILARSWLSVQMAIVLTAVTPIPDLLHALRHLRVPPLLVAVIGLMVRYLTILSDEALRLMRARDARGSGGSLLWRAQVTGNMVGQLFLRSYDRSERVYQAMLARGFDGRFLTANPHQMRAHD................... 239
196 5.000e-36UniRef50_R6ZLF4 Uncharacterized protein n=1 Tax=Clostridium sp. CAG:299 TaxID=1262792 RepID=R6ZLF4_9CLOT  ali  27  1........MPTIDRLSYESRLRFVHTGEKFFFSLFTLLLCVGSRSIPLALYVFMTTGILTVYKGKIPVIEYLKXXXXXXXXXXXXXXLFAISMGQWYLTASTETVLYGLRIFLTAMASVSCLYALSCHTPMTDFILFLKRIHVPALLSELMVLIYRFIFILLDCAHAISISQRARLGNKDFKTSLRSFSALISSLFIRAVSRSSILYDAMESRCYDGVLNVLSEEQRPRKREICFIIFYELSALFVLWL. 253
197 5.000e-36UniRef50_A0A140L4F6 Cobalt transport protein CbiQ n=3 Tax=Clostridiaceae TaxID=31979 RepID=A0A140L4F6_9CLOT  ali  29  1........MISMDQYAYINRLKSVHPMEKCLLSGGMLLICLWNTSPXXXXXXXXXXXXXXXXXXXXXGKTYVQXXXXXXXXXXXTLFLYGFAMGHWKIGISQQGLDQAVLVFLRAYASVTCLYFLAFTTPMTDMMWVLRKLRMPTVLVELAMMIYRFIFVLMETASMIYISQDCRLGYSSIKRSYTSLGQLASNLFVKAFCRAQELFTALTARGYTGRLDVLEENYYLSMKNMALIVLAQGIFMILAL.. 253
198 5.000e-36UniRef50_A0A1V5W6H3 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Spirochaetes bacterium ADurb.Bin218 TaxID=1852906 RepID=A0A  ali  17  9..DNILFNLGYLDLLAYRDSIHRVNPVAKFITTVVYLFFVISFNRYEIMLLPFSIYPLFLILRADLPFGYILKKVLYVSPFVIMVGIFNPIFFSFNGINITS-GWVSFLSIIIKYFLTVTTVIVLIGVTGFYNLCYAMNKVGVPKVFSVQLLFLYRYIFLITEEAARMTRARELRT-PISKPVSLKVYGSLAGHLLLRSINRAERIHRSMILRGFDGNIKIAGRTSYRLNDFIFMSLWILVFIFFRFF.. 259
199 6.000e-36UniRef50_A0A1V5H8U6 Energy-coupling factor transporter transmembrane protein EcfT n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=1227  ali  19  3.........MTLGQYIPGDSPVHTLDPRVKLFLMGFGIGAAFRMDTPLGLALFFAVCAVSTLAAGLSFRRLVKGLSPFLWLFAMTAVLHVFMTPGQPVHATWQGLQNGVQTGLQLMFAIWISTLMTLTTSPLDMVWAMEWLKVPDEIALLIMLAIRFIPLLFEEADRIIKAQKARGVDGGVFKKMRSLVPVLVPLLHSVFRRADDLAVALTLRGYSPGIVRSRMKCLKAKKSDIVSLTGAITVLIVLILL 258
200 6.000e-36UniRef50_A0A1F5RHI4 Cobalt ECF transporter T component CbiQ n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5RHI4_9B  ali  17  6...NAIYNIRQFDELAGRDSIHRLHPLAKLLSTLVYTVLLVSYDKXXXXXXXXXXXXXXXXXXXKIPVDPLLKRLLYIEPMIVGIGLLNPLFDQGNYLGYTSSGWLIFWSIFLKGTLAVTSALLLIATTGMDGVALSLRKLKVPRIFVLQMILTYRYISVLLEEAARTVQAYALRAFSSQGLKR-EVWGPLLGQILLRTVDRAQRVYDAMCLRGFRGEYHTGKGPGAGWIDIMYVSTWGAFFALSRMI.. 254
201 6.000e-36UniRef50_A0A2K2VXQ4 Cobalt ECF transporter T component CbiQ n=8 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2K2VXQ4_9DELT  ali  20  1.........MHIDNFATGDSLLHRLDPRVKIVVAILFSVVVAVADRYGCLATAVCLALTLLFLARLSLREXXXXXXXXXXXXXXXXXXXXXLFSIGPLDATREGIIYALLITVKSNTIVLALIALLATSPVVTLGHALSHLYVPDKLIHLLFFTVRYLQVLHLEYDRLRDAMRIRAFKPGNVHTYKSFAYLLGMLLIKSFDRADRIRKAMLCRGFHGKYYLLSHFELQRVD................... 229
202 6.000e-36UniRef50_S6GNE8 Uncharacterized protein n=2 Tax=unclassified Oceanospirillaceae TaxID=221817 RepID=S6GNE8_9GAMM  ali  17  16.............EIPEKSSLLLMIDPRARIITTLLFALAVVSSDQVIVLLCAFSLSVIATFFAKLALLKTLKRLVVMDAFMLYLLIILPFTFSVFGLSGSWQGLEQAIIIALKANSVVLMLFSLVSNLSASALGSALQAIKVSNKLIQLLLFTMRYLSVINEELQRLRRSMRARGFVMGFLHSWQSIGNLIGMMLVRSMQRSERILKAMKCRGYNGQFISYHPMQWRQHDYWFCLLMCTISFALIYL.. 257
203 7.000e-36UniRef50_A0A1H3LSD5 Cobalt/nickel transport system permease protein n=2 Tax=Saccharopolyspora TaxID=1835 RepID=A0A1H3LSD5_9PSEU  ali  26  12................PGDSVLHRSAPEVKIVAAFLVVLCVVATPRFWAFGGYALLLFGLVLVARVPPRWLAGRLLIEVPFVVL-ALVLPFTAGGAGLALSTGGLLAGWNILVKGTLGLATSVLLAATTAPRELVVGLQRLRTPRLLITIITLMLRYAEVIVAEAKRMRVARICRGHDPRFLWQLGATARGVGSLFIRSYERGERVHLAMVSRGWSGAMPELGESRRTS..................... 230
204 7.000e-36UniRef50_A0A1W9LDA8 Cobalt ECF transporter T component CbiQ n=1 Tax=Verrucomicrobia bacterium A1 TaxID=1934251 RepID=A0A1W9LDA8_9BACT  ali  21  6..............FLGGGSPVHRLDPRVRXXXXXXXXXXXXXXXXXXXXTMALVAGCGLAAAARLPEPALLRRLGRLNLFVLFLWLMLPWSTPGAGLGLTHEGVELALLIALKANAIVLLFTSLVATVPPAELGYALRHLGLSDKLVHLFLFAIRYTDVIHGEYERLRGAMRARAFRANFLHTLRTFGYLVGLLLVRSLDRAERVLAAMKCRGFDGCFRSLTPFAMRPADWAFLVAGSCAAGGWTWMIL 248
205 7.000e-36UniRef50_A0A2G6NAB4 Cobalt ECF transporter T component CbiQ n=3 Tax=root TaxID=1 RepID=A0A2G6NAB4_9DELT  ali  20  52...........IDDHAQKSSFFHTWDPRFKIATLLAFCFLVVTLNHPATCILALFTALLAVYYCGTPWQRVRRRLTPMAGFLSMFLVVLPFFSPLQEIFFHTAGLLLAILIILKACTVALLMEPMLGTAPLNVTLQALTRMGLPKTISQMILLCHRYLFVFLQEALRMQRSMRVRGFTRTNLATLRSMGNFFGMLFIRSFDRTQRVFDAMLCRGYQGTFPVHSRFTPDSADLKKTWLWVALGLSLVLL.. 301
206 7.000e-36UniRef50_D9PUJ4 Predicted cobalt transport protein n=4 Tax=Methanobacteriales TaxID=2158 RepID=D9PUJ4_METTM  ali  18  1.....MEDLINIERESLKESSIHSLDGRVKXXXXXXXXXXXXXXXXXXXXXXXEIYLILLIFLSNVSPSYAIKRLILILPFGGFIALFQPFWAGPFGFDITLQGIIFGALLLGKVTVSVTAVILLSSTTSMQELVGSARRIGVPSDFAMLLNLTVRYLFFFYDELERIRNAQKTRCFDIPYRWRLRKVGETIAMMFLRAYEQGERVYLSMLSRGYTPESRMYTAASKIGRREVLFVAANIMILAVLHVM. 256
207 7.000e-36UniRef50_A0A248LGX7 Cobalt ECF transporter T component CbiQ n=3 Tax=Laribacter hongkongensis TaxID=168471 RepID=A0A248LGX7_9NEIS  ali  19  5..DTALWSIRRMDHFAGQDTAATRIDPRAKVIAVFAILIGAAAHPPVSALLPLLLFPVCLLSLGEIPVRWLASRLLFALPFAFFVGILNPWLVAMPWGGDMAAGWLTFASIMLRFLIAVSAAFLLVATTGMNRVSKALSQMGVPRVFANQLLFLYRYVFVIGEELLRSIRAYQMRAVNGRHALPPRFYGLLLSGVMSRSIARAMRVHAAMQARGYDGELHFVQQWHWRLSDTLFVVGWTGFAVLCRMI.. 256
208 8.000e-36UniRef50_B0TDI5 Cobalt abc transporter, permease protein cbiq n=12 Tax=Firmicutes TaxID=1239 RepID=B0TDI5_HELMI  ali  18  5..TDSLLSMRQLDDLARQTSIHRLHPVTKLLTTVIYLAVVTSFDSRAIGLLPLILFPVVLLTLAELPPAAIFKRVLFVEIFVLTLGIVSPFLVSIGGVALS-AGWLTFFSLLLKTALTVTATMILIATTGMDRIAVALRILKVPKLFVLQMMLTYRYISLLLEEVQRTVMAYALRAPEQKGVHR-SAWGSLAGQLLLRTMDRARRVYEAMRLRGFTGDYHAGEVLKLGARDILFAAGWIGFFLTARWV.. 255
209 8.000e-36UniRef50_B3EC56 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) TaxID=290315 Re  ali  31  1........MITLDRYTAASPLRRVDPLVKLSFALPPLLLCLWADRIALSLLVLLAMGAATVFAGRVSARXXXXXXXXXXXXXXXXXFAVAMPVGGVYAGLTASGLDRAFRLFFRAMGSVSCMYFIALTTPPETLFHAARRLRVPELLIEMAGLVYRFLFILLDSAGRIRLAQESRLGYVDLQASFRSLAVLSSALFLIAARRADECYTALECRGYEGTLRVLHEPCERPR.................... 235
210 8.000e-36UniRef50_A0A2H6FXL4 Nickel transport protein NikQ n=5 Tax=Bacteria TaxID=2 RepID=A0A2H6FXL4_9BACT  ali  13  1.........MHLEEFAEGKSFFHTLDPRIKFLTFIPYIMVIAIVHGLRIPITALALSSIMAVLAELNKKKLLNRXXXXXXXXXXXXXXXXXFFRIGPLTASKEGFLYVLSITMKTNAIVLATIAILGTSEVFSLAHAFVHLKVPNKLVHLFFFFYRYISVLHEEYTRLKRAMIIRSFKPGNLHTYRSFAYLIGMLLVNSYERSQRIYNAMLCRGFTGKFPVIDHFSLRKSDITFGLLMSVVTLILIYIM. 247
211 9.000e-36UniRef50_A0A0J8D6Y0 Cobalt ABC transporter, permease protein CbiQ n=1 Tax=Clostridium cylindrosporum DSM 605 TaxID=1121307 RepID=A0A0J8D6Y0_CLOCY  ali  21  1........MIGIDKYAYLSKISRLNPKGKLLFSMLPLLICIFSNXXXXXXXXXXXXXXXXXXXXXXXYKVFLKLILIPIGFLFIGSLLIGVSLGSYSYGISYDTLMKGLLITLKSLGAVSCMYFFSLNTPMNDFFNLLRKTKLPVLLIELMELMYRFIFIIWEEGEKIYIAKSSRLGYLGFKNQMYSTGELISSLFLRSFRRIDTINAALESRGFDGSLDTLVEEYSPCKWLNIYTVLVCIILIISYIV. 254
212 9.000e-36UniRef50_A0A1V5BCJ2 Energy-coupling factor transporter transmembrane protein EcfT n=5 Tax=Methanothrix TaxID=2222 RepID=A0A1V5BCJ2_9EURY  ali  19  1......MSHLEIDGYSHLASPIHRWDPRVKIASLLLLTFSIVLLKSLAVALLGLASSAAILLISRLPFSYVLQGIKWPLLFLLPFPLILPLTVDGYGLGFSIEGLEQGLVMMTRGVAAVVLIYPIFGSSPFNTTVHAMRSLGLPEALTQIFLFAYRYLFLLREEFASTSRSLASRGFKGTDAASIRVLGAALGMLFIRSYERSERIYRAMVSKGYGGDLPSADRFRMEGRDLLKALIV............ 239
213 1.000e-35UniRef50_A0A256BQD2 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Aerococcus sp. 1KP-2016 TaxID=1981982 RepID=A0A256BQD2_9LAC  ali  18  1.....MKDNLIIGRYIPGNSIMHRFDPRLKLVGLIVMMLLVFAATTLTTNXXXXXXXXXXXXXXXXXXXXXXKGLRPMIAIIIFTVALQILFWSWGFLALTTGGLMNAAYIFVRFLLIIFLSTILTLTTQPLAITDAMESLLKPHEIALMLSIALRFVPTLLEEAEKIMNAQRARGVDGNIIQRVKAFIPVLIPLFISAFNRAYDLATAMEARGYRGGEGRSKYRLLHWENIDTIGAIVLAILTVVMIVL 262
214 1.000e-35UniRef50_D3E2H3 Cobalt ABC transporter permease protein CbiQ2 n=8 Tax=Methanobrevibacter TaxID=2172 RepID=D3E2H3_METRM  ali  23  5...........MDYIAHHNELSEANPYYKLFITIILLIVTLALDNLYFDIFMFILFSIIILGVAKINIRSYIKXXXXXXXXXXXXXXXVIYQTGFFGIVVTDDSWHYGLYTFFRVLGCFPILGFLALTTPIAKIFHCLETLKVPKIVIEIGLLMYNTIFIFLNEIDVMQKAQKTRLGYNSYWNSLQCLGSLVSNIFLRSLEKSETLQNSLDSRGYDGELPVYIPPK........................ 228
215 1.000e-35UniRef50_A0A1M6E5S4 Cobalt/nickel transport system permease protein n=2 Tax=Clostridia TaxID=186801 RepID=A0A1M6E5S4_9FIRM  ali  34  1........MLKIDQYAYTSSLRHVHPGEKFAFAMLTMSICLXXXXXXXXXXXXXXXXXXXXXXXRVPARFYFRXXXXXXXXXXXXXXXXXXXXXREPXXXXXXXXXHAALLFTKSLGAVSCLYFLSLTTPMVEIISVLRRLKVPALIIELMGLVYRFIFVIMETAGSMYISQTSRCGYASLKTSFRSLAQLVSNLFVKSCYHSQALFTALLARGYTGEIRMWEDPRPVSRK................... 236
216 1.000e-35UniRef50_A0A2N2FWV4 Cobalt ECF transporter T component CbiQ n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N2FWV4_9DELT  ali  28  1.........MRIDSYAHGNRWRQIHPGVKGLLVLLTLIAALLSRHPTIPLLIALSISSLTLFGAGIPWRGYLRXXXXXXXXXXXSLPLLQLPASELTIGLNLSELPLVQLVFSRSLGALCTLLFFALTTPLSEIAGLLRTLGLPRLFVELMVIAYRQIFILLDAFSQIHTAQEARLGYRSFKVSWRSTAELAGNILIKTIVRARHNHQALLARGYDQELRFLSPHRHLSRWQLLGAGTLGWTFILLAW.. 251
217 1.000e-35UniRef50_Q1AU60 Cobalt transport protein n=7 Tax=Terrabacteria group TaxID=1783272 RepID=Q1AU60_RUBXD  ali  22  9..........SIGQYYPAPSPLHALDPRAKLLAAAALVVGLFLVDSMAGMLLVLAAVGAAAAISRVPPGAFGRLLRPVLFIVALTALFQPLLVGWGPLEVHEGGVRTGVFLALRIALLVTSAALVTATTPPEDLLSPLRRLRFPHEMAMMMTIALRFIPTLDEEAQKIMRAQAARGADGGVAGRLRAVLPVLVPLTVGAFRRADELAEAMESRGYRGEGRTRYRELRFGWRD.................. 249
218 1.000e-35UniRef50_H6LCM8 Cobalt ABC transport system permease protein CbiQ1 n=60 Tax=Firmicutes TaxID=1239 RepID=H6LCM8_ACEWD  ali  22  42..........SIDFYAYASKIRSWNPTFKVVFSFVTLLLCVGLNNPLVSVAVIIGMAYLTVIKGGLPLRXXXXXXXXXXXXXXXXXXXXXLFLGFGYVFTSVDKLQQMVFLMLKVFGAISAMIMMTLSTPSSEIIGVLRKAHVPKLIIELMNLIYRYIFILMDVFNNMRNSADSRQGYCDFKTSCYTFGSVASNMLVVSLKKANAYYTAMEARGYEGDLVFLEDEKK....................... 270
219 1.000e-35UniRef50_A0A2P8I3B7 Cobalt/nickel transport system permease protein n=10 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A2P8I3B7_9PSEU  ali  25  11...............PGDSPVHRLAPQTKIVATVVGVLCVVATPRAFWAFGAYLLALTAVWAVARVPVRWFAARSVIELPFVLLAVLL-PFTGGGLGVSVSEEGALAGWNILAKGTLGLLTSLTLAATTAPQDLLLGLQRLRMPSVLVTIATLMLRYAEVIVGEARRMRVARISRGDDPRLFWQLGATARGIGSLFIRSYERGERVHLAMVSRGWTGRMP.............................. 220
220 1.000e-35UniRef50_A0A0S3QUC2 Cobalt/nickel transport system permease n=1 Tax=Thermosulfidibacter takaii (strain DSM 17441 / JCM 13301 / NBRC 103674 / ABI70S6)  ali  18  1......MRHSFIDKYSDLDSPVHRLPTRLKLILFLFIISVLSFKGSWFVWTFFLLFCCAVVFVANIPPGYIFKKSAVVLPFAFFLSLGAWRDWDGF------------LFLVLRAWLCAAYCILLLATIPFPELLKAFQDMGVPALFIMVLSFMYRYIFVFVDEVHRFEVAWKSRAFGVKGIKAFKTLSQAIGVMFIRSFERSDMVYQAMLARGFDGRIRVYRGDRCSS..................... 213
221 1.000e-35UniRef50_A0A2H6K1W9 Nickel transport protein NikQ n=2 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A2H6K1W9_9ARCH  ali  18  38..SSFFEDDLFGDEYTKKNGLLQRIDPRVKLLTLLAMVVAVSVSTNTEVIIGVYLLTLILASASKIELKPFITRXXXXXXXSTGTPIISLFEIGGVQIALTAEGISGAVLFISRVATSVSIVALLTLTTRWNLILKSLRVFKIPLIFVMVLEMTYRYIFLLIKTVKEMHLARKSRTIKKHGLEKGHWVAGRIGYLFRKSYDLSQKVHFAMLSRGYTGEAKILSQPKVKRVDYGW................ 284
222 1.000e-35UniRef50_A0A1V5Z801 Energy-coupling factor transporter transmembrane protein EcfT n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A1V5Z801_9EURY  ali  17  1.....MFGHDFLEEAAHHNALLQVHPFTKLFLGVGSIILVLLTPNYIVPCFLAMTLSIIIIVLAKINLKFYLKXXXXXXXXXXVTEIWSVQLFPWLTLAATSESLNQGLHIFSRIFGGMCALFFISLTTPMTDLFGIMKKLKIPELFIDLSMIIYRYIFIFMEKASQIFLAQKMRLGYTRPGEAVRSYSMLFGSIFITSWDAGEDLINAMDGRCYNGK................................ 225
223 1.000e-35UniRef50_K7W6V9 Cobalt ABC transporter, permease protein CbiQ n=42 Tax=Cyanobacteria TaxID=1117 RepID=K7W6V9_9NOST  ali  26  3.........LQLDTLAYTNQLRRLPPEHKLIFAFTTLAISLST-HSLVQILMVIWMSIWTVIYAKIPAGVYWRLLMFTIVFCLTSLPALMVTFGQFYLYISRSGSIQAWEIVTRSLASVSCLYFLMLTVPFTEILQTLRWLRFPALLTDLLLLMYRFIFILLKTANELLTAQNSRGGYSNWQTSMKSLALLIGQLLQRTLQQYSQFSLGLQARGFSGELRFWHPRRYRPSPRYTIEAICGCVLLI..... 256
224 1.000e-35UniRef50_A0A1Y4NQW3 Cobalt ECF transporter T component CbiQ n=1 Tax=Lachnoclostridium sp. An169 TaxID=1965569 RepID=A0A1Y4NQW3_9FIRM  ali  31  1........MIMIDSLCCRSRLRDKNAGVKSAFALITLVICIAARSFPVSAVVFVTNGVLTVWKGKIPASSXXXXXXXXXXXXXXXXXAFAIPAGRWYLTGSRHAVLEALELGGAAMASVTCLYFLALNTSVTDILGVLRALHCPSLLTELMMLIYRFIFLLMETASALMTAQEARLGNRNLRTGLRSFGMMGTALFLRSLKRANALYDAMEARCYDGEIRVLARKQPAEAGDILLTVLFEAALTGVMIW. 253
225 2.000e-35UniRef50_B4S8I3 Cobalt ABC transporter, inner membrane subunit CbiQ n=3 Tax=Chlorobiaceae TaxID=191412 RepID=B4S8I3_PROA2  ali  16  1.........MQLELFSGGKSLLHHLDARIKILIYLPFILLSALTNHTPQTLATLATGVVLLSIGQLWSRLLLQRLAAVNTFMLFVWATLPFSLAGGPFSISREGVDLAMLITLKANAIAILTITLLGTTPVIALSHAMLHLGVPTKLVTMFYFLYRYTGVILSEFERMKRMLQSRGFSPSGMHTLKTYAYFTGMLFIKSYERAERVYQALLLRGFTGTFPLLTHFTLTPKD................... 229
226 2.000e-35UniRef50_A8YXN4 Energy-coupling factor transporter transmembrane protein EcfT n=139 Tax=Bacteria TaxID=2 RepID=ECFT_LACH4  ali  14  7MCRGSLMSKIIIGRYIPGDSLVYKMDPRGKLLXXXXXXXXXXXXXXXXXXXXXXFFCFLAIIATGLKARVFWNGVKPLIGLIFFTSLLQLFFWHWWIFSISSYGVENAIYIFIRFTLIILISTVMTVTTMPLEIADAMEWLLKPDEIALVISIALRFVPTLFDETLKIMNAQRSRGADGGLIKRAKAIAPILVPLFIHSLETAIDLSTAMESRGYRGSAGRTKYRVLNWSKYDLISLAYFILLVGLLLIF 274
227 2.000e-35UniRef50_A0A0Q9R4L5 Cobalt ABC transporter permease n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q9R4L5_9ACTN  ali  27  61...............................................................SRVPVRYLAPRMVIEVPFAVFALLMPFIAHGPLGLTVSEPGLHAGVALLVKGTIGVLASLTLASTTEPQDLLRGLQRLRMPDLIVQIMGFMIRYLDVVTAELGRMMVAMRSRGCDPRSPRHWPTLARAMGALFIRSYERGERVHLAMLSRGYDGRLPS............................. 222
228 2.000e-35UniRef50_A0A257AL64 Cobalt ECF transporter T component CbiQ n=2 Tax=unclassified ANME-1 cluster TaxID=1046933 RepID=A0A257AL64_9EURY  ali  18  1.....MVEYPEIDLFSSLDSPIHRFDPRAKIVAFLCLIFSVVLVQDLRLAFAGLLGSLAFLAASRLPLRFVSQHIKWVSFFIVPFLLILPFTFRFYALKMTYEGLEYGVLVALRAYSAVVLVLPVVATTRFDLTIKALDRLKVPNMLVQMLMFSYRYIFVFVVEFQRTWRAMEARGFKLRTSPSLRTVGKALGTLFVRSYERGERVYQALRSRGYTGTRKTLVKFKMQARD................... 237
229 2.000e-35UniRef50_A0A2N2LHF6 Cobalt ECF transporter T component CbiQ n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-9 TaxID=2013732 RepID=A0A2N2LHF6_9CHLR  ali  20  35............DRYSERDSPVHRADARAKVPAAFAYILVISATRDXXXXXXXXXXXXXXXXXXXXGPWFVLRRTFLALPFVLAAVPLVFFTLPLLGWTASDEGIRAVATILGKSWLSVVVAVLLVSATPMVEILRALRWLRLPRILVATIFFTYRYFFVIGEEAQRMLRARDSRSGGGTVLWRARIVGHMAGSLFVRSLERSERVYAAMQARGYRGDHIFLADPPLPAAHLVGASAFVACAVLV..... 283
230 2.000e-35UniRef50_A0A177E9X7 Uncharacterized protein n=2 Tax=Thermodesulfatator autotrophicus TaxID=1795632 RepID=A0A177E9X7_9BACT  ali  14  5..................NSFLKSCDPRVKXXXXXXXXXXXXXXXXXXXXXXXXXFSLICLLLSGLSFFYYLKRLGLVNLFLVFVLITLPFTTPGEFLSASKEGVSLAFLIFFKSNLIILTTTALLSTSSIFELAHALHHLFLPSKLVQLLFFTFRYLHVIEKEFWRLKDAAVVRCFPRTNLFTYRTMAYLVGSLIVRSYDRSQRVYEAMLCRSFNGTFPVYHHFHLRKKDILFGIFGVTYLVAILIL.. 241
231 3.000e-35UniRef50_B2TKQ0 Cobalt ABC transporter, permease protein CbiQ n=30 Tax=Firmicutes TaxID=1239 RepID=B2TKQ0_CLOBB  ali  21  16........IYSIDFYAYQSQIGHWNSMFKVLFAFITLLFCIIADNFYVSLTIVFTMAFITIYKGGIHFREXXXXXXXXXXXXXXXXXXXXLNFHWFYLYSSNESIIKTLKIMMKAFGAISAMYMMTLSTSASEIISVLRKLHIPKLIIELMNMVYRFIFILLDVQCKMKNSAQSRLGYVDFRTSCYSFGSTAGNLLIVSLKKANAYYDAMESRCYDGEMNFLEEDK........................ 245
232 3.000e-35UniRef50_A0A1Y3PKY4 Cobalt ECF transporter T component CbiQ n=1 Tax=Bacillus thermozeamaize TaxID=230954 RepID=A0A1Y3PKY4_9BACI  ali  30  3.........LHMDTLAYTNRLRGLPPEQKLLFACGTLLIAL-LGHPLVQAGVFLWMSGWIVAYARIPLKTYGGLLSVISAFLMMSLPALCVSWGAYTIYLSHTGVAQALQVALRAAAAVSCLSFVLLTVPFAELLQVMRRMRVPPLLTELLLVMYRFVFVLLETAEQIWIAQVSRGGYRGFRQGMSDLGRLIVKLFVRTNERVQQLATGLSARGFTGQLQVVSAVGYQPSRRYAVEAMAG.......... 251
233 3.000e-35UniRef50_A0A095YBG2 Transporter n=12 Tax=Terrabacteria group TaxID=1783272 RepID=A0A095YBG2_9FIRM  ali  17  1......MTNITIGQYLPFDSFIHKLDPRVKIIGVFLYIITIFFVKDXXXXXXXXXXXXXXXXXXXXPFKAIIKSLKPLIFIIVLTGVINLVTTPGWKFSITEEGIYRTAFTILRLVLIILSTSVLTYTTSPMELTYGLEKLFSPGELAMMISISLRFIPTLFDEANKIKMAQMARGADGNVIDRAVSMIPLLVPLFINALKRSGDLATAMEARLYR.................................. 227
234 3.000e-35UniRef50_F6CPH2 Cobalt ABC transporter, inner membrane subunit CbiQ n=5 Tax=Clostridia TaxID=186801 RepID=F6CPH2_DESK7  ali  24  14................HSGSFMHRLDPRVKVVAVAGFVALSTMLTSRTALVLAVGFLLVLTAAARLHLRQLVSXXXXXXXXXXXXXPFWRWEWGILTLTATREGWQHALMLFLRVFAAVLAVNFLMATTGLRRVLEALSFFRVPAVFIQLIEFTIRYIYVVGDELRRMNTARAARGFVPGRLHTFRTLGQTVAVLFVRSWERGERIYHAMLARGYSGENRKRALPPPGGWDLAWGAFILSVAVGLRLF.. 259
235 3.000e-35UniRef50_A0A117S2Z0 Transporter n=2 Tax=Desulfitibacter TaxID=293136 RepID=A0A117S2Z0_9FIRM  ali  15  1.....MIKGISIGNYYVGNSLIHRLDPRVKILFSLSVIISLFLIDNYWALLWISGVYGYICLVSQLSFTYLVRGMKXXXXXXXXXXXXXXXXYHLGPISITREGLDRGVFMAYRLILLIGVSVILTATTSPLRLTDGLQNLLSPSELALMVSIALRFIPTFISETERIIKAQSSRGVDGNFKERLENLIPILVPLFISSFRRAEDLAIAMEARCYRGE................................ 230
236 3.000e-35UniRef50_A0B6P5 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360  ali  29  2........HRLLDDHAHDNGLRDVSPKLKLAIGAFSIMACIASPTPAVPLAVSACLSAAVILLARIPWRXXXXXXXXXXXXXXXXXXXXXXXXPGGALSLSREGLWLGMLLVSRTIGGTSSLFFIALTTPMTEIFSILRSMGLPETLVELSMLIYRYIFVLLEEAMLVHSAQEMRMGYTSIRGSISSFAMLASVLFIRAWERGERLMVAMDSRCYSGRMPV............................. 220
237 3.000e-35UniRef50_A0A255ICV9 Cobalt ECF transporter T component CbiQ n=2 Tax=Lachnotalea glycerini TaxID=1763509 RepID=A0A255ICV9_9FIRM  ali  24  20.........LDIDQYAVQSGLVDMNPDLKLLTGVLSLVLCLMSPNGITAIVVAVFMLYITLYHGKLKALQXXXXXXXXXXXXXXXFGFFNISILGGYLIVTQTSMKTAFLVSTRALCSITCLYMISLSTPLFEIIGVLRKYKVPEIIIELMYLIYRFIFILLEAYHNMKTAADTRLGYCNIKRSYYSFFGICSNLFVIAFQKASKSFDAMEARGYNGNLKFLEKDKPVKRLQIVFFLFYCFIMFMILVL. 271
238 3.000e-35UniRef50_X0Z508 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0Z508_9ZZZZ  ali  21  7..........................................................LAVASGGLSPLLVLRRSALALPFILAAVPLMLFTLPPFGWDASREGLVAVITILTKSWLSVTAAVVLTATTSAVDLVRALRSLAVPRILVATVSFMYRYIFVIAEEALRLVRARDSRSARGSGWWRAGILGNMVGSLFLRSYERSERVYAAMQARGYDGEPRFLWNPPWRAAEITLAVFIALYAAGI..... 207
239 3.000e-35UniRef50_A0A160FB38 Energy-coupling factor transporter transmembrane protein EcfT n=19 Tax=Bacillaceae TaxID=186817 RepID=A0A160FB38_9BACI  ali  17  1.........MIIGRYVPGNSVIHRMDPRAKLLLVFFYVGIVFLANNGVTYAILTAFTLLLLFLSQVPFLFVLKGIKPVLWVVLFTFLLHVFLYQIGPFAIYEGGIQQGIFISLRFLLFVLITTLLTLTDAIESLFGPLKRFRIPHELALMMSISLRFIPTLMDETEKIMKAQAARGVDGPLGERMKAIVSLLVPLFIHSFKRAEELAIAMEARGYRGGEGRTKYRVLTWK.................... 239
240 4.000e-35UniRef50_A0A2D5C7F4 Cobalt ECF transporter T component CbiQ n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2D5C7F4_9ACTN  ali  13  4..DTSHSHHLEI----HGDSTLRQLKPELKIFTTFCIVFSIAFLSLENNFLVFLQFLIVLYFLSKINIKTYFKRLSIDIPFILFALFLPFISFEIFSVSIYETGFNEMLSILIKITLCVSLAIVLTASTSNNEIIYGLQKLKLSPLLISILSFAIRYIDVFIDEFKRVRVAMKSRGYDEKGIKGLKPIAYASGALLIRGYERGERVYNSMLSRGFNGSIELKEREYKSSK.................... 236
241 4.000e-35UniRef50_F0S010 Cobalt ABC transporter, inner membrane subunit CbiQ n=3 Tax=Desulfurobacterium TaxID=64159 RepID=F0S010_DESTD  ali  14  4.............KLSQRQTLLHEIDPRVKIIVFLLFAWGIALTPDFKEALLFIPFVGILLIVTGKDALKALKPLLFANTFLIFIVLSMIFTYHFGFLSLSIDGLKYGLFLFLKSNEILILMLLLLSTSSVFSIFHALHHLKLPEQLTQLLFFTYRYIYTIKDEYNIMMKAAKCRGFKPTSIFTYKTFAYILGNLLVRSYRKADKIYKAMLCRGFKGAFPVYSHFSFSTKDIIFALLSTMFFLVVELW.. 245
242 4.000e-35UniRef50_E9RSR0 Cobalt ABC transporter n=1 Tax=Lachnospiraceae bacterium 6_1_37FAA TaxID=658656 RepID=E9RSR0_9FIRM  ali  30  1..............................................................MGGIPAARYIRLLCIPFFFLLLSTLTVVINFGTFYITAGKDTILFAVQIFCTAFGAVSCLYFLSLSTPMTDLIAVLERLHCPSLFIELMLLIYRFLFVLAELASSISTAQKARLGNRNFRTSFSSFGALLSVLFIRAIQKSGRLYDAMESRCYDGTIRVLHQQYPVKKKELFLCIGYELLLLYFSW.. 198
243 4.000e-35UniRef50_A0A2P8HKX0 Energy-coupling factor transport system permease protein n=2 Tax=Salsuginibacillus TaxID=427077 RepID=A0A2P8HKX0_9BACI  ali  22  1......MGSVLIGQYIRGSSVIHLLDPRAKXXXXXXXXXXXXXXXXXXXXXXXXXXTAAMLYIARIPFKTFLRSLRPMIIILSFLALAHAILFSFGWLSVYPEGIINAVEMVVRIILLVTIASILTLTTKPLEVTQGLEQLLSPEQFAFMASLTLRFIPTLLLEAEKIMEAQKARGVQKNPWKRLKSYIPIMLPLLTSAVQRAGRLTDALEARGYQPGAKRTRSRQFVYKQLDYGAFTIFGAVSAMLVLL 262
244 4.000e-35UniRef50_C7RE27 Cobalt transport protein n=4 Tax=Anaerococcus TaxID=165779 RepID=C7RE27_ANAPD  ali  17  1......MANISIGQYLPFDTFIHRLDPRVKIVGVFLYIITIFFVDDFYXXXXXXXXXXXXXXXXXXXXKSVLKSLKPVIFIIIITGLINLITTPGGPVTVTAEGIHRTAFTVLRLILIILSTSVLTYTTSPMELTYGLEKLFSPGELAMMISISLRFIPTLFDEAQKIRMAQMARGADGNIINRAVSMIPLLVPLFINSFKRSDDLATAMEARMYR.................................. 227
245 4.000e-35UniRef50_A0A2E3YH84 Transporter n=3 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E3YH84_9BACT  ali  20  3.....LLRDIAVGRYVAGTGLLHRLDPRTKLLSLVALMVAALASRDVAPVALFTVFVALVALVGRLPLNILLRNLRSFAWLIGVTALLHLFMTPGASLVVTDEGLSAAILFSLRLASLVTAASMLTLSTTPIALTDGLESLLKPHELAMMVSIALRFIPVLADEAERLQKAQMARGADGGPIRRARRLVPLLVPLFLSAFSRADRLAVAMEARGYRGGRTRFRPLQMGRADAGAAILVVLAVAGQIWL.. 265
246 4.000e-35UniRef50_C4XSL9 Putative cobalt ABC transporter permease protein n=11 Tax=Desulfovibrio TaxID=872 RepID=C4XSL9_DESMR  ali  22  6..............LARGVSPIHALDARCRLAACLLLSLPXXXXXXXXXXXXXXXXXXXXTLLSRPPLGVVLRRTAAVNVFVAFLWLFVPAVWTFHGLTVTREGLDLALLATVKANSVFFCVLSLLATIPAPALGRAMTALGVPAKFSFLFVFTYRYLHVIAEEYGRLVVAARLRGFPASNGRTYRTYAALLAMVLVRAYDRSQRVYQAMLLRGFHGRFPSLDRFRAGWPDRVF................ 232
247 5.000e-35UniRef50_A0A1Y4TSY6 Transporter n=2 Tax=Lachnoclostridium TaxID=1506553 RepID=A0A1Y4TSY6_9FIRM  ali  18  1.....MLRDITIGKYYNRTSVIHLLDCRTKLAGTLLYIIALFFVEDPAVYIPCLAYLLLLYRLAAVPWSYILKGLRGFALLLLFTFVFQSLLFSMGIVTVSREGLLKAVRLVSRIILMVLMASLLAYTTTPTQMAAGLEKVKVPHEMAMMVSIAFRFIPVFIEEVNIIMDAQASRGVDFHSGNVFKRMGPLVVPLFVSAIRRSADLAMAMEARGYTGSRTRYRELVYTSKD................... 245
248 5.000e-35UniRef50_A0A238XUE4 Cobalt/nickel transport system permease protein n=1 Tax=Desulfurobacterium atlanticum TaxID=240169 RepID=A0A238XUE4_9BACT  ali  16  10..................SLLHRIDARTKVLICLLFSFVCXXXXXXXXXXXXXXXXXXXXXXXXXKNLKDIFYTLLFADSFLFFIIITTTLTFNVGVFPLYIEGLKYGAFLFFKSNIILLTVIVFLSTSTIFEIAHALHHLKVPSKLVQMLFFTFRYLQVIKDEYNRLLKAAKARGFKPTNIHTYKTYGYIVANLLIRSYLKSDRIYKAMLCRGFKGEFPVYKHFKLKKEDILFATISVAYFLLAFTW.. 246
249 5.000e-35UniRef50_A0A1C5QLH0 Energy-coupling factor transporter transmembrane protein CbiQ n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C5QLH0_9CLOT  ali  27  1........MNQIDSIAYHSKLAWIDPKAKLCFSLVLLCVCIGCRXXXXXXXXXXXXXXXXXXXXRLSLRRYLHXXXXXXXXXXXXXLLAGIPIGGSQVGISAQSFLEGLRLCATALGAVGCMYFLSFNTPMTGLFALFRKSPLPEVVVSLMELIYRYIFVLWEEAATMKTAQNARLGYQGIRHSIASFGTLVGTLFFRAYQRCDRIYSALESRGYQGSLEALQEEYQPGKGWYGATFLTAAAALGIFFL. 254
250 5.000e-35UniRef50_UPI0003628229 cobalt ECF transporter T component CbiQ n=1 Tax=Geopsychrobacter electrodiphilus TaxID=225196 RepID=UPI0003628229  ali  24  51.............EFAGGDSPVHRWDIRFKLASFLFVAFLAVSLKHPQSAAVAVLLALIGNRMAAIPWRRGLKRLVGMTGFLSMFLLMLPLFNGLGWLTFNLRGLDLALLIILRAASVALLMEPLLATAPLPETLAGLSRMGVPQRISELLLISHRYLYVFMHEARRMQIGMDVRGFHATNMATLRSVGNYVGMLFVRSFERTERVHMAMLARGYQGTWPQPFRFKSCPADYL................. 283
251 6.000e-35UniRef50_E4T7K0 Cobalt ABC transporter, inner membrane subunit CbiQ n=2 Tax=Paludibacter TaxID=346096 RepID=E4T7K0_PALPW  ali  22  1........MHYFDCYPIQSRIRKVHPGYKLGWFVLYTVLGLSSHSVLFLGIELLVFLTITVFTVRISLWRLLRLMAIPAGFVLLGSLLFSLNTGAITFGVGEAGLQQGLFILFRSFSGIAVLYALVLNTSISDMIYVLRKLNVPEVVLDLMVLVYRNIFILSDTAQRIYIAQKSRMGHRNLKTSLRSTAQLGGSAFILAGVRAEQLFHSMESRGYTGRIYSLPAEWETNKK................... 234
252 6.000e-35UniRef50_Q58489 Uncharacterized protein MJ1089 n=12 Tax=Methanococcales TaxID=2182 RepID=Y1089_METJA  ali  27  98..........................................................................................INVFGFEIPVYKDGIELGLLLFGRMLGGVSSMLFLAFTTPMVELFYIFRELKMPDVLVDMMMLIYRYIFVLYEEYEKMKFAQESRLGTSNLKSTYKSLGALAAHLFIRAWEKGEKLNITMMSRCYDGKIKLLQTIENPSIKYILFIAIFDIFLIILAYL. 256
253 6.000e-35UniRef50_UPI0006B63A93 cobalt ECF transporter T component CbiQ n=1 Tax=Niameybacter massiliensis TaxID=1658108 RepID=UPI0006B63A93  ali  27  1........MKVIDQYAYRSPLRHFDPVQKVLFSLLVLITCLIEHSLLLYITVILLMGWLTVRKGLTPIKXXXXXXXXXXXXXXXXSFLWSIHITHMYMGISKGSIEICLFMFFKVFASVSCLYFLCLSTPMNDILRVLEKWHCPTFLLEIMSLIYRFIFVFIDTATTMYTAQVARLGYRNFHLGIRSFGMLLSTLLIRTLKMNNVLYTSLECRGYNGSFNVLHE.......................... 229
254 6.000e-35UniRef50_UPI000C0721D8 energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Neglecta sp. Marseille-P3890 TaxID=2014781 RepID=UPI000C  ali  16  1......MMDITIGQFFPGKSIMHKIDPRLKICLTIFSXXXXXXXXXXXXXXXXXXXXFIGMLISKVPVKLYLKSIRAVIFIVVFTSLLNVFYAQFWVFKVTVNGILNSVFISTRIISLILASSVLTFTTSPTQLTDAIERLLKPHEFAMIMTIALRFVPLLLEETDKIMQAQKARGADGGMVQRIKAMIPVLIPLFVSAFRRAYDLATAMESRCYHGG................................ 229
255 6.000e-35UniRef50_A0A2E6I275 Transporter n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E6I275_9BACT  ali  21  20.....LSKAITFGRFVPGNSPLHRLDPRAKILTLSLWIIALTLTARSPMLVGALLVFIVAARLGELPIRLLLGNFKPLMPVLLLTLAFNAWLIEGQAIVLTIEGLERGLFLCLRLSVIVVGTSLLTLTTSPEELLKPLERLKLPHELALTGTIALRFIPYLTDEAGRIYNAQRARGFSGSLINRARRLVPLLVPLFVAAYARADRLAVAMEARGYGGRGRTRYRMLKMSGLDL................. 265
256 6.000e-35UniRef50_A0A1X7MQY1 Cobalt/nickel transport system permease protein n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1X7MQY1_9RHIZ  ali  20  22.......................RVDPCMRLAAALLFVAVLAFLRSPAPLTVALATGIAAVSWARPPARSTLRRLAGVEGFLALFLVSLPFTFSLFGYPASREGLERALAIVVRVNAAALVIAALISTMGTMRLASAMAGIGIPARIAHLFQLTVRYIGVFHEEYSRLRRAMMARAFRGSNQHSWRTLGNLVGMLLVRSIERAERVSWAMKSRGFSGSFPDFDQQRMQAADIAFCATWIGVAAALVVL.. 253
257 7.000e-35UniRef50_D5VRL5 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Methanocaldococcus infernus (strain DSM 11812 / JCM 15783 / ME) TaxID=573  ali  24  5...........LDYIAHNNKLRIVNPKLKILYTFLTLIISLFSKNIFVPFIAFLVSSYLIIFRARVPVKXXXXXXXXXXXXXXXXXXXXIVIFKIFFITFKLEGLKQGILIFFRILGGVSTMLFLALTTPIIELFYVLRRY-LPKEFIDIALMMYKFIFDLLDTFLTMKNAQETRLGYKDVKTSYKSLGMLMSNLFIRTYEKSEKVYISMASRGYDGDIRILTELP........................ 224
258 8.000e-35UniRef50_D9QVQ9 Cobalt ABC transporter, inner membrane subunit CbiQ n=6 Tax=Halanaerobiales TaxID=53433 RepID=D9QVQ9_ACEAZ  ali  14  4............EKFTEGSTWVHQLDPRIKIVITMMLAVVTAVGKNVDMLLVAFGFSGLLLITARLDIKKVGKRXXXXXXXXXXXXXXXXXLFQVGPLIASREGVIYTAKITLRSNTIMLIMISLLSTSAMSSIIHAMKYLYIPEKLIYLLFFIYRYIHVIKTEFGNLYSAMLLRGFKPNTIHCYKSYAYLVGRLLIKSYERSQRVYEAMTCRGFKGKFYILDNFNLSSLDYLVFVGSLFLVSCLVML.. 246
259 8.000e-35UniRef50_A0A2D6N6V6 Cobalt ECF transporter T component CbiQ n=1 Tax=Dehalococcoidia bacterium TaxID=2026734 RepID=A0A2D6N6V6_9CHLR  ali  36  1......MHPFPIDLYAYSNRLRGAHPAEKFLFSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAFWNFIRLPAGFIALGVLTLVFPVGTWHIGATWSGLERAARVASVSFACVASMLALALTTPMVDITDQLRKWRVPQVFIELMVLIYRFIFVFIETAQAMYIAQNARLGYSNWRRSLRSAGILAANLYLRSQARASALFTALTARGYTGELRVLTAEPTWSSRN.................. 240
260 9.000e-35UniRef50_A0A238ZE77 Cobalt/nickel transport system permease protein n=1 Tax=Desulfovibrio mexicanus TaxID=147047 RepID=A0A238ZE77_9DELT  ali  20  6..............FAEGSSFLHRADPRAKLALAVALACTLAVCTGWRGPVLGLCAGMVLVVWARLRWRPFWRRMLTINGFVAFLWVFLPFTTPGGPLDITAQGIAASLLISLKTNAISLCFLSLVATSDAASLGQAMHRLHVPDKLVFLFLFTYRFIHVINDERLRLSTAARLRGFRRSDAHTYRTLASLLAMVLVGAMRRAEVTRRAMLLRGFSGVFATMRTFRMGNKERCFLAGGAALTAFIAFL.. 246
261 9.000e-35UniRef50_A0A2N2AQL9 Cobalt ECF transporter T component CbiQ n=20 Tax=Firmicutes TaxID=1239 RepID=A0A2N2AQL9_9FIRM  ali  28  1........MLNIDGFAYNNRLRHVHPLEKAGFAMITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIYLKXXXXXXXXXXXAGWLAGITVSGITVGLTYNGLATAGGLFCKSLGAVSCLYFLSLTTPAVEMTAVMRKLKIPSLFIELTDLVYRFIFVMLETADDIYISQSSRWGYASLKTSMKSLGQMTAALFVKALHRSRMLFIALSSRGYTGQINVLAPEYTVSVNNIILIAVIESTLLITAVLL 257
262 9.000e-35UniRef50_A0A2N3KUW5 Cobalt ECF transporter T component CbiQ n=20 Tax=Thalassospira TaxID=168934 RepID=A0A2N3KUW5_9PROT  ali  18  36.........................DPRVKIAATILLAITLVSFASWQPLVASIAITALIIASSSPDWRKTLRRILAMDGFILITLVLLPFTFPGWGFDASWQGLYRAIMIALKANAVMCGIIAFLGNLSSTELGRGMTGLYLPTKLTTLMMFTVRYIDVLHHEYLRLRQSMRARAFRKTNRHSWKMTGYLVGMLLVRAHERSERILWAMKCRGFHGHYHFAHLPRPTRRD................... 248
263 1.000e-34UniRef50_A0A1M4YLF3 Cobalt/nickel transport system permease protein n=1 Tax=Caldanaerobius fijiensis DSM 17918 TaxID=1121256 RepID=A0A1M4YLF3_9THEO :  ali  29  1.........MPIDRYAYINRLRHVHPGEKIFFAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXRFYLKLMSLPLTFLFMGIITILFGTSNIYIGLSKKGVATGILLFSRSLSIVSCLYFISLTTPMPEFMSVLKKMKVPSLLLDLMELIYRFLFVLIETAEQIYISQDSRLGYISFKTALNSLAYLISVLFIKSYTNAEQLYIAMESRCYNGDIRLLENSYKIS..................... 232
264 1.000e-34UniRef50_A0A1V4MQX4 Uncharacterized protein n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MQX4_9DELT  ali  16  4............ERFASGKSILHSADPRVKILLAVIYAFVIVGLESQVGQILALLGGLILVMAARLSLKEIFRRXXXXXXXXXXXXXXXXXXXXWGSVIITFEGINLAFSITLKCNAIILTNLALLSTSTIFSLAHALAHFRVPSKIVQLIFFSWRYFHVIDSEFHHMNQAIKVRGFKGSNLHTYRTYGHLIGTLFIKSLERGERVQKAMLCRGFDGTFWLLSHFRLRPSDICLGGLATAYLFFVIGV.. 246
265 1.000e-34UniRef50_A0A1M4MMF2 Energy-coupling factor transporter transmembrane protein NikQ n=17 Tax=root TaxID=1 RepID=A0A1M4MMF2_9EURY  ali  17  4.......DLYFIEKYAYRTSIVHRLDARIKLLIALAAIVTIVSTRVYELGAVLFALVAALWAASRLPPTVYLKRLALILPFGIFLIGFQAFVKNPFGIEVYAESVEFASILLVKFVVSVSFIILLSSTTKMQDMIEAAGRLGLPREFTLTLAMMVRYIFVFAEMFTRIRTAMATRCFDPSYRYRLNQLGYTVGTIFIRSYEQGERTYTSMLCRGYGANAGLYVRKKPLR..................... 246
266 1.000e-34UniRef50_V6IZ78 Transporter n=5 Tax=Sporolactobacillus TaxID=2077 RepID=V6IZ78_9BACL  ali  19  1.....MPRDITVGQFLPGHSIMHRLDPRTKIVLTFFFIIQVFISKSAISLSFLIALLGVFIACSQVSPGKVFKGVRPMIPVIIFTAVLNIFYLSFSIFHITKQGLFTGFTLMVRLTALIAGCSLITYTTSLNTLAAGLEQLLSPGELSMTIAITLRFLPTLADEFDRIIDAQKARGGSGNFIKRIKSYFPVILPLFMSAFRRAFELTNAIECRCYRGG................................ 230
267 1.000e-34UniRef50_A0A162T674 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Clostridium magnum DSM 2767 TaxID=1121326 RepID=A0A162T674_  ali  15  1......MKEIKLGQYIRGTSLIHKLDPRAKIIYCLFIVCSTIINSDWLIILVNICTLILAIILSKINIFKFFFRMKSLLLIFMFTLFFQAILFHIWKLSFTKEGIYQGILTIFRLIAIYLCSTILTMTTSPMNLIFGLEVLFSPLKLAMIISIALRFMPTIIEEVDNIKCAQKSRGAQGNLLVRLQSVLAVLIPILANSLQRANDLAVAMESRCYDCKSSSKVSYNVPYKRMDIIVIGGVIINLVVCFII 261
268 1.000e-34UniRef50_UPI000A05B570 hypothetical protein n=1 Tax=Desulfovirgula thermocuniculi TaxID=348842 RepID=UPI000A05B570  ali  34  90..........................................................................................FSVLGLAVGTSYADLYRAGLILVKSLGATSCLYFLALTTPVIEVACFLRKARLPALWVELFCLTYRFIFVIMETAEKIYLSQSARWGYASLQNSYRSLGQLVSVLLVRSLYRSRALYTALLARGYDGELQVLEERFEVSGKNWAFITGTGAVLLFLAL.. 247
269 1.000e-34UniRef50_A0A1D2X161 Cobalt transporter n=1 Tax=Methanosphaera sp. WGK6 TaxID=1561964 RepID=A0A1D2X161_9EURY  ali  19  11............EYLSNQDTVLHNIDSRIKLIVLVLIILFAVSSNNYITFIMLELYLISLILISRIPLKDALIRVLVILPFGLFIAIFQPFIQPGLGINITIEGIVFAELLMARLIISITSIVLFSYITPMKDVAEAFRRLHFPNEFAMIFSLFVRFIFLFYDELTSIRQSQTSRCFDFRNKWKLKQVGYLFLMMFLRAYERGETIYNSMASRGYTSESKIYS........................... 232
270 1.000e-34UniRef50_A0A1Q9JZE4 Cobalt ECF transporter T component CbiQ n=2 Tax=Roseburia sp. 499 TaxID=1261634 RepID=A0A1Q9JZE4_9FIRM  ali  26  1...........MDFYAYQSGLRQWNGGYKVLSALLILILCIGLDDIWVSVTVIVTIGMLNVIGNRVPLRQYVELMKIPIAFLILGCIAIAFSLHWFYLYFMKADIRKAVELFLKALGAVSAMYMMALSTPAGELINVLRKAHVPKLMVELMNMIYRFIFILTDVQGRMKRATVSRLGYVDFKTSCSSFGKIAGNLFILSLKKADTYYDAMVSRGYDGEIMFLEEEKK....................... 228
271 1.000e-34UniRef50_A0A087ASM1 ATPase component of ABC-type transport system n=15 Tax=Bifidobacterium TaxID=1678 RepID=A0A087ASM1_9BIFI  ali  19  517...............AEGSGPLGTLDPRVKMVTFLVLMFTAFAISNAWQLGLAAALTAGIIAVGRLNPLRLLTAVRLILGMLVVVGLLNLFFAAWGPLTITTGGVQTAALYTLRFALVIVLGAVMMATTTPTALTDAIGSLLSPQEIALVLSLALRFLPTLAREAHAVIDAQSARGGDGSPAKRLRALTAIVVPVFAGTLRHADNLALALDARCYEGAHRTHWRRMRVRRRDLLFVTVAMLYLFALM... 767
272 2.000e-34UniRef50_A0A2E7D564 Cobalt ECF transporter T component CbiQ n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7D564_9PLAN  ali  27  1........MSFVDRYGRSSTVCHRLPAVKLWLAISIIAVGVSLPTEFWPLGLLACVVFCGLTLARVPMSYLLRRLALFLPMLFVLSISLPASQGF------QGGWDIMAKIIIRSIVAFTTMLWLINVMPFDELLVSLRRLRVPDILLATLSFMYRYIYVLWDELEKLTTARRARSFANDRRWSWRTSAQMIGMLLIRALQRAERVHGAMLSRGWNGQAHYLPSQSRGR..................... 218
273 2.000e-34UniRef50_G7WC31 Cobalt ABC transporter, permease protein CbiQ n=16 Tax=Clostridia TaxID=186801 RepID=G7WC31_DESOD  ali  27  1........MNDIDTYAYHNNLITVHPGEKAFFAMITMVVCLSXXXXXXXXXXXXXXXXXXXXKAGIPTRVLFKXXXXXXXXXXPLGFWLAYSMKGLTIGIRYPDLITAVNLFLRSIGAVSCLYFLALTTPLTELISILHCLKVPFIITELMVLIYRFIFVFLETATTIRRAQVSRSGYVTMKSSFRSMSRLFSALLGKVFIKSQELYDSMSARGYTGEIKVLNKKRPVNLRNYGIIIGLEIPLILLNLL. 255
274 2.000e-34UniRef50_A0A1W9SIU4 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium 4572_119 TaxID=1971636 RepID=A0A1W9SIU4_9BACT  ali  15  3.....FIQDITLGQYYPIDSFIHRLDPRTKMLCIISAMIALFAAHHVFELGISFALLLSVIFISRIPSKVILRNLKPFFLLFVLSLVFHVFTVPVLGASITKEGLYRGLIYSVRLAELVLLAATLTLTTSPIEITDALDRFFLPHEFVLMMTLSLRFIPTLISEADKLQKAQISRGFEGNIVQRVKSVIPLIVPLFISVFRRADELAMAMDSRCYIGGKNRTSFKNLEYK.................... 246
275 2.000e-34UniRef50_B8E1G4 Cobalt transport protein n=3 Tax=Dictyoglomus TaxID=13 RepID=B8E1G4_DICTD  ali  15  2....EVLKTFPIGQYIPANSILHGLDAKAKIIASFWLIVFIFLIRLNXXXXXXXXXXXXXXXXXXXXXKYFLRSLKPVYFLVLFTFIIHFFFWRFGIIHITELGIKMAIFMSLRLIFIVMITSLLTLTTSVLELAQALEDLLKPHEFSMMMTIAIRFVPTLLDETDKIIKAQKARGGKGNIVNQAKSLLPVIIPLFVNAFRRANELAEAMESRCYRGEGRTRYRRTYWTLKETSFIFFIGIYSALLLIFF 267
276 2.000e-34UniRef50_A0A1D2WL48 Cobalt ECF transporter T component CbiQ n=2 Tax=Methanobrevibacter TaxID=2172 RepID=A0A1D2WL48_9EURY  ali  26  5...........MDYIAHNNALTETNPYFKLFLTIILLIVTLAFDNLYFDVTVFVIMSIVILTIAKINYKSYLKXXXXXXXXXXXXXXXVIYETGILGIVVTTDSWHYGVYTFMRVLGCLPCLGFLALTTPIAKILNCLRTLKVPKILIEIALLMYNSIFIFLNEIDTMQKAQETRLGYHSYWSSFSSLGALVSIIFLRSLDKSETLQYSLDSRGYSGELPVYEPKKR....................... 229
277 2.000e-34UniRef50_A0A117SB94 Uncharacterized protein n=1 Tax=Gracilibacter sp. BRH_c7a TaxID=1734398 RepID=A0A117SB94_9FIRM  ali  21  2........NNFFEQLSNKQTIIHELDTRVKIISVVGFILISSSLQSFLGLAVGAAFLMIVLKLVGTPISPILRXXXXXXXXXXXXXXILAWQLGTLKISATQEGVDKAILLFLRLLSAVLAVTLLNATTGFREVINGFRKLHMPNILVSIIEFTVRYFFVLGDELTRMKLARKARGYDLNNRKALMTITQLIAVLFIRSMERAERVYCAMLARGYGGHRPVKRSERVQMADILWGIGFVCFTLSIKLL.. 261
278 2.000e-34UniRef50_W5W2U9 Cobalt ABC transporter, inner membrane subunit CbiQ n=8 Tax=Actinobacteria TaxID=201174 RepID=W5W2U9_9PSEU  ali  26  14..............IPADTPLHRAAPQCKVAATALCVLFVACTPKXXXXXXXXXXXXXXXXXXXXXPATTLLRRLVVEIPFVFFVVLLPLLATGPLGVHLSVDGLESAASIVLKASFGLLATGVLAATTPLAEIITGLERLRVPRVFTAVASFMVRYVEVLNTELARLRTARACRGGDPRWLWQARDTAACVGALFVRAFERGERVYLAMASRGYNGALPT............................. 225
279 2.000e-34UniRef50_A0A0F4VXZ5 Transmembrane component NikQ of energizing module of nickel ECF transporter n=5 Tax=root TaxID=1 RepID=A0A0F4VXZ5_9CLOT  ali  17  24....................VHSLNPLSKMIVTIMFLFAVASVDKYDVSMLIFIFYPIILVELSDIPKKILFKRVIITLPFCVVMGILNLIFFYIGGIPITY-GILSCSTIIIKVVLTVTSVYILVATTSMEDIFSSLRKIKIPKIILVQLLLSYRYISVILKETNSMYTAYSLRSGNRKGIN-LEHMGVFLGQILLKSFTRSEEIYMAMKCRGFDGFYTVVYEKKFQLKDYAYICILCISFVLIRMI.. 255
280 3.000e-34UniRef50_R4KJL4 Cobalt ABC transporter, permease protein CbiQ n=2 Tax=Peptococcaceae TaxID=186807 RepID=R4KJL4_9FIRM  ali  26  1........MLLIDHFAYNNRFTQVHPGEKALFFVLTMSVCLFLPSLXXXXXXXXXXXXXXXXXXXXXXKFYGKXXXXXXXXXXXXXFLWGTYLGDYAVGITKAGLDTAVNLFFRSLGAVSCLYFLSLTTPMTEMVGLLRKLRVPALVVELITLIYRLIFILLEMAGQIYTAQSSRLGYRSMRTGFTALSQLILSMFIKSYRQSQNMYDSLVARCYDGQLHFIEDKRNWS..................... 234
281 3.000e-34UniRef50_A0A1V5KHW6 Energy-coupling factor transporter transmembrane protein EcfT n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5KHW6_9BACT  ali  18  2....ALFTDITLGQYFPADSPVHRLDPRTKLLAGMLLMTGLIISVHGLVLLALTLTLLTTIYLAKLPGRLVIRNLRPFLWLFLLTLFIHLFWTSGLNLDITWEGLQLGLRYTIRLSLFIVLATILTLTTSPMEIMDALERFGRPHELTMMLSLSLRFIPTLLEEALRIRNAQLSRGFEGSLVNKVRNMVPLILPLFISAFRRADELAYAMDSRSYNGGRTSYSRLCFRWPDGLTLAAAALIFVACLYV.. 265
282 3.000e-34UniRef50_A0A1G2WA87 Cobalt ECF transporter T component CbiQ n=1 Tax=Desulfuromonadaceae bacterium GWC2_58_13 TaxID=1801896 RepID=A0A1G2WA87_9DELT  ali  31  1.........MLLDVYAYGNRWRYLNPAEKGLLTGLALVAALMARSPLAAGVVFACMTALTIGGAGIPLLAYLRXXXXXXXXXXXXIPLGTLPWVGLPVFLSKAGLVQAALVLARSLGAVSALYFLALTTPMTEIIGLLRRLRVPALLLELMVLAYRQIFVFLQIAREMRTAQASRLGYGTLGNGFRSLAALGANLYLRAHQRSMLLHRSLVCRGYEDDLRWQERDYPRSTRN.................. 235
283 3.000e-34UniRef50_A0A1V5VGA7 Cobalt transport protein CbiQ n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VGA7_9BACT  ali  22  3.............................................SPRAFAAYFSAVVLISIALRAPFSVFLKRLIVVLPFVLFIAASAPFALFGGALLVTDRGIEAFANAALKGALGVCALTALSLSTPFHEMLAGLRWFKVPAILVSLAAFSYRYMFVLVDEASRMKRARDSRGWRGRWIWQSGVVGNMIGSLLLRSLERSERVYSAMLSRGYDGNLPMAELPAPRLTDFIVAVVFFSAIMSARLFL. 216
284 3.000e-34UniRef50_A0A261QFS2 Cobalt ECF transporter T component CbiQ n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A261QFS2_9BACI  ali  22  1.........MIIDYYANYSRLSHLHPGEKAAFAFSHLLLVLFTKEIALSVYVFVLMGVVSVSYANIPFRTYRKXXXXXXXXXXXXALVQTISVAGWFMYVSYSSLQQAVLLCVFAYAAVSCMYFFILTTPFHGIATLLRLLRLPEVFVELTAVTYRFIFVFIEKAAETYNAQRSRAGYNDLRSTFSSISMLVANLFVQTMREAKDVQMAIDARGGSEVEAGQMISYPVRRDLWGAITVCLLISCMVVYVF 257
285 3.000e-34UniRef50_Q5WLN1 Cobalt ABC transporter permease n=13 Tax=Bacillus TaxID=55087 RepID=Q5WLN1_BACSK  ali  18  6.........LLMGQYRPSESFVHRLDPRSKXXXXXXXXXXXXXXXXXXXXXXXXCYFAAAIASSKVPLPVLAKSLKPIIWFVIAFALLQVIVFHLFGWPVYAEGLAEGGILAWRTLCLFLAATLLTMTTSPLHITWAIESLLKPSDLAMMMSITLRFIPILSGELHMISRAQAARGIDQPFMKRVLAYMPLLVPLFVRSLKRAEELAQAMEARGYNRERSSWKTNQWAFKDTYALLVSATVAFLLAWF.. 264
286 3.000e-34UniRef50_F0SVT1 Cobalt transport protein n=1 Tax=Syntrophobotulus glycolicus (strain DSM 8271 / FlGlyR) TaxID=645991 RepID=F0SVT1_SYNGF  ali  13  1......MQNITLGQYYPTDSFIHELDPRTKIISILMYIAGLXXXXXXXXXXXXXXXXXXXXXXSKIPVKSIIDGFKPLVLVIVLTLGSNIFLFQIGFIKVTQEGIVRTLFVGIRLLLLIIGSIMLTLTTKPIKLTDGLEKLLSPHEIALLFNLAIAFIPTFAEEIDKISKAQIARGANGNLYTRAKNLLPLLIPLFVGTFRRASELAMAMEARCYSGGNNRTKELKLESKDFIASLLAASFLTLVIL... 261
287 3.000e-34UniRef50_A0A0X3BKP7 Cobalt/nickel transport system permease protein n=25 Tax=root TaxID=1 RepID=A0A0X3BKP7_9EURY  ali  18  4.......DLYAIEKSAYRDSVIHRLDARVKLVIALAGIVAIVSTRVYELGAILFAFFIVLWICSRLSPLVYLRRLLLILPFGIFLIVFHPIATLPFGIEIYAESVEFASILLVKFIVSISFIILLSSTTKMQDLLEASGRLGLPREFILPLGMMIRYIFVFAEIFGKIRSAMDTRCFDPPYRYRLRQLGYTVGMLFIRSYEQGERTYMSMLCRGYGEGAHLHIRSKPIGAK................... 248
288 3.000e-34UniRef50_UPI0009FC01F3 cobalt ECF transporter T component CbiQ n=1 Tax=Terasakiella pusilla TaxID=64973 RepID=UPI0009FC01F3  ali  20  22...................TWVNRTDPRARVIAAVLFACCVITLDXXXXXXXXXXXXXXXXXXXXXXXXSTMKKVLTMDSFIIFMLLMLPFTTPGGSWEATKEGVLKAVEIALIANAVVMAMLALVGTIDAITLGHALNRLRVPENLVHLMLFSVRYIDVLKVEYFRLRNAMRARCFKGNNLHTYRSIGYLLGMMLVRSLERSERILAAMKCRGFNGKFYLISNFHFQKRDRIF................ 243
289 3.000e-34UniRef50_Q8RD06 ABC-type cobalt transport system, permease component CbiQ and related transporters n=22 Tax=Thermoanaerobacteraceae TaxID=186814 RepI  ali  14  16.....FEDLFYSDEIAAKKGLMQSLDPRVKLLSILLLIVIANFGKSILFLSVFAIYTVVLAFLSKIPLKAYIKRVAVISIIFTGIILLPPLIYFGKNLYITKEGALASLTLMMRSFVSLSFVYILSLSTKWTDILKAFRSFHLPQVFTTTLEMAFRYIFLFLEVSLNTFLARKSRNGKIKGKDGRKFVASVIGSILIRSNELTEEVYKAMVSRGYRGEYKTFSSFKMTPWDYIWISSNLIFIIALF.... 267
290 4.000e-34UniRef50_D8IIP4 Energy-coupling factor transporter transmembrane protein EcfT n=77 Tax=Terrabacteria group TaxID=1783272 RepID=ECFT_LACFC  ali  16  1.....MNSRVLFGSFVPVDSVLHRLDPRLKLVTCFWYVVIIFFAKGPLTYLLLVAMLGAMIGLSKVPLKMYWAGLKPLLWVIGLTIAIQVLFWHWGLMAITSGGINQXXXXXXXXXXXXXXXXXXXXTTPPLRLADALKKIKVPNQIAMMISIALRFIPTIMDEVNTIVKAQQARGVDGSVYTRVKRMVPIMVPLFVGAFRRAEDLAVAMEARGYDPDQERTRYRQLTWRR................... 244
291 4.000e-34UniRef50_A0A2K9ETN3 Energy-coupling factor transporter transmembrane protein EcfT n=2 Tax=Herbivorax saccincola TaxID=1677857 RepID=A0A2K9ETN3_9FIRM  ali  18  1.....MLKDVTLGRYYPGSSLLHRTDPRIKIILTISLMITVLFTKSYVAFGILALFIFFGIKHAGIPMSFTLRGLKPVVYIIIFTALINVFLTPGGFIKITFEGLDRAFKLALRILLLMAGTSLLTLTTTPIALTDGIEKLLKPNDFALIISISLKFVPVLLDETNKIIKAQASRGVDKNPVKKLKNYIPVMVPLFINTIKRADELSLAMEARCYRGEGRTGLRKLKLTARDILVLLFVLAFEGMLLYV. 262
292 4.000e-34UniRef50_A0A089ZIB5 Cobalt ABC transporter permease protein CbiQ1 n=25 Tax=Methanobacteriales TaxID=2158 RepID=A0A089ZIB5_METFO  ali  21  2...HSMFEN-TLDNYAHSNGLRETNTLFKVIFAIATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIPWKFYLKXXXXXXXXXXXXXXXHILDLGIFNLAVTQDGFNRGLLLFSRVLGGFTCMAFLALTIPMTELFSELERFKIPQIVVELAMLMYRYIFLFLDEGINMYHAQETRLGYSSLKKSFKSMGMLGSNLFIRTWIKGEQAHIAMESRCYDGSIKTMKEPRTIGARNLVLLTLFEVGLVIGLYF. 258
293 4.000e-34UniRef50_K4LD88 Cobalt ABC transporter, inner membrane subunit CbiQ n=8 Tax=Clostridia TaxID=186801 RepID=K4LD88_THEPS  ali  30  1........MLKIDQYAYTNRLAGMHPAEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRAGIPLRFYCKXXXXXXXXXXXASFLWSVRIGGYAVGVTASGLQQAGELFLKSLGAVSCLYFLSLTTPLVEVLAVLHRMRFPSLLIELMSLVYRFIFVLLETADKIYISQSSRWGYASLKTSYRSLGQLLSSLFGKAYYNSQMLFLALSSRCYTGKLNLLERPLTFSRKN.................. 237
294 4.000e-34UniRef50_A0A1T4KIW0 Cobalt/nickel transport system permease protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1T4KIW0_9FIRM  ali  25  1........MLIIDKYSYINELRKYSPMVKFYFAIGLMSFGMIMNHYILYGIIFLVNFILITKGAKIPVNKYIKFLCIPFSFLFLGMIPLLLSFGRMYFGITKQGIQEAILLLFRSLSCISCTFFLILTTPMNDLVRVFQKHRIPFLVIELMVLMYRFIFILLEEFHNLIIAQDLKLGYINIKSSYRSVSILVVCLFHRVMDRYQCLQYSLEARGFNGKFYM............................. 226
295 5.000e-34UniRef50_A0A1Y4DIC5 Cobalt ABC transporter n=4 Tax=Olsenella TaxID=133925 RepID=A0A1Y4DIC5_9ACTN  ali  24  5.........IEIGQYYAVDSPVHALDARVKLCCALVALVAVFCSANATQLGASAAFTLGVLVAARVPGGRVIASVRPLVAFLAVLSLFNLVFVTLGPLTVTTGGAWAAVLYTARFAVALVLGSLVLLTTTPTRLADALDSLLSPHEIAMVFSLMLRFVPMLADEASAIMDAQALRGGGGGPAQRVRSIAPVVVALLASGLRHADGLARALDARCYEGGGRTHFHEQPLARRD.................. 246
296 5.000e-34UniRef50_C8W417 Cobalt transport protein n=2 Tax=Desulfotomaculum acetoxidans TaxID=58138 RepID=C8W417_DESAS  ali  16  1.....MREGISFGRYLPGNSFIHFLDPRAKLIASLFIGASVFLAESWFKLIALSVISIVIVYLSEIQPKXXXXXXXXXXXXXXXXXXXXXXXXXWGWFKVTREGISLGGMLLLRMTLVMTLASVLTFTTSPVSIAGAMEMLLQPHELSLMMTVAIRFLPTIYGEAVRIINAQKSRGGQSGIAGIYKTVIPIIVPLFAGVFRRAEELALAMEARCYGGEGRSSYIQYKYNKKDYIVISVGLLILFLAVW.. 261
297 5.000e-34UniRef50_UPI0002DDBA66 cobalt ECF transporter T component CbiQ n=2 Tax=Firmicutes TaxID=1239 RepID=UPI0002DDBA66  ali  18  5..TKSMYGLRYFDETAQNDTVIHLNPLVKLLVSFFYILTAVSFNKYIVSLIPLAIYPSIVFNLGDIKVMPVLKRSLLVLPLILLVGISNPITVVIFENVVVSRGILSYISLIIKSTLSVICGMLLIATTSVDDIAKALGSLHVPKIFIMVFLLTYRYTYVLIEEFSTISTSYFLRAPGQNGIH-YNLWGPLLGQLLMRTYDRAQSIYSAMCLRGYQGEYYSTKNI-FRINDYVYLILWDVFLFLVRFY.. 254
298 5.000e-34UniRef50_A0A235B3M0 Energy-coupling factor transporter transmembrane protein EcfT n=6 Tax=Firmicutes TaxID=1239 RepID=A0A235B3M0_9BACL  ali  20  7..........ILGQYVPGRSPVHRMDPRAKLLFVFVYMFLVFLANNSWTYGLLAGVTGMGLILSRVPLRIILRGLKPILILIAVTAFLHLWWFQWGPIAVYEQGVVQAVWISCRFLLLVLTGTLLTLTTGMERMLAPFTRFGVPHELALMMSIALRFIPTLWEETEKIIKAQKARGADGSLIRRVKSYIPVLIPLFISAFRRADDLALAMEARGYRGGEGRTRLRKLKFK.................... 244
299 5.000e-34UniRef50_A0A1G3D6R7 Cobalt ECF transporter T component CbiQ (Fragment) n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3D6R7_9BACT  ali  23  1........................................................SFSLLLTVKIPFTAILRSMLLPLSFAVFILLILSLSIVGYKLVLKEEGLWNGLQTCSKVLGGISLVILLSFNTTISQLCAGLKWFRVPNTIIDLLALMYRYIFLFLDEVDTMWTAQRTRLGHTSWKNTIKSFGILGGMLVIRAFARAEQTYEAMHARGYEGGGILTATLPPWRKKEYVFVIGIVLVLSFLIY.. 202
300 5.000e-34UniRef50_A0A081BTK4 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A081BTK4_9BA  ali  24  1.........MLIDTLAYTNRLRAAHPGEKMLFALCTLFGALLTDSIGXXXXXXXXXXXXXXXXXXXXPRVYGKLLLIPATFIVMGAIPLLFNIAGYWLYVTLASFQRCSVIILKSLASISCFYVLVLSTPVNDVLYLLGKIGVPALLVEMMSLVYRYLSVFVETVSQMYLAQKSRQGYSSFSKALKSLGILASTIFIRALLKSSAAYNALLARGYRGEIATLKDMRPINRRAVAQILWGELVLFALI... 251
301 5.000e-34UniRef50_I0KXS1 Cobalt ABC transporter, inner membrane subunit CbiQ n=32 Tax=Actinobacteria TaxID=201174 RepID=I0KXS1_9ACTN  ali  27  10..............YRESTSPVHRLPPEVKIVAMVVFTIAVVATPRXXXXXXXXXXXXXXXXXXXXGPRWLLSRALIELPFVLFAVALPFLGTGVLGLRLSEDGLHGAWNILAKGTLGVLASLLLAATTTTRDLIVGLDRLHCPQVLTQIATFMLRYLDVLVGEARRMRVARISRGDDPRFLWQLRGFAAGIGALFLRAFERGERVYLAMLSRGYTGRMP.............................. 221
302 5.000e-34UniRef50_A0A1I6UJ27 Cobalt/nickel transport system permease protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1I6UJ27_9PSEU  ali  22  10.............HLPGATVLHRLDPHVKITAAFLLVLCVVATPRHFAAFAGYAVVLAALAALGRIPPRWMLTRLLIEVPFVVL-ALLLPFTAGGAGLALSTEGLLAGFNILVKGTLGLGTSLLLAATTAPREIVLGLQRLRAPKLVITIITLMLRYAEVIVAEAGRMRVARISRGHDPRFAWQVGATARGVGSLFIRSYERGERVHLAMLSRGWSGEMPELEPARRTSWK................... 232
303 6.000e-34UniRef50_D1A9Z9 Cobalt ABC transporter, inner membrane subunit CbiQ n=18 Tax=Actinobacteria TaxID=201174 RepID=D1A9Z9_THECD  ali  27  9..............YLPEDTPLHRLPPQCKLAAAGAFVLAVVCTPRXXXXXXXXXXXXXXXXXXXXRPGFLLRRMVIEVPFVAFALLLPLVQVQVLGLTLSESGLWSAWNILAKATLGTVSSLLLAATTEPRRLLIGLQHLRVPPLLVQIATFMFRYADVIVAEMQRMKVARAARGFQARDVRAFGVLARSAGALFLRSYERGERVYLAMLSRGYDGRMPVLHDSR........................ 226
304 6.000e-34UniRef50_A0A1H9PLN4 Energy-coupling factor transport system permease protein/energy-coupling factor transport system ATP-binding protein n=9 Tax=Atop  ali  20  5.........LSIGQYYPAESPIHRLDPRAKVGCALVAMASTFLIRTPLQLALGVALALALVAATRIPVTKVLESIRPLVTILVLLGLFNLFLFACGPLLIGAEGAWSAVLYSLRLAIAILMGALMMLTTTPTQLTDALARLGLPHEIAMVFSLMLRFIPTIADEAQAIADAQRTRGGEGSPLHRCHAIAAILVALFASSVRHANDLARALDARCYGGEGRSHWHPAHMRPRDWAAVATCVACIAAILF.. 262
305 6.000e-34UniRef50_A0A166DE41 Nickel transport protein NikQ n=3 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A166DE41_9EURY  ali  15  4.......SIDKIEQESWKDSAIHNLDGRIKLILTIMIIVYSVYXXXXXXXXXXXXXXXXXXXXXXXSIGFFAKRILLILPFGGFLAVFQPFIKPGLGLTITYDGVLFGVLLISRLIVCLSAIVLLSSVTPIETIVNSMRKLGFPKIMSMILSMTIRYLFVFYDELDTIRKAQKSRSFKTSYFWRLKQVGYTIMMLFLKSFEKGEKVYYSMLSRGYTGESVSYRKENPIMKMDYLFLILTLILVFSIEII. 257
306 6.000e-34UniRef50_A0A2N3L935 Cobalt ECF transporter T component CbiQ n=18 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2N3L935_9PROT  ali  17  22...................SFVGSFDPRVRVATAGLFAVMVVALHQVEFAFGAFLLALGTVFLTDLPLRLTLKRMAAMDGFIIVMLVMLPFTTPGTPMDASKEGLMHAVLIGVRANAVVLMMLSLLSGLSPVALGHTLYRLKCPAALVHLMMFTVRYISVLHDEYHRLRMAMKLRGFRRNTFHTYRSIGYLFGMLLVRSLERAERVLEAMKCRGFSGHFPMIDHLEFKVRDGMLAVGFGVMIGALVLL.. 257
307 7.000e-34UniRef50_D3E1A9 Cobalt ABC transporter permease protein CbiQ1 n=13 Tax=Methanobacteriales TaxID=2158 RepID=D3E1A9_METRM  ali  14  2....AIEEVRNLEVIASKDTIIHNLEGRVKLIAILLIIVFCVFSDRLIVPLVLEIFLLIVMYLAELSFKDSFKRIALLLPFGGFVIAFQPFIHPGNWLFITDTGLNWTVLLFARLIVCLTAIVILSSTSPMQEVVQSFRKLGMPRDLAMILTIMVRFLFIFVDELRDIRQSMKSRNFDPPYKWRVKQVGYSIAMMFLKAYEKGETIYLSMASRCFSDNSRLYHAKTIIGK.................... 240
308 7.000e-34UniRef50_UPI0008637DD9 cobalt ECF transporter T component CbiQ n=1 Tax=Merdimonas faecis TaxID=1653435 RepID=UPI0008637DD9  ali  24  9.......................LSPMPRVLFCLGMMVTAVCSAHPFLGAELSVVMFLWARVYGKVPVGKYLRMFRLPLGFLALSGLVLLFSVGPGYLSMTRETVLRTILVTFRALGAVSALFALGMTTPVTELTGVLKRLHCPDLICSLMYLMYRYIFLMYQVHGNMKQAAEGRMGYMDYRTSLRTTAGIYGNLLAYSYRQAGANFDAMESRCFDGSVRFLSGKYRKDWRKTVILVILVLLEIGICI.. 245
309 7.000e-34UniRef50_A0A1C4H146 Energy-coupling factor transport system ATP-binding protein n=2 Tax=Bifidobacterium commune TaxID=1505727 RepID=A0A1C4H146_9BIFI  ali  18  558.................RTGIMTRLDPRVKLVVFLMLTLMMFLVNQPAELLLAAVGTFLITAFSGLKAVELFRSLRGFLILFFVIGIFNMFFVTLWGLKVTRDGLGLAALYTSRFSLAVLLGIVLLKTTTPTALTDAFASLASPQEMALVMSLALRFLPTLANETRSITQAQAARGGSGSPMRRLKALAATLIPVFAAALRHSDNLSLALDARCYEEGIHRWHAMHVTGKDLIAVALSAA.......... 800
310 7.000e-34UniRef50_A0A0Q9SWD3 Uncharacterized protein n=5 Tax=Paenibacillaceae TaxID=186822 RepID=A0A0Q9SWD3_9BACL  ali  16  4......IDKFSMGRYVPGQTFVHKLDPRLKIVFAMIFAAAIFSSNTTLLLSIHTVAALFVIRLTRISFFYFLQSLQGLSALIVFFGIYHMLTWSLGRLIIYDQGLMGAIFINVRLILLICITSLLTLTTSPGDLTAGLERLLRPGEFALMLAIALRYIPIAAEEIDILIKARKARGAYRNWIRRIQEPLRLIVPLLVQSFRRAEQLSVAMESRCYIGERGRTHRHTLRMGWREALAGTAACFFFASTFII 265
311 7.000e-34UniRef50_A0A2K2H793 Cobalt ECF transporter T component CbiQ n=5 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2K2H793_9DELT  ali  23  48......WSLPQLDGATAGDSPIHRWEVRCKLVGMLGFAFLVVSLQDLRTAAVAGAITLSLLFVTRLPFDRSLARLLAMSGFLGMFLLVMPFSAPAHPLPWNLRGLHKAATICLKACAVALLMEPLLATAPLTRTLQGLRRLGVPAAIGQMLLLAHRYSYVFKHEAWRMASGMRLRGFPGSNRRALGAFGNFLGMLFVRSFERTERVYDAMQARGYRDRFPEPEPQPATAKD................... 285
312 7.000e-34UniRef50_A0A1V5NR57 Cobalt transport protein CbiQ n=1 Tax=Firmicutes bacterium ADurb.Bin373 TaxID=1852891 RepID=A0A1V5NR57_9FIRM  ali  27  8.........................PQAKILAVTTFVVIVVLTPREWISFFGYAAILAAALAFARVPPHRVARGLAIEVPFVLFAVLLPFVGHGPNWLGLSIPGMWAAWNILVKATLGVVAATLLASTTLPVDIVAGLQALRIPSAFVAILTFFVRYVDVVADQYQRMRVAQRSRGFTASSPRSWPVLAHGLGALFVRSFERGERVHLALVSRGYEGQLPV............................. 205
313 8.000e-34UniRef50_UPI000C82C84D energy-coupling factor transporter transmembrane protein EcfT n=2 Tax=Raoultibacter TaxID=1926677 RepID=UPI000C82C84D  ali  19  1.....MSANITIGQYVAGTSIVHRTDARVKXXXXXXXXXXXXXXXXXXXXXXCGALGALGYVAANIPAKLAVRSLKPVLFILLFTVALNAFTFNAGSFGISLQGVENGVFFALRIVFLIAATSLLTYTTPLIDIVDAVRSLLRPEDVAVVCALTIRFIPSTVEEAECIMKAQRARGLRGSLLTRAKAWVPIITPLFINLFRRADTLACAMDARCYTGAARTLSIARMRRSDSLAGALGVALLACVAVFL. 272
314 8.000e-34UniRef50_A0A2M8CS27 Cobalt ECF transporter T component CbiQ n=5 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8CS27_9CHLR  ali  18  1......MHADAFDRFHPASRLHRLNPSVKVALTVAFIISNXXXXXXXXXXXXXXXXXXXXXNQSRLGLWFTFRRSLLAAIFSPLGGALVSFHLLWLNLTVTDVGLLRFASILIRSWLSVQMAVLLVATTQFPDILHALEHLRVPKALTTIIAFLYRYLFVLTDKVFRLLRAREARSAGGSLLWRANVAGNMAGQLFVRSYERSDRIYNAMAARGYTGQLRTLHPHEIKPSD................... 243
315 8.000e-34UniRef50_C4IBB3 Cobalt ABC transporter, permease protein CbiQ n=27 Tax=Bacteria TaxID=2 RepID=C4IBB3_CLOBU  ali  17  16............DVAAKDSTINNLHPLSKIIVTFMYIVVVVSFDKYFYGVISMGIYLYGVSVISDIPLSNSFKNMKVVLILVCIVGIGNPFFFSISGIDITY-GMVSMVTLMIKGIFTVCAAYFLIVTTSIEKICYGLRILHIPKGIVTVVMLIYRYIIVLLKETERMMQAYKLRAPYQKGIN-IKAWGSFAGQLLLRSIDRAEIVYESMLLRGFNGNF............................... 226
316 9.000e-34UniRef50_Q8KFD5 Cobalt transport protein n=3 Tax=Chlorobaculum TaxID=256319 RepID=Q8KFD5_CHLTE  ali  29  1........MMTLDEHAARSRLRDVAPVYKLFYALPXXXXXXXXXXXXXXXXXXXXXXXTVVVKGGVRPVDYLRWLTLPAGFLLIGTIAVAVPLGGVHVGVTSAGLAMAAHLCFRALASVSCLYVIAFTTPVADLARSMASVGLPPLFVEMTLLVYRFVFQLFDTSSAIATAQKSRLGYAGLQATFRSLSALASNLFVFSARRSEELYVAMECRGYDGAIRVLAPTSGARQPSLAGIALVEAALLCVAV.. 253
317 9.000e-34UniRef50_A0A1D9FL43 Cobalt ECF transporter T component CbiQ n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1D9FL43_9CLOT  ali  23  1........MYFIDHLAYSSSLRKVEPNQKFIFSLSTMLVVLLAKNYIVPIAVILFMGIIIMKKGGTSAQNFVKXXXXXXXXXXXXXXXXXXXXEGFKIYGTWKGFYDALFLVVRALAAVTCLYFFILTTPMVDTLQLLKKYKCPILIRELMFLMYRFIMLLTEITTKIFFAQKSRGGYYNTTNSRQALSQLVASLFLGLHQRSKESYQGLIARGYQGEIDLLIVEYENSPKNWCFIMITQVVLVFLLMI. 244
318 9.000e-34UniRef50_A0A1Q2MAV8 Energy-coupling factor transporter transmembrane protein NikQ n=4 Tax=Planctomycetes TaxID=203682 RepID=A0A1Q2MAV8_9BACT  ali  20  1......MHHAHIDKYANQSSHVHKIDARLKLLAVVLFLTVTVSINKLPSLAWYALFPFLLLVIGRIPIKFVLKQVILVSPVILVFGFSCVIFVSFGPFSGEIAGWVRFLSIACKFTISAAALIALVSTTRFYDLLAAMQKLGVPKMLVLQLGFLYRYIFLLIDKAGRMMRARSARLCTFGFLYELRLAGSMIGSMFVSSIDMAERAGIAMEARGFTGTVHTLNTLRLK...................... 232
319 9.000e-34UniRef50_UPI00098725C8 energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Mobilibacterium timonense TaxID=1871012 RepID=UPI0009872  ali  17  1......MHEVTLGQYYPQDSVFHGLDPRTKLGTILLYIIGLFLVKNSLWFLAFLAVLVMLFKSARIPLSYMLKGTKGFALLLVFTFIFRMLCTPGWIFQITMEGINKGIQLSARIGLMVAAASLLGYTATPKELVDGLKKIGVPSDISMMVMIAFRFIPIMMNEAFDLMDAQSSRGVQCSFAEKCRNIFALLVPLFVNSVYRSADLAMAMESRGYTGDGNVTMMYPL....................... 238
320 1.000e-33UniRef50_A0A0R2DQA4 EcfT protein n=2 Tax=Lactobacillus sucicola TaxID=519050 RepID=A0A0R2DQA4_9LACO  ali  14  2...........IGQFIPGRSVVHRLDPRTKXXXXXXXXXXXXXXXXXXXXXADTIFLVLITLSSRIPLLVVLRSTKPIIPIVLFTSFFNILYTSGWIFQITKQGIEISAFLSLRILLMVMGSSILTFTTSLTDITSGIESLLSPTDFAMMVTLAIRFIPTLSEEVQKIKDAQRARGASFGSKKKIKEVFPILVPLIYSSFRRAFDLTNAIECRCYNQKIKRTKLNPLKYQKRDLFCGIIIVLFFSIIIII 257
321 1.000e-33UniRef50_B0TDW5 Cobalt abc transporter, permease protein cbiq n=2 Tax=Heliobacterium modesticaldum TaxID=35701 RepID=B0TDW5_HELMI  ali  33  2........LFTIDQWAWANKLRDKPPTLKXXXXXXXXXXXXXXXXXXXXXAITLLYGALLAFAARIPLSLFLTLMTVPGLFLFTGCFTVAFTFGPYSPGISAAGLKQAGVLFFRSLGATASLYFLVLTTPMVDVIELVSRLRAPRLVTELMLLIYRFIFVLMETTQAIVVAQESRLGYSTRANSLRALGILAANLFVRSLIRSRELYIALSARGYEEELRVLPRAR........................ 230
322 1.000e-33UniRef50_UPI0002F7BF40 cobalt ECF transporter T component CbiQ n=1 Tax=Bacillus massiliosenegalensis TaxID=1287657 RepID=UPI0002F7BF40  ali  22  1........MLPIDQMAYCNALRHVHPLEKGSFAASLLFLSLLLKNPASSILVFALMSMVLLIGAKIPLFYYXXXXXXXXXXLKVLDVLTQVEIGNWRIYISSGKAERVSELFLSAMAGISCMYFFILTTPIQQMIWLLQKIRLPSLFIELFVIIYRFIFVLMNNMNEVRIAQTSRLGYRGMKRSFSSLAQLITSIFIKSLKTAQDVQRAIDSRGNNGDFHEVEVQQSYNKRNWLGIGCFVIIVSIVTFVF 258
323 1.000e-33UniRef50_A0A2K2VPD7 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium TaxID=2049433 RepID=A0A2K2VPD7_9DELT  ali  20  3.....FLRDLTLGHYYPTSSPIHTLDPRIKLIGLCFAGITLFALDKLLVLALFFLGSLWLIHLAHLPLATVIRGLRPFAWLLVLTACLQLFFTSGGPLNITWEGLHQAVRIGGQLSLFILFSSILTLTTSPLELLRALEKFGSPAELCLAMLLCIRFLPILGQEAERIVESQMARGIDGTWRNRLEKFHSIFFPLLYNVLWRADELATAMAVRGYGQEKQTLKHMRLSRLDCLSLAVIVTWCIVLFWLF. 267
324 1.000e-33UniRef50_R9SLE8 Cobalt ABC transporter permease protein CbiQ2 n=14 Tax=Methanobrevibacter TaxID=2172 RepID=R9SLE8_9EURY  ali  23  3.........INLDYVAHTNRIADNDPYVKVGVSLFFMLSALILSNNXXXXXXXXXXXXXXXXXXXXXXKEYCKFLVIPFSFTFLTCLFILFFFGFWGIGITTYSYTTSVLTFFRVFACFSALGIQSLTTPISDVMHVLRSIKVPRVFCEIAVLMYNSIFIFLECVETMRNAQKTRLGYTTSLTAFKSMGSMFSNLFLQSLKKSETMQVALDSRCYTGELPVYKPNRKL...................... 231
325 1.000e-33UniRef50_A0A2V2CYL3 Transporter n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2CYL3_9FIRM  ali  18  3.........IAIGQYVPGTSALHRADPRTKFVLTFAYMVVVMIADNYAAYLAAALYLGAAYVCARINVGKILRSLRPLIIMMVLTALLNLFFYRGWKITIYKESALFALRMVLRIVLLVLGSSVLTYTTTSVMLTDGLESLFSPHEIAMMMSIALRFIPTFMDETDRIMKAQLARGSDKNLISKIKSYIPILIPLFISAWRKAEELATAMNARCYRGG................................ 229
326 1.000e-33UniRef50_M8DU88 Cobalt ABC transporter permease n=9 Tax=Bacillales TaxID=1385 RepID=M8DU88_9BACL  ali  25  5...........IDSLAYENRL-KRLPPEQKLLFSLAMLLLALISHPLVQGILFVWMSVWIVVYARTPWRXXXXXXXXXXXXXXXXXAIASWQLGSWVVYVTAEGLSRAMSLAARSLAALSCFSFILFTVPFAEVLQVFRRIGIPSILTDLMMIMYRFVFVLLETAEQIWTAQKARGGHRGTAGTLKDAGRLIVQLFIRTMARYRQMYISMTARGFTDDFRVLVHASHMRSKRYEWEAVAGCLLLAML... 257
327 1.000e-33UniRef50_A0A222SHW1 Cobalt ECF transporter T component CbiQ n=2 Tax=Prosthecochloris TaxID=1101 RepID=A0A222SHW1_9CHLB  ali  15  1.........MQLETFSRGKSILHALDPRVKLLVYLPFVFLTALTDEIGIAAAMLLTGLLLAGMGRLYGGKLLERLAVVNVFMALLWLTLPFSVEGETIRITREGLLLSLLITVKTNAIALFTISLPGTSTIIALTHAMLHLGMPEKPVTLFYFFYRYIGVVNEESEKMSRMLRARGFRQTGIHTIRVSAYFIGMLFIRSYERSERVYNALVMRGFTGWFPMLEHFSLHPRDVAFTALMGVVLITTLLL.. 246
328 1.000e-33UniRef50_A0A1V5UGI3 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=bacterium ADurb.Bin243 TaxID=1866936 RepID=A0A1V5UGI3_9BACT  ali  15  2................PTGSLVHRASPKIKIISLFLLTFSIFLIKDSYLYFYFLAASVFILKIAGLKTSYLLKGLKPLIFVFVLTFFLNIMFWEWGLVKITEEGLIYSFKFFMKVTLLVIYATLLTLTTSPVELSDGMEDCLKPHEFSLMMTIALRFIPTLVMEIDKIKKAQEARGANGNLMGRVKNFIPILIPLFITSFKRADELAVAMESRCYGGEGRSRYRRKKDGFSDYVMLIMVLSVIF...... 248
329 1.000e-33UniRef50_A0A0F2PRT2 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4b TaxID=1629717 RepID=A0A0F2PRT2_9FIRM  ali  19  16.................DNFITRIDPRVKLFFSFALLVLIICTRNVFVHLSVVFFMVAGIIML-RVNKKIFLIRGLPAISIAVAVLATQIFLYGGVTFSGYREGLARGIVLMCRVLAGIATVLFLTLSTSMNKLIYAAGWFRLPGAFLEVMMITYRYVFVLFDEFTTVKNAQKIRLGYSSPGESVRSLGNLSGIILLRAVDKSEKLHRAMKSRGYNGQIKVQYNASFTKSDLLVSLGLTSTLGSILFF.. 256
330 1.000e-33UniRef50_A0A1V5B2R5 Energy-coupling factor transporter transmembrane protein EcfT n=5 Tax=Methanomicrobia TaxID=224756 RepID=A0A1V5B2R5_9EURY  ali  27  2........HDLLDDYAHSNALRETSARLKLLLGLGAILLCVSSSSPIAPLFIALTMSLATVRLAKIPARFYCTLLLIPSSFSILSAVVVAFMHGGGELGIREEGGNLALLLIARTFGGMCSLFFIALTTPMLELFSIGKSLGLPDFLVELSMLMYRYIFVFLDQAARIHSAQVMRLGDAGFKSTLSSFSMLSSVLFLRSWEQGERLIVAMDCRCYDGKL............................... 223
331 1.000e-33UniRef50_I3IMM3 Cobalt ABC transporter permease component n=11 Tax=Planctomycetes TaxID=203682 RepID=I3IMM3_9BACT  ali  18  5..................NNLVEGLDPRSKIISFLSIILCMVLTTRLKDFGLYFLLILAIAFIAKITPRQILKRMFFLIPFILFVAIFIPFIIGYWQLRVTYEGVWTFLNVIIKSGLSIILLVIASSTTTFPDFLQGMEMLRMPRLLVILMSFMYRYIFVLFDEAKRLMRARALRYFGSRYSEQLWIIGYMIGVLFIRTFERARRIYSAMTIRGFTGEIRSIKRFQ........................ 224
332 1.000e-33UniRef50_A0A2M7H0F1 Cobalt ECF transporter T component CbiQ n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2M7H0F1_9BACT  ali  18  1......MHLPEIDKYAHLSSPFHSWNPRIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPFSFVLIHLRWVLLFCLFFFIIMPLTVPGNFVSISWEGTKYASLITLRAISAVLLIFPMLGTMRFDATIKALQRLKVPNKFIQMIMFTYRYIFVFMEETRRMFIAANARVFKRTNIRTLKIISNLIGMLFIHSFERTQNIYNSMVSRGYTGYLKTLDDDFRLCGKDFLKGFFIVAIALILTI.. 249
333 1.000e-33UniRef50_D3ALD0 Cobalt ABC transporter, permease protein CbiQ n=24 Tax=Bacteria TaxID=2 RepID=D3ALD0_9CLOT  ali  22  23..........SIDFYACESRLRSWNAGLKMAVGMAALCLCIAADKXXXXXXXXXXXXXXXXXXXXXXXXRYLKXXXXXXXXXXXXXXXWYISAPWFSLYVTKNGLIQAVGLFTRALGAVSAMYMMTLATPASEMIGVMKRIHVPKMIVELMYLIYRFIFVLSDTYSQMKQAAGSRLGTCDFRTSCRTFGSTAGNLLVISLKKADTYYDSLLSRCYDGDLCFLEEEKRIKAGQAAAAVGYLLMTAAVWLVF 274
334 1.000e-33UniRef50_A0A1B9F6H9 Transmembrane component NikQ of energizing module of nickel ECF transporter n=1 Tax=Dissulfuribacter thermophilus TaxID=1156395 R  ali  13  4............EHFSNGRSFFHRCDPRVKLLCLLVGSWIIAALETLEFQVACLLLSSAFMFAAKLPLKETGLRILIVNTFCLFIWLTVPLTTSGGPYFVTEEGVITALSITLKSNAILFLSLSLLSTSKITDLTHALSHLKCPSPLVQLFYFTWRYIHVISEEAKKINEAMKLRGFSLSNLSTYKYIGNYISAIFLKSYDTGIQVQRAMELRGFDGTFWLIHHFNLKRSDIVFFTTTISAIMLIFI... 246
335 2.000e-33UniRef50_A0A1V5RZN5 Energy-coupling factor transporter transmembrane protein EcfT n=14 Tax=Bacteria TaxID=2 RepID=A0A1V5RZN5_9FIRM  ali  16  1.....MIKDITIGQFFPGKSFIHKLDARIKIVLTGIILVMIFVCGNFYSLGLMSAFILFSFLLTRLSLRLILKSFKPLVLILVITSLLQLILFSWRKLSITSGGVYMMIFITVRILSLILVSSLLTYTTSPTSLTYAIESLLSPHTFAMMMTIALRFIPTLIEEIDRIMNAQKARGADGSLVSRIKALFPIFIPLFVSSFKRAFELADAMSCRCYTGKGRTRMKQQKTGVRD.................. 246
336 2.000e-33UniRef50_UPI000373597C cobalt ECF transporter T component CbiQ n=2 Tax=Sporomusaceae TaxID=1843490 RepID=UPI000373597C  ali  18  51..............................................FSALLPLCLYPIGLCTLGGIPPAVIAKRLLIAAPVVLMLGLFNPFFILPGGFTISK-GWVSFGVIACKLLFSVSASLLLIATTGLQPLCASLRTLGCPKALVVQLLFLYRYLHLLLEESSRILQAYRMRSFQGNAI-AMHAWGSLLGQWLLRSMERAERIYQAMSCRGFSGEMPGNLLPSWRSRDTGYFLAWSAFFLLCRQF.. 255
337 2.000e-33UniRef50_A0A2I0QI76 Uncharacterized protein n=1 Tax=Candidatus Altiarchaeales archaeon HGW-Altiarchaeales-2 TaxID=2013674 RepID=A0A2I0QI76_9EURY  ali  19  1......MHHYFLDKYANVNSIIHHLDPRLKIIAFISYVLFVILTPPFIKFFLYFSLIFSVILLSKLPLKFIFKKIL--------------------------------FNVLVKSWLSVISMLTLTSTTKFSDLLKGFEYLKFPKVMLLVISFMYRYIFVIADEAMRLKTAGDARNFGNKLKQRIEIFGNIIAVLFIRSYERAERVYAAMLSRGFDGNFKTIKEFKFSNADFGFATIMGLILISIFVI.. 213
338 2.000e-33UniRef50_A0A1D7XAL9 Cobalt transport protein CbiQ n=8 Tax=Moorella thermoacetica TaxID=1525 RepID=A0A1D7XAL9_MOOTH  ali  35  96..........................................................................................LTLLGWTLGVTPASIHLAGKIFFKSLGAVSCLYFLSLTTPMVDILTVLKKLRVPALLVDLISLTYRFIFVLLATVNDIYTAQAARLGYASLRTSYHSLGQLVANLFIKTHRRSQELFTALTARGYGEELQVLEVPKPFSW.................... 235
339 2.000e-33UniRef50_J0X061 Cobalt transport protein n=13 Tax=Clostridiales TaxID=186802 RepID=J0X061_9CLOT  ali  14  1.....MIRDITLGQYFPGKSLVHRMDARVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRQYLKSLKAVIIVVALTSVLNLFLVQWGFLTIRTGGVINCIFIAVRIISLILFSSVLTFTTSPTDLTDALERIMKPHEIAMMMTIALRFVPTLLEETDKIMSAQKARGADGGAIQRAKALIPILIPLFVSSFRRAYELAMAMECRCYRGGRTKMKSLHMTTLDGWAIAVSSAACVGVALCVM 264
340 2.000e-33UniRef50_A0A2G6NP66 Cobalt ECF transporter T component CbiQ n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2G6NP66_9DELT  ali  22  6............ETFAQGDSVLHCRDPRLRVIFAAFYAVLLAVSSDFTTLIIGLCCAFALVLVARLALLVVARRLLLVNIFNLILVAMLPITYEGGPFVGSVEGLALAGEIALKSNALVLLFIALVTTMSVATLGHALNSLHVPPKLVYLLLIAYRYVFVLEQEYGRLATAARVRGFSGTNLHSYKTVAYLFGMLLVRALARADRVYQAMLCRGFCGRFYCIQQFRLDCGDILWSGIMLFFFLVLVY... 247
341 2.000e-33UniRef50_C0C003 Cobalt ABC transporter, permease protein CbiQ n=12 Tax=Clostridiales TaxID=186802 RepID=C0C003_9FIRM  ali  16  5..DEAIRGIHYLDESAERDTWLRIHPLAKVIVTVWYMVLVVSFGKYNLSLAGMCLYPVILIILGDLSFKRAAGQLKYILLVVCMVGIANPFFFYIGRIPVT-GGVVSMLTLVLKAMFCVSASYLLAAATSIEKICCALRMLHVPKILVTLIMLIYRYVMLMLKEAERVTQAYSLR-APGEKGIRFKVWGTLAGQMLLRSMDRAELVYESMTLRGFTGEYRLSGMEGKHRGSIQYALFWCAVLSVLRVFPL 257
342 2.000e-33UniRef50_Q58966 Uncharacterized protein MJ1571 n=9 Tax=Methanococcales TaxID=2182 RepID=Y1571_METJA  ali  13  32.....LNENIFFEKYTRISGLLQNIESRIKIISLVIFLVGSVLSKHILTLIIFNSIALILAYLSNIPLLQYLKRXXXXXXXXXXXXXXVFVILNNPHISITYEGLIYAITFTLRVATCVSFAVLIPITTQWNKVTSAIHKLGVPEVVITITNLAYRYIFLLLNFVLDMMYSRKSRVVNKGMVESWKEAGKAIGALFIKTYQMGEDXYYAMLSRGYNGEIKHIYREEIKIKDIAFLLFSIIITALLVLF.. 287
343 2.000e-33UniRef50_UPI000B7D9100 cobalt ECF transporter T component CbiQ n=1 Tax=Dehalobacterium formicoaceticum TaxID=51515 RepID=UPI000B7D9100  ali  25  1........MFYVDQFVYTNKMRGIHPGEKFAFAMATLVICFTAHKPLIHLLIIGIMLGLLVFKARVPWRVVAKXXXXXXXXXXPAGMLASLKLGRFYLGVTETSLAQSFSIMMRALSAVTCLYFIALTIPMIELIYLLQKMKVPAIFAELMMLMYRFIFVFVETAFNIYTAQSSRWGYCNFKRSIYSFGILFGNLCQKVFFKTKALYDCLLSRGYESELKVINPKYHFS..................... 234
344 2.000e-33UniRef50_A0A1Y5HUY9 Cobalt ECF transporter T component CbiQ n=1 Tax=`Osedax` symbiont bacterium Rs2_46_30_T18 TaxID=1856298 RepID=A0A1Y5HUY9_9BACT :_  ali  16  1........MTSIGTFSPNQSLVQKVDPRARIVCTVLFAFAVVLSDQLIALIFALVMSILMACFAKLTVAKTLKQLAAMDMFMLYLLLMLPFTVPGFGFSASWQGLEQGIKITLKANAVVLMLFATVTNLPSSALGSALQALKVSNKLIQLLLFTLRYLSVIADEYQRLRRSMRARAFVMRFWHSWKTIGNLIGMLLVRSIHRSQRILKAMKCRGYNGQLVSYLPMRWQPLDSGFCGTMALLTAAITAV.. 249
345 2.000e-33UniRef50_UPI0005278D6E cobalt ECF transporter T component CbiQ n=2 Tax=Spirulina TaxID=551299 RepID=UPI0005278D6E  ali  24  1........MLGIDRYAHLKSPVHRWQHPPKLLGLLSLIFTFAGVERLQLLPFMIGVTAGLYALSRLPLSFLLGHLRYPGLFIAAVVVFLPLIFQWGGVAVRWEGCLTVLLIVTRFICIVTVSLVLFGTAPFVGSLKAMRSLGLPKLLVDMALLTYRYLEELAEMAVTMQRAMKLRGFRGDRKRNLERLAALVGTLLVRSYEQSQRVYQAMILRGYG.................................. 216
346 2.000e-33UniRef50_A0A2D6EQF8 Cobalt ECF transporter T component CbiQ n=1 Tax=Desulfobacter sp. TaxID=2294 RepID=A0A2D6EQF8_9DELT  ali  24  6........HLFSDYFARRDNVLQRLDVRLKMGVAIALFAAILCSTRPVLPVSAWLLSIATMIALRIPRKIIFHRXXXXXXXXXXXTPVFSVSLGDWVLTATREGIAQGTLTGSRVLGAVGTLLLLSSVTPAHEIFHTLHWCHMPKVWVEIAMLVYRYIFVLLDEATDMAAAQRVRLGYSSFRNSMSSTSGLIGAVIVRSMEQSFRTHEAMIARGYAGEYRFGGMDRL-SWKTCFDIFSAGVGIAFVFLLI 256
347 3.000e-33UniRef50_A0A2S6HNB5 Energy-coupling factor transport system permease protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2S6HNB5_9BACE  ali  12  1.....MLRDITIGQYFPGNSIVHKMDPRAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLKKSIDPMIPLLGISLIFNIFLTDGGFLKITDRGVWAAIFMCIRLVCLVIGTYIFTYTTSIMQITHGLEQLLNPQEIAMTMTIALRFIPTLVEEADKIISAQKARGADGSIIKRVKSRIPILIPLFMASFQRADELTLAMSCRCYDSKNTRTYLEKLKYKKYDLFLFITTGVTGALVIYI 262
348 3.000e-33UniRef50_Q12VD4 Cobalt ABC transporter permease protein n=77 Tax=Euryarchaeota TaxID=28890 RepID=Q12VD4_METBU  ali  25  4..........ILDDYALVSPLRYRNNWLKIAIVGFGVLVGVSSQSFIPPFAIALCMSFTTVYFGKTSLKXXXXXXXXXXXXXXXXXXIFGFNIFNYHLGVNTGGLDMALLVFSRTLSGMSCLFFLALTTPMVELFSVLKATKLPDSFIEISMMMYRYIFVFLEVAWGIKYAQTVRLGYKDWRTALNSLAMLSTTLFIRSWEQGEKIFISMSARCYDGKLIFFEEKRPIRANELVLTCTYFAVVLVLWYL. 253
349 3.000e-33UniRef50_A0A089LEQ0 Cobalt transport family protein n=3 Tax=Paenibacillus TaxID=44249 RepID=A0A089LEQ0_9BACL  ali  17  1.....MKDNILLGQYIPSDSVLHRLDPRTKLLSMLTFTICSLLINNYGGYAVATVFTGSQLLLSRVPVRMFLRGLKPVALILSFTFAYHLFLWPGSAVKVTEEGIEKGLFVVWRILLLVSLASLLTLTTKPLDLAKGLEQLCKPEATALMLVIAVRFIPVIIQELDRIMLAQRARGYDIKGHKRVFAYLSLVVPLLITTVQRAEQLAMTIDARAYTGRDRTSYRELRLSRMDYTAGGVT........... 252
350 3.000e-33UniRef50_A0A2G3PX27 Cobalt ECF transporter T component CbiQ n=1 Tax=Lachnospiraceae bacterium TaxID=1898203 RepID=A0A2G3PX27_9FIRM  ali  29  18.......KMRELDYYAYHSRLRRFYPEQKVIFASMLLLTTLMTKSFLLFISVSVLTMYISILKGGMPMKLYLKLLGLPLGFLCISGLLLALQLQTIIIGISKEGLIKGSQLFLKAIACVNVLYFLCLSTPLNDILHVLQKAKLPQLLIEMMQLIYRFIFILMDMALTTQLAQASRLGYKDLKTGLRSMGQLLSTLLYRALKMNDKVYTALEARGYNGTLRVLSNEQYERLSLIKLVAIEVILIGVAIL.. 271
351 3.000e-33UniRef50_D9PVC9 Predicted cobalt transport protein n=5 Tax=Methanothermobacter TaxID=145260 RepID=D9PVC9_METTM  ali  28  91...........................................................................................LVTFMGLRIYSDGLHTGILVFSRILGGFSCLAFLALTTPLNEVFHELGRLGLPAAFIEIALLMYRSIFVFLEEASVMYNAQDSRLGYSGIKNSYRSLGLLAGNLFIRSWLRGETVYRSMEARCYQGTMPSIRRQSIGAREAVMIALFDGLLLVGLLF.. 247
352 3.000e-33UniRef50_A0A1V5SXH1 Nickel transport protein NikQ n=1 Tax=bacterium ADurb.Bin270 TaxID=1866926 RepID=A0A1V5SXH1_9BACT  ali  19  1......MHHSFLDALSYSDGPLHGWDPRVKLMAALVTIFCTASTPFPRFGALAATILILMAIFAKLPPLQIVKKISMVLPFVLIASISLIIADSENRAEI----LARLIFLIMKAAASVGALIILSSTTKFHETLKGMRWIGIPRIITALISFMYSFEFILIDEFQRLSTGRKSRDVAPGIILTWRSRAWMLGTFFIRSMERSARIHNAMLARGYCGEIKSFDSSSPVPSNQIAMATIYSAMLILI.... 238
353 3.000e-33UniRef50_A0A1Y3GD79 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Methanonatronarchaeum thermophilum TaxID=1927129 RepID=A0A1  ali  16  56...............................................................SKLPIKKLIKRLKWIFLFAAAIFLFVPFFFTILFLTATYEGLTMASIISLKMISIMTLSLTIIMTTKIEEILRALNELGIPQTFIEIFFLTYKYIFVIYEETEKSMMSAKARGYKPKAKSKLKILGNIIGMIFVRSYDRSQRVHKAMMARGYRGTMTTTINNKILTNKDILLSFSTIILAITLHLI. 249
354 4.000e-33UniRef50_A0A2G6N2N6 Cobalt ECF transporter T component CbiQ n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2G6N2N6_9DELT  ali  19  6..............FSEGDGWLHRIDPLLRVLGVVGFSLVVAAAYDFRTLFAALALSFLPVLSSHMDLRQVLHRXXXXXXXXXXXXXXXSVLVRLGPVAITRSGVLLCSQISLKTVALMTAFMALVATMTVDTLGHALNRLRLPDKMVHLLLITYRYLFVIEQEYQRLVRAMKIRNFRPTSLHSYRTYAYLVGMLFVRASERARRVHNAMICRGFNGRFHSLRTFPSTPGNRLFFCGS............ 236
355 4.000e-33UniRef50_A0A2D3UA11 Cobalt ECF transporter T component CbiQ n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A2D3UA11_STRC0  ali  23  10..............YRGGHSPVHALPAHCKLLAVLGFVLVVVSTPRXXXXXXXXXXXXXXXXXXXXPAGFLLKRLLIEIPFVAF-ALLMPFVVPGLGISLSVPGLWGAWNILAKGTLGVAASVILASTTELRSLLLGLQRLRLPSLLVQIASFMIRYGDVIADEMRRMSIARRSRGFEARGVRHWGVLAKSAGALFIRSYERGERVHLAMVSRGYTGTMPVLDEVRATRAQWSAAAVLPVTALAVCLL.. 249
356 4.000e-33UniRef50_A0A1Q1FZQ5 Cobalt ABC transporter permease n=2 Tax=Staphylococcaceae TaxID=90964 RepID=A0A1Q1FZQ5_9STAP  ali  12  1.....MLKDNLVGKYIPQDSVIHHLDPRAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFNISYVLNGLKPILLIVLFAFFVHLFTWSWQFLSIYSNGLVQGIFISLRFILLMYFATILTLSTSPIELTQGIESLCAPFKIALMMSIAIRFIPTLIDELDLIRRAQAARGADGSLSARFKAVQALVIPIFIQSFKRAEDLANAMEARGYDTNVQRTYYKVLTWKFKDTLIIISVMCIGVLLILL 263
357 4.000e-33UniRef50_J0DGY0 Uncharacterized protein n=1 Tax=Scardovia wiggsiae F0424 TaxID=857290 RepID=J0DGY0_9BIFI  ali  16  590.............RCTPQGSPLSRLDPRTLILCAMAVMVSYFAVSNGAMLLWSAVVTLSAAVLLRANIRDLWARLKGFIALFIVMGVLNALFIRWGDFLITTAGVWTALIYSMRLILMVCIGALLLMAIPPMRMSDAFESLISPLKLAFTLTLGMRFMPVLSREFRHLRHAQAARGGYGSLRTQAKSLSSLVIPVLAAAIRHAHHLSDALDARCYTGTARTWHPMHFTARDITAAAITACMIAVLVLLRF 846
358 4.000e-33UniRef50_UPI00031AEF27 cobalt ECF transporter T component CbiQ n=1 Tax=Holophaga foetida TaxID=35839 RepID=UPI00031AEF27  ali  31  1.........MLMDDLAYANRLRRVHPAEKAIFAILCLMASLLARXXXXXXXXXXXXXXXXXXXXXXPFGAWLRISLLPVGFLLVGGLSLAVDIGGLSLCTTPQGLRLAVHVTARSLGCTAAMLFLAATTPLTDLIQLLRWGRVPDFVIEMLTISYRALFILLETAGQMQRAQASRLGYSSFRTSLRSLGQMVSHLFGRSLQRADLAWNAMLSRGYGEVLCVLPPEYRVSP.................... 233
359 4.000e-33UniRef50_UPI000403978B cobalt ECF transporter T component CbiQ n=1 Tax=Desulfovibrio inopinatus TaxID=102109 RepID=UPI000403978B  ali  25  6..............FAHGDSLFHSMDPRCKLVAALVFAVTVALLRTPFAAEVGFAVGLCLLISARLPLKXXXXXXXXXXXXXXXXXXXXXXXXXXGPLAVTDNGLQLASLVTLKSYAIIMGFIALVATSPVPDLGKAMISLHVPAKLCALLLFTYRYVFLISEEYQRLHTAARLRGFPKTNRHTYTTYANMLAMTLVRSYNRSHRIHQAMMLRGFDGVFRSLRSFQLR...................... 226
360 4.000e-33UniRef50_A0A1I0CXL7 Cobalt/nickel transport system permease protein n=1 Tax=Natronincola peptidivorans TaxID=426128 RepID=A0A1I0CXL7_9CLOT  ali  23  1........MFIIDQIAYNSNLREMHPSEKFFFSIATMTMVFISNAPLIASIVFLMMTFLLLYKGRVPFTLLMKXXXXXXXXXXXXXXXXXXXXGGLRLTLAENAFQQGFLLITRSFASISCLYFLVLTTPITEIIYVLEKLRVPILIREMMFFIYRFIFIFIKIAADIHTSQRIRGGYANIKNSYYALSQLISVLFLKAQHHGELTYTALVSRGYTGEIRTVAPPYKKCKKNWIKIAIAEGFLIGIFLW. 244
361 4.000e-33UniRef50_UPI000C147405 cobalt ECF transporter T component CbiQ n=1 Tax=Lachnospiraceae bacterium Marseille-P3773 TaxID=2002841 RepID=UPI000C147405 :_  ali  22  20.........LDMDNYAVRSGLAYVNPDLKLWAGVISLILCLF-SRGFTSIVIAVAMIGVILYFGKVNAEEXXXXXXXXXXXXXXXXXIVSIPILHRYLVITWESLFTAVRISVKAMCSVTCLYMISLSTPMYEIIKVLRKCKLPEIMIELMFLIYRFIFVLLEAYSNMKTAADTRLGYINWRRSYQSFFGICTNLFVIAFQKASKNFDAMEARGYDGNLRFLESEKPVTKKQLGICGVYFVVIISLL... 268
362 5.000e-33UniRef50_A0A0F2NG80 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4a TaxID=1629716 RepID=A0A0F2NG80_9FIRM  ali  20  3.........MTIPACAGTTTSLYRMDPRVKIVAIFGFVAVVSSLSSTXXXXXXXXXXXXXXXXXXXXXGQLLRRXXXXXXXXXXXXAVITINLGLLTLDATDQGISRAAILSMRVLSAVLAVNLLTATTPFSDLMQAMRSLKVPDVFVQVLEFTVRYIFVLSDEVKRMKLARRSRCFQGGNMDAFRTLGCLVGVLFARSWERGERIYSAMLSRGYTSSCAAASVHRPGWVDFCWGGAILAVAVGLRIF.. 255
363 5.000e-33UniRef50_A0A1M7J7Q3 Cobalt/nickel transport system permease protein n=6 Tax=Halanaerobiales TaxID=53433 RepID=A0A1M7J7Q3_9FIRM  ali  31  1........MIDIDQYAYNNNFSSFHPLEKSFFALFTILITLTANXXXXXXXXXXXXXXXXXXXXXXXXKFYLKXXXXXXXXXXXXXXFFYFELGGWFFGLESKSLNTAALLFLKSFASICCLYFLTLTTPVLEIISVLRKFKLPEIVIELMMLIYRFIFVLLDTADLIRTSQLSRLGYSSIKKSFFSIAKLISNLFIRAYYRAQGLLTALVARGYDGKIRVLERKYSFSYKN.................. 237
364 5.000e-33UniRef50_A0A0X8WRL5 Energy-coupling factor transporter transmembrane protein EcfT n=47 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0X8WRL5_9CYAN :  ali  26  3.........LVMDEFAHLDSPIHRWEPRCKLLGLVTLMFAFAFVERGWLVPVVLAIALSLYWLSRLPLSFLRSRLRYPGYFLLGVVALLPFLWQLGPVALRQEGLSAMLLIAGRFLAIVTTGFILLGTTPFLTLVATLRSLGLPPVLADMTLLTYRYLFDLAETLATMKLAMRLRGFGQPRRTDLGNLSALAGTLLIRSYEQSERVYKAMRLRGYGYTPRSSAAPVVHKK.................... 244
365 5.000e-33UniRef50_R5AU14 Cobalt ABC transporter permease protein CbiQ n=4 Tax=Firmicutes TaxID=1239 RepID=R5AU14_9FIRM  ali  20  4.AQQASVELRAMDELAQDSPMHRLSPLSKLFVTVLYIVVTVSFHKYDISVFVMVLFPLVGYQVGMIPVHTCFHKLRVVMPLVCAVGLFNPFFXXXXXXXXXXXXXXXXXXXMMKGIFCLMASFLLAATTSIEDICRALRQLHVPKVLTSLLLLTFRYISVLLDEAAIMTDAYRLR-APGQKGVHISAWGSFLGQLLLRSMDRATALYESMELRGYHGEFHYAQGRPSSRASWPFAIGCAALIVLARLY.. 255
366 6.000e-33UniRef50_A0A0D0RDG0 TWA4_scaffold00001, whole genome shotgun sequence n=1 Tax=Lachnospiraceae bacterium TWA4 TaxID=1392836 RepID=A0A0D0RDG0_9FIRM  ali  19  33.........LSIDYLAYNSRIRPWNPGFKVAFSFFMLVYCIVMNNIAVSAIVILSMMFITVKLGGLDLHEXXXXXXXXXXXXXXXXXXXXLNLGAFCIYATNASLLKTARIILNAFGAISCMYMMSLSTPVNEIICVLQDIHLPTLFTELMNMIYRFIFILLDVQSRMTISARSRLGYIDLKTSWYSFGSVLSNLLIVAMKKSNAYFDALVSRGYDGRLQFLTEEKPLDKKLVVYAIIYVGILSLIWYF. 284
367 6.000e-33UniRef50_Q8XNY8 Probable cobalt transport protein Q n=26 Tax=Clostridium perfringens TaxID=1502 RepID=Q8XNY8_CLOPE  ali  30  71......................................................................................FLVSFKLFNGWIGVSKSGIIQGLNMFLKVMGSLSCLYFISLTTPMIDVISVLAKLKVPSFLIELISLVYRFIFIILETSEMMFISQNSRLGYRDIKTSYKSLGALASTLFIRSFKRANDLYTALEARGYNGELKVLEEQ......................... 209
368 6.000e-33UniRef50_A0A2E4MTI8 Transporter n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E4MTI8_9BACT  ali  21  7.........LAIGRYFPAETVLHRTDARTKLICSAGLVTVLFLHGAWLHWSGLIAILTLFLSASGIPVSYLTGNARPLIPILALTLLLNGLVTEGRPAPLTAEGLSRGGNLCLRLAGIVTITTVLSLTTMPLDLADGLTSLFHPHEMALTATIALRLIPLIADEAARIRTAQLARGAHGQWKRRIKDLVAMLVPLFAASFTRSERLADAMQARGYRGEGRTRYRVTRLGKVDAFVFATTCLFLAAVCL.. 260
369 6.000e-33UniRef50_A0A1G0ZVC7 Cobalt ECF transporter T component CbiQ n=2 Tax=Bacteria TaxID=2 RepID=A0A1G0ZVC7_9BACT  ali  19  1MGATDWIEIGRMDDLARLDTPMHRLDARAKIIVTLAFIGVVMSPHALSALTPFLFFPLVLIYGARIPMGPIVKKILLAMPFALAVGIFNPFLLAIGPVTIT-GGWMSFTSILVRFLLTAGAALALVACTGMVRLASALGQLGVPRVFVVQLLFLHRYLFVVAQEGRNVLRSVTLRS-SGTRSLNLGVYGSLTGNLLLRSMDRATRVYRAMMARGFDGEIRLVHPHQVRWIDGAFIAGWLAFFALGRTW.. 253
370 6.000e-33UniRef50_A0A117KTE0 Cobalt ABC transporter, inner membrane subunit CbiQ n=2 Tax=Euryarchaeota TaxID=28890 RepID=A0A117KTE0_9EURY  ali  25  11........HNVLERYAWNESPIHALDARVKVVSLLGLLVGVVLSRAPLQYAIVFLVLVCLLILARVPLRFALTRTLMVMPFVGGIALFVPLFVGPLTLTLSPTGLDVLTRVSSKGVLAVLCVVVLTSTTPFHDILRALEHLRVPRIYLMVMTFMYRYLFLLVEEITTMKRAWESRTVRERRWWHIRTAGMIIASLFLRSYERGERVYAAMLSRGYKGELPTLESMPLQRRD................... 261
371 7.000e-33UniRef50_A0A2N2HJ04 Cobalt ECF transporter T component CbiQ n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-19 TaxID=2013746 RepID=A0A2  ali  18  25.....................LRVDPRAMIVTTFLFIAVVSSFDKYLLGLLPLVLYPVSLMALGRVSFRRIARRLLVASPFAVMIGIFNPVFDGLGPLAVS-GGWISFASILVKFLLTVSAALLLVEICGFDAVCFGLGKMGVPRVLVSQLLFLKRYIHVAADEAARMVRAHALRSFRRRGM-SFRVFGSLCGQLLLRSLDRAQRIYNAMISRGFSGRIHLLRERSVRGGDILFASLWIGFFLLVRLY.. 255
372 7.000e-33UniRef50_Q04EY3 Energy-coupling factor transporter transmembrane protein EcfT n=17 Tax=Lactobacillales TaxID=186826 RepID=Q04EY3_OENOB  ali  16  6.........LLIGRYLPGKTLIHRLDPRVKLVITLAFIFLTFFADNWQSNLLLFAFIFFCVLIAKIRFGFFLNGLRPMLWLIIFTVMMQVLFWHWGWLTISQYGINSXXXXXXXXXXXXXXXXXXXXXTSPTNLANGLSSLLKPDEISLMLALSLRFVPTLMDETGKIMNAQRARGGEGNIFQQMRSLVPIFIPQFIASFNRADELATAMESRGYRGAAKRTKFNRLKFKVNDWIACLIFVFLIFAIYFL 264
373 7.000e-33UniRef50_A0A2S0KLR5 Transporter n=1 Tax=Fastidiosipila sanguinis TaxID=236753 RepID=A0A2S0KLR5_9FIRM  ali  19  11.....FVKLNVIGTYKAGDSVIHKLDPRIKLCLSFALMILVFFLRSPLALGMYGLFTFTLVLLAKMNLKRVFNSIKPILFILSFAFIINIFTWSWGFLSISREGLYSGILVSVRILLTIQTNVLISYTTSIESLLSPLKKINVPQDFALMISIALRFVPTLAEEADKIMKAQSARGANGKLKDKIKGMITILVPLFVNAVKRSEELAIALEARAYG.................................. 239
374 8.000e-33UniRef50_UPI000D6D5996 energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Tumebacillus permanentifrigoris TaxID=378543 RepID=UPI00  ali  16  54...............SYASSLVRVNPSVKLGLHLLCMLVFIFVHDPVTSCGLMLIPMVLALTAARIPVWTFVKRMAPFLLLFISTTWILSVLWHGGWVTITQEGLVKGLNIGLRMLGFVAYGALFAMTTEVTLLLSLMQQCKLPPKFGYALLAGFRFLPMFKEEYEQIKSAHRVRGVARGLRGKLETFTRYTIPLLAQGIRKAERVAIALEARGFDGNRTFYRELRVGANDAIYF............... 286
375 9.000e-33UniRef50_A0A1Z4NGZ9 Cobalt transport protein ATP-binding subunit n=2 Tax=Calothrix sp. NIES-3974 TaxID=2005462 RepID=A0A1Z4NGZ9_9CYAN  ali  27  3.........FPLDSLAYRNKLRNIPAIAKVIFSLLNFAIAFFF-HPXXXXXXXXXXXXXXXXXXXXXXKFYLKXXXXXLWELVKNDVWQGLIFGNHYIYVSRQGINQAFTIFCRSFATISCLYFLILSTPFTDILQVLRQWGFPTLLTELLLLMYRFIFVLLKTANQLWIAQNSRGGYRTWKRGISSFALLVGQLLQRSLQQYQEFSKGLESRGFNGEIRVYSFQRLSNQRYLFVAMMSWIILICLEIL. 270
376 9.000e-33UniRef50_A0A0S7BA88 Cobalt ABC transporter, permease protein CbiQ n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A0S7BA88_9CHLR  ali  20  7...............PNRSSIHQLDARVKVIFTLALIIALNLTPPAWPAYILFLTLTLSLAVYSRLGVQFVLKRXXXXXXXXXXXXXXXXXXTPDLRILYSPAGGVRFASIAIKSWISVQAAVLLAATTRFPDLLAALQQLRVPKIFVAIIGLMWRYLFIIVEEVNRTLRARRSRSAGGPLLWRARVTGNMAGSLFLRSIERSDRVYAAMLSRGYNGELPPAEARTLSARD................... 240
377 1.000e-32UniRef50_Q1Q392 Similar to cobalt transport protein CbiQ n=12 Tax=Planctomycetes TaxID=203682 RepID=Q1Q392_KUEST  ali  22  3.....FFHLTFTDRYARRDNWLTRIDVRVKLIYILSMLAINIWAKNVFVSLSFLFISFVFLLTLKISPLAIIKKMVLPLLFAVMMLVVVSFSIGGYIMSLKKEGLLGGLQTGGKILGGISLVILFAFTTTMSRLNAGLKWFRMPDTVLELMSFMYRYIFQLLDEVSAIWFAQKARLGHASWLKAIKSLGILGGMLIIRAVERAERTSEAMYARGYKGGCILTCHLKPLGKNEYIYFSGMTLFLPFLLY.. 255
378 1.000e-32UniRef50_Q6AQ87 Hypothetical membrane protein n=7 Tax=Desulfobacterales TaxID=213118 RepID=Q6AQ87_DESPS  ali  20  4............EDFSSGNSLLHKLDARTKLIVAACFSLQVAVQKTVEPTLCLLALALVFLLFSRLSPLAVGRRLLMVNTLTLFIWLTLPLTIKFGPLALNREGIDLALLITIKTNTALLALMSLLSTSTPADLGHGLERLHLPEKLCFILLFAYRYIFVIHNEYKTLLRAAQMRCFPKSSLHTYRTFAYLFGMTLVKSHNRALRIHQAMVLRGFTGQLIPLKSGHINRTDTLFFCLASLAMTGILA... 243
379 1.000e-32UniRef50_A0A0U3CED5 Cobalt ABC transporter permease protein CbiQ1 n=26 Tax=Methanobacteriaceae TaxID=2159 RepID=A0A0U3CED5_9EURY  ali  16  8.........LNLDELASRDSPIHNLDGRIKLXXXXXXXXXXXXXXXXXXXXXXEIFLLIVLRIAKLSYIDSFKRLALLLPFGGAIIIFQPFLWSYSWLTITDVGLNWAILLLTRMIVSLTSIVILSSTSPMQQIVASFRRLKMPKDLAMILSIMVRFLFVFIDELAAIRKSQKSRNFHIHYKWRVKQVGYSIAMMFVKSYEQGERVYKSMISRGYSDKSDLYNEKK........................ 235
380 1.000e-32UniRef50_A0A268IDL4 Cobalt ECF transporter T component CbiQ n=2 Tax=Bacillus TaxID=55087 RepID=A0A268IDL4_9BACI  ali  24  1........MLPIDQMAYCNAFRNVHPLEKGIFAASLLFFSLLLKNAASAIFIFVFMNIVIVKGAKIPLLYYIKLLLLPSFFLCTSVLFILFSVAPWRIYISVDNAEQVLELFLSVMAGVSCMYFLILTTPMQQIIWLLQKMRLPSLFIELFVVTYRFIFVLLENMNEIRIAQTSRLGYFRIKQSFYSLAQLIISIFVKSLKTAQDVQKASDSRGNNGQFLQVEIQQSFNKRNWLTIGCTVFLTYFIFFL. 258
381 1.000e-32UniRef50_A0A1E5QG82 Cobalt ECF transporter T component CbiQ n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A1E5QG82_9CYAN  ali  26  2........HHHLDAYAYTNRLRPLPPQQKLIFALVVLGIA-SIAHPATQGLILIWLSVWIVGYARIPPKXXXXXXXXXXXXXXXXXXXXXWVVGNWYCFISRSGLVQAAEVGMRSLACIPCLLLILFTIPFAELLGVLRQWRVPGVLVDLLLLMYRFIFLFLDVLTQLQLAQRSRGGYRTRQRWMYSAGLLASQLVVRSLQRYQQFSLGLATRGFNGDFQVYANPSSRYSRRYAIESLVGCVGLVIL... 258
382 1.000e-32UniRef50_A0A0Q4BCD8 Uncharacterized protein n=1 Tax=Methanomassiliicoccales archaeon RumEn M1 TaxID=1713724 RepID=A0A0Q4BCD8_9EURY  ali  27  1......MKHYEIDKYAHSSSLFQFDPRVKLACAISLIVVTAFL-RSMEAVMVVLLFTALLVLFSRVPLGHLWKNXXXXXXXXXXXXXXXXXXXXP----------YNAAVLAMRILASVLALTAVISTTPLFDLLRTLRWFRMPKLLSSIMMFAYRFIFVLIDEMDRMKMARMARGGRGNILSRFRTLSFTAGMIFVRSNSRATRIYDALLARGYSGDVHTLDRMKVRGRD................... 218
383 1.000e-32UniRef50_A4J143 Cobalt transport protein n=7 Tax=Desulfotomaculum TaxID=1562 RepID=A4J143_DESRM  ali  21  3.....LFSNITVGQYYPTKSIIHHMDPRAKLLAMPLIIAAVLLANHRLGYLITATMVFLAVALARVPMVSFLRGMKFLWLFLLISLILQTLTWQWGFLAVSREGLLLGLKLAYQLTLLILTAMLLTMTTTPVNLTGALEKLFQPHELAMMMAIALRFIPTLLEEAEAIMKAQQARGGSGKLGPRLKAAVALLVPLLAGSLRRADELALAMEARCYRGD................................ 232
384 1.000e-32UniRef50_D5ECD0 Cobalt ABC transporter, inner membrane subunit CbiQ n=4 Tax=Synergistaceae TaxID=649777 RepID=D5ECD0_AMICL  ali  23  14..............YIPDSFLSRVSAAIKVVL-VFLFALCVALLPSVAAQFFLLMYAFMLVTIARIPIKVIITRLLALDSFLLMMWLTLPLS--------SENGVRLALLITIRAHAATLAFISLLRTTTMPDLLQALHRLHVPQKLILLLHFTYRYAHVLSEEAQKIHKSMVLRGFHPTSFSTFRAYGNLVGMLLIRSIIRSERVSKAMALRGFNGSFPFFSFCATSSPPDTLCMAALYILLAGCFIL. 240
385 1.000e-32UniRef50_V2QDD0 Cobalt ABC transporter, permease CbiQ n=1 Tax=Mucispirillum schaedleri ASF457 TaxID=1379858 RepID=V2QDD0_9BACT  ali  24  1........MLVTDKYAYISKFAKKDPLAKVIFTFTMLFLCLILNNVFVSIFILIFFAGFTIMSNPVSFIKYIKXXXXXXXXXXXXXXXIVILIDKFNIGITYQSLETSLNLFFRALSAVSITYFLALSTPMVSFFESLYKLRLPKLFISLMELIYRYIFILIDEAAAMYKAQKLRLGYRNFKSSLLCVSELAAMLFIRAYKRADFSYQALLSRGYDGEITVISNQYEKAYIFYALMFFIAAFCIIL.... 249
386 2.000e-32UniRef50_UPI000401CD61 cobalt ECF transporter T component CbiQ n=1 Tax=Desulfobulbus japonicus TaxID=231447 RepID=UPI000401CD61  ali  21  3.......................RVDARLKIVTAGLLSLVLASSQSLSCLLAGLILAVVYCILGRLNTWWVLKRLLSLNLFILFLWLTLPLVITLGWVSLYKEGLFLAMIITMKSNGIMLFLMSLIGTLSIPELCRGLQQLRVPSRFVQLLGATYRYIAVIKEEYQRLYQAALLRGFPGTNLHTYRTYGYLIAMTLLRSKIRAERVHKAMLMRGFTGIYPMLSPDSP....................... 214
387 2.000e-32UniRef50_A0A1E5L8H5 Cobalt ABC transporter permease n=2 Tax=Desulfuribacillus TaxID=1543703 RepID=A0A1E5L8H5_9BACL  ali  17  1.....MINQILIGQYVSIDSFLHRLDPRSKLISVFLLMMIVFGAYHXXXXXXXXXXXXXXXXXXXXQARHLYQGMRPILWFVYLTFFLHIFLWQYSFLAVYSEGVITGAIVSYRLFLLMYFSTLLTLTTSPIELTEGIESLMKPHEIALMLTISIRFIPTLLRETDKLIKAQTARGGRGSVLERVKHFVPLLIPLLIMSFKRAEDLATAMEARGYRGDGRSKYRQLMFSWRDYLTLGMLLILTSLIIM.. 261
388 2.000e-32UniRef50_A0A2M7JXJ4 Cobalt ECF transporter T component CbiQ n=6 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7JXJ4_9D  ali  18  1......MKHAFLDHHSQTESPIHHLDARAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLGHLLKKVLVILPFLFVVTISIPFNLGLGGLSISQSGLWILWNVVIKSCLGVFSIILLSSTTSFPQLIKGMEKLGSPKIFTMLTSFMYRYSFILIDEMYRMKRARDSRCFGGRWFWQSKIIGHMIGTLFLRSFHRGERVYLAMLSRGYHGTMPETTGRRFGLEEMLFLSLSPFLVFIRIYI.. 254
389 2.000e-32UniRef50_M8DAA6 Energy-coupling factor transporter transmembrane protein EcfT n=13 Tax=Bacillales TaxID=1385 RepID=M8DAA6_9BACL  ali  17  1.....MLQNIAIGQYVPGTSFLHRADPRSKXXXXXXXXXXXXXXXXXXXXXXXXXXTVMTVMLSRLSLAYILKSLRPVWILVLFTVILHVLYFQWGWFSIEEKGVTQAIFISLRVSLLVLVSSLLTLTTSPIDLTEGLERLLGPHEIALMMSIALRFIPTLMEETDKIIKAQTARGANGNLIRRAQNLIPIVIPLFISAFRRAEELALAMEARGYRGGVRTRLRTLTMSWRDGSIALAACVLLLVIGWW. 263
390 2.000e-32UniRef50_A0A117LI54 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Actinobacteria bacterium 66_15 TaxID=1635289 RepID=A0A117LI  ali  16  1.........MALGQYHKVDSPLHRMDPRFKILVAVVYMLVIFLAREXXXXXXXXXXXXXXXXXXXXXXXXXXRSLRPVIAFVVFTFMVNLVFFALGRLAITSGGLSAAAFMTTRLFTLFVSTALLGFTTSPVDLADGMEGLLAPHEISMMMSIALRFIPILVAEKDRIVRAQTARGADGNPITRMRAIIPVLTPLFLSAFRHAEDLATAMESRCYHGKRTRVKTLQPAWRDWVAVAALTVLTCALVVL.. 259
391 2.000e-32UniRef50_A0A174DN07 Energy-coupling factor transporter transmembrane protein EcfT n=5 Tax=Turicibacter TaxID=191303 RepID=A0A174DN07_9FIRM  ali  16  1......MNGIVIGQYLPGQSFWHRLDPRAKIVATSXXXXXXXXXXXXXXXXXXXXXELVAMTLTKIPLNYFMRSLKPVFFFVILTFVLQIIFFSLGPIEIYDEGLNLGFFMSIRLIIVVLISTLLTLTTKPSDLTLALESLFKPSELALMISIALRFIPTLFEETQKILKAQASRGVDGKFKDKVMQLISLLVPLFILSFKRADELANAMEVRGYVGRLRTSINRLSWKVSDTVLVLVCGALFIGAIIF. 262
392 2.000e-32UniRef50_R6BQU3 Uncharacterized protein n=2 Tax=environmental samples TaxID=2231195 RepID=R6BQU3_9CLOT  ali  29  1........MILFDKLSYSSPVRQTSPALKSLFAVGSLVICVSFRQVSVCVLVLCCMAACTLQFANVTPRRYLRXXXXXXXXXXXXXXLFSFRLFSRYIGISRLSFSNWYSLMAVAFSGVSCLYFLILTTPVTDLLAVLRRLHCPWLLLELMLLIYRAIFVLLDIASAIQTAQNCRLGNRTFRSKLSCMGQMLSVLLVRSLKKSSLLYDAMESRLYDGKIQVLEETQPARPLAWAACCGWLILCTVLCILL 254
393 2.000e-32UniRef50_A0A1D7XDC6 Nickel transport protein NikQ n=7 Tax=Moorella thermoacetica TaxID=1525 RepID=A0A1D7XDC6_MOOTH  ali  24  48............EELAGRRGWLQDLDPRCKLLSLLWLMVVAGLARHPLTLIVIYLGVILLAVQSRVPAGPFLKRVWLFVPLFTGIMVLPSLFLGPWQLAITRQGLAGAGMLILRVGVAVSLGLLVTLTTRWAVLLRALRVLRVPRIFILTLTLTYRYIFLLLKLTEEMFVARQSRLGRMDRRMNYRFLAGSMGNLLARAYFLSEEVYQAMLARGFKGEVQMKEDWRLTLPDYRRAAGIILAGIILL.... 306
394 2.000e-32UniRef50_F5WTV7 Cobalt ABC transporter, permease protein n=23 Tax=Bacteria TaxID=2 RepID=F5WTV7_ERYRF  ali  16  1......MNDIALGRYVPLDSKIHKLDPRIKIIAMLVLMVSIFMVKNVWANVFLFFFFVCAILASKLTFKFILKSIKPMLFMLVFLFVMNMFLIQFAFFKIYSGALYQTAFIVTRLVLMIMVTTLLNLTLGIEDLLNPLKKIGVPHEIAMMISIALRFIPTLIEDTQRIMDAQASRGVDGSFKEKINGAISMLIPLFVSIYHRAEDLADAMEARGYPGKTRTRYKQLKIRFSD.................. 245
395 3.000e-32UniRef50_A0A1V5NRG0 Energy-coupling factor transporter transmembrane protein EcfT n=5 Tax=Firmicutes TaxID=1239 RepID=A0A1V5NRG0_9FIRM  ali  16  3.....MMKRMKLGRYMPGNSIIHQLDPRTKXXXXXXXXXXXXXXXXXXXXXXNTGLIFLVIYLAQTSLSSVMRGVKWLWIIFIFSFVAQCVLFSLGPLTVTLEGVYRGLSTFLRLLILFLSSTILTMTTSPMKLAGGLEALLAPNEFAMLITISLRFIPTLLEEAETITRAQKSRGAPPKKLVRLKTTLAVLIPLVVGSLQRATDLAAAMESRCYTGGPHHSRTKKLRFCRY.................. 246
396 3.000e-32UniRef50_A0A2L1C839 Nickel transport protein NikQ n=10 Tax=Methanococcales TaxID=2182 RepID=A0A2L1C839_METMI  ali  14  4.......SIHSLERDAFVESPLHRIDARIKLIFVFTVVLTATIFNNVYLMVLMEIYMLFVMLFSKIPISNLLKRIIMIIPFGGFIALFQPFIRGLGMLPIYSEGLDFGISLFLKFLVSITSVVLLSSTTPMYEVINAGKKLGIPSIMSTLLGMMIRYLFVMVDVLESTIKAQKSRALNRNYKQLLNTFGSLIGLVFLKSYEQGERTYLGMLSRGYSKDSNIKTLGQKIGFNDILFLSTTTLILSIGIISF 255
397 3.000e-32UniRef50_E0NN07 Cobalt transport protein n=3 Tax=Firmicutes TaxID=1239 RepID=E0NN07_9FIRM  ali  14  1.....MLKDINLGQYYPGESKIHRYDPRLKILSVMFFIVQLFFVKNXXXXXXXXXXXXXXXXXXXXKFKTVFKGLRPLXXXXXXXXXXXXXXXXXLFITVTKESLVLATTTSTRIVLLVWGSSILTLTTSPIQLTDGIESLLKPHEISMMMTIALRFIPTLIEETDKIMKAQKARGADGNVINRAKNLVPLLVPLFISSFRRADDLATAMESRCYNGG................................ 230
398 3.000e-32UniRef50_A0A1F8REY8 Cobalt ECF transporter T component CbiQ n=1 Tax=Chloroflexi bacterium RBG_16_63_12 TaxID=1797657 RepID=A0A1F8REY8_9CHLR  ali  21  1.....MLHIDLADQYQRGASLIHRLNPRVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYASQLGIGYTLKRSFVALPFAL-AAITLPFTVPGGGLTVSAEGSLRFLSILIKSWLSVQVAILLAVTTPFHDLMRGMRELRIPRPLINIVSFMYRYLFVFADEALRLMRARAARSAGGGLMWXXXVAGGLVGNLALRAFERSERIYDAMVARGFQGEIKTLTSPPLTDKDR.................. 241
399 3.000e-32UniRef50_A0A2G9ZPJ8 Cobalt ECF transporter T component CbiQ n=2 Tax=unclassified Desulfobacterales TaxID=1403365 RepID=A0A2G9ZPJ8_9DELT  ali  25  3............EEFAIGDSSLHRLDPRLKIVAASALSIVVAVSTRFSALGVAVGLALILLAFARLPCGAIARXXXXXXXXXXXXXXXXXXXXXXGPIPLMREGLELAARLTIKSNAIVLAFIALVSTSSVVSLGGGMNRLRLPDKLVHLLLLTYRYLFVIQEEYERLKRAAVVRGFPKTNLHTYRTYAFLVAILFIRAAARANRVQQAMLCRGFQGRFYSLQEYAFTPKD................... 228
400 3.000e-32UniRef50_A0A1E8GL71 Energy-coupling factor transporter transmembrane protein EcfT n=14 Tax=Streptococcaceae TaxID=1300 RepID=A0A1E8GL71_9LACT  ali  14  1......MDKIIMGRYIPGDSIIHRMDPRSKLLAMFAFVFVIFMATDLVGYGILFAYTVLAVVLSKIKISYYYTGLKPMFGLIIFTALFQILFFKFWIINITTGALMNALYMSLRXXXXXXXXXXXXXXXXXXXXXDGLKKIGVPYDIGLMLSISLRFIPTLMDDTTRIMNAQRSRGGEGNLIQKIKSVIPILIPLFVSSFKRADDLAIAMESRGFQGGDNRSKYRILKW..................... 241
401 3.000e-32UniRef50_W4Q2X5 Energy-coupling factor transporter transmembrane protein EcfT n=12 Tax=Bacillales TaxID=1385 RepID=W4Q2X5_9BACI  ali  18  1.....MLQNVIIGQYVSTSSLLHRLDPRSKLINXXXXXXXXXXXXXXXXXXXXXXXXXAMVFLSNVSLSFLFKGIRPILWLVLFTFILQLLLYQISIFTVYEEGLRQAVNIAIRLLTIILLTSLVTLTTRPIDLTDGLESLFTPHELALMMSISLRFIPTLMQETEKIMKAQMARGVDGPIGQRMKALLPLLVPLFISAFHRAEELALAMESRGYRGEGRTKYRILLWHWRDTVSILFCIGFGIAIVLL. 263
402 3.000e-32UniRef50_A0A235F6U3 Energy-coupling factor transporter transmembrane protein EcfT n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A235F6U3_9BACI  ali  13  1.....MLQNVIIGQYYPASSVLHRMDPRSKLLASFIFIFIIFLANNFISYGAAALFTLFVLASSKVPAGYLYRGLKPVFFLVFFTLLLHVFLFSLGWLKVYEGGVIQGLYISLRLMLLVMMTSLLTLTTTPIDITDGLELKLPVHEFALMMSISLRFIPTLLQETEKIMKAQMARGADGPIKERVKAFVPLLIPLFISAFKRAEELALAMESRGYRGGRTRLRELNWQLRD................... 246
403 3.000e-32UniRef50_N1ZEJ3 Cobalt ABC transporter, permease CbiQ n=1 Tax=Clostridium sp. ASF356 TaxID=97138 RepID=N1ZEJ3_9CLOT  ali  20  4.......HLKQIDDIAYHSPFIKYTAILKFIFTITIVSLCLYYNNIVISCYIIITMLFINVLKNKINIHDXXXXXXXXXXXXXXXXXXXXXEIHFITLYVTKQTIFKSICIMARTFAAVSALYFLTLSTPIYQIVSVFQKLHVPKILTELMYITYRYLFILAEIQHQLKIASMARLGYCDFKTSIKTFSSCITNLLLLSLQKAQQHYKAMEARCYTGELLFLQQEQCHNNAITIKGVIYILSIVLLNIVL 249
404 3.000e-32UniRef50_A0A1I2G6J9 Energy-coupling factor transporter transmembrane protein EcfT n=6 Tax=Bacillaceae TaxID=186817 RepID=A0A1I2G6J9_9BACI  ali  15  1.....MLDNVIIGQYIPGRSVIHKMDPRAKLLSXXXXXXXXXXXXXXXXXXXXXXFAAGAMLSSQVSLRYIYKGLKPIFLIVIFTFILHIVIYHLGWLKIYEGGLKQGVFISLRLVYLVVITSLLTLTTTPIDITDGLEYLLSPHEFALMMSISLRFIPTLLQETEKIMKAQMARGAEGPIKERVKAFVPLLVPLFISSFKRAEDLALAMEARGYRGEGRTRLRILEWRFRD.................. 246
405 3.000e-32UniRef50_C0BZA8 Cobalt ABC transporter, permease protein CbiQ n=61 Tax=Firmicutes TaxID=1239 RepID=C0BZA8_9FIRM  ali  27  1........MIVVDKLCYQSKLRYVNAGEKFAFSMLSLLFCILSRMFLISAAVLAVNSFLTVRKGGIAPGHXXXXXXXXXXXXXXXXXXXAVPVGAFFITGSRDSVLFGVRLIVTAMSAVSCLYFLSLNTTMTDIMSVLNRLRCPRVIIELMLLIYRYIFVLMETASAILVSQKARLGNRDLRTSVRSFGQMGCGLLIKAFRRSGALYDAMESRCYDGTIRVLEEQRPAR..................... 233
406 3.000e-32UniRef50_E3DP19 Cobalt ABC transporter, inner membrane subunit CbiQ n=3 Tax=Halanaerobium TaxID=2330 RepID=E3DP19_HALPG  ali  18  9................YGDSWVHQLDPRLKIIVAFLTAFIIALTKDLVTLTYFLFLAIILIFNSKIEIKFLFKKXXXXXXXXXXXXXXXXXXXXXXXFSLTIEGVYYALKITLRSNAIMLLIISLLTTTTMSNLIHALYRLKVAEKLIYLFFFVYRYLHIIKKEYNSLNEAMLMRAFKATNLHTYKSYAYLIAMLLIKSYERSQKVYEAMICRGFKGKFIFFDDFKIKKIDILFTIALVVSLSLIFVI.. 247
407 3.000e-32UniRef50_C4IBT0 Cobalt ABC transporter, permease protein CbiQ n=27 Tax=Clostridiales TaxID=186802 RepID=C4IBT0_CLOBU  ali  19  3.........RKIDSYAYKSKLRKINPAFKVIFAFLTLLICIIADNIYVSLAIIVSMGFITIFKGGIKFHEXXXXXXXXXXXXXXXXXXXXLHLCGFYLYTSDENIMKTMEIVMKAFGAISAMYMMTLSTNTSEIISVLRKSHIPKIIIELMNMIYRFIFILIDVQCKMKNSAQSRLGYIDFKTSCYSFGSTASNLLIVSLKKANTYYNAMESRCYNGDMLFFEEEKKVK..................... 234
408 3.000e-32UniRef50_E1QKE5 Cobalt ABC transporter, inner membrane subunit CbiQ n=2 Tax=Desulfarculaceae TaxID=453228 RepID=E1QKE5_DESB2  ali  23  24................GRGPLTRLDPRAKLLAALGFSLVTSLCASPWAATA-ALSLGLGLTLAARLGLGPVLRRTATVNVFVLFLWAFLPWRLEIAPLVFNPPGLSLAWLITLKVNAIFFALTGLLATSRVNDLLHAMAHLRLPGKLVTLFLLFFRYLFVLHREYQRLTLAMRVRCFPGNNLHTYRSYANVVGMLLVRSFDRAERVFQAMLCRGFNGTFWVLDHFAWRRQD................... 244
409 3.000e-32UniRef50_F7V8Z9 Uncharacterized protein n=1 Tax=Clostridium sp. (strain SY8519) TaxID=1042156 RepID=F7V8Z9_CLOSS  ali  17  1.....MLKDITIGQYYPGQTVLHRLDPRVKLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRYLRGIRAIWPLIAITAGCNLVFWQFGILRITPLSIHNSVFYSIRLVLLVVGTSVMTLTTSPNKLTDGMEALGAPHEIAMMMSIALRFIPILGDEAEKIKKAQLARCADGNLIRRARGMLPILVPLFVSAFQRAQDLSLAMEARCYHGGRTKLHPLQYARRDYIGYGCILAALGVMIALRI 265
410 3.000e-32UniRef50_A0A1V4SKB6 Energy-coupling factor transporter transmembrane protein EcfT n=8 Tax=Clostridiales TaxID=186802 RepID=A0A1V4SKB6_CLOHU  ali  18  6...SSVMEVKHIDELSKQKNLINVHPLAKLLLTLVYIFVLASFDRYXXXXXXXXXXXXXXXXXXXXPVKNIFKRVVLLEPFIIITGILNPVFVEIGGVEIS-GGWLTFFSLLLRSTLMITAGFLLVATTGIENIARALTLLRIPTVFVLLFLLTYRYIFVLTDEAGRLLKAYHMRAPKQSGV-RIKVWGSMVGQLLIRTYNRAQTIYQSMILKGYTGRYNSGEGSGVNTLDIIYPALWLLFMAAARRF.. 254
411 3.000e-32UniRef50_A0A0M2PHX0 Uncharacterized protein n=6 Tax=Bacillales TaxID=1385 RepID=A0A0M2PHX0_9BACI  ali  20  1........MIKIDDYAYTSGLKDVHPVEKVSFTLIFLFFTILSKNISVACFTFTVMSIAVIVKAKIPFMAYLKXXXXXXXXXVGLDVLWMAEAGLWKIYISSYSIQQSYELAATILASVSCLYFLILSTPLYQFMWLLKKGKLPAVFVELMGITYRFIFVLLEKMNEIYIAQSSRLGYQNYRSWFSSAAQLIVSLFVKSMHSAKELQITIDSRGGDEHLYDVDLSLGYNRGHFVIIFISFVTLSMIYMI. 257
412 3.000e-32UniRef50_A0A1B3WPF8 Cobalt ECF transporter T component CbiQ n=1 Tax=Anaerolineaceae bacterium oral taxon 439 TaxID=1889813 RepID=A0A1B3WPF8_9CHLR  ali  28  1........MRLIDRFAYNNRIRKLDPAWKAGFSLLLLLSCLTVNRAGFSAACXXXXXXXXXXXXXXXXXXXXKILFTEAGFLVLSVGTVAVFFFGLWFSATQESLAAAGGLFLRSLACVSAMNLLALTTPMVDLIDLMTRMKVPDSLIDILTLIYRFIFTLLDCLDRMIVAKEARLGFRTFRNAFRSSADIAASLFIDAYRRSQRLQIALEGRCWNGSFRVLPRDYESPRSLW................. 236
413 3.000e-32UniRef50_D2PMS3 Cobalt ABC transporter, inner membrane subunit CbiQ n=13 Tax=Actinobacteria TaxID=201174 RepID=D2PMS3_KRIFD  ali  23  62................................................................KLPLTTVLRRLAVETPFIVFALLLPFVATGPLGVSLSQSGVLGAWNVLAKGTLGVLAAIVLSATTSPRDLLAGLERLRLPPTLVAILSFMVRYLGVVSDDLHRMRIARESRGYAGGRAGQLTAVAGGVGALFVRSFERGERVHLAMQSRGYTGRMPQLAVGGAGRAQWLEGLAMSL.......... 241
414 4.000e-32UniRef50_A0A2N6EB80 Cobalt ECF transporter T component CbiQ n=4 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6EB80_9DELT  ali  20  5........HGFIDAAGENRRLLVALDGRVKLALLIAALGVNLTAGGVRTPLLLAGLAFLLVRLAGVRSGSFFKRMAVPFTLACVAFVTQLFWVQEGGFVFFSGGVLRGLELASRIVGGMGVLLFFSLSTPLPELMRAARFFRCPPVLVELALIMYRYIFLLLEEGGRIRGAQKARLGYTGFRNALRSGGILGGMLVLRTYDRAENSFAAMRCRGYRGALTAIVPGHMQGRDWLALVFGSFLLLGLYL... 254
415 4.000e-32UniRef50_Q5V048 Cobalt transport protein n=28 Tax=Halobacteria TaxID=183963 RepID=Q5V048_HALMA  ali  22  25............EDLPDRDGFLQAVTPTVKLVGVATLVALTVTQRTLAVVSALALVATVLAALSRVPVRTFLGRLTGPPAFALVVVAPQAFLMGGGSLPLSAAGVDYVLTFAVRVTACVGFLSVLLLTTRFADLLAAFRRLRAPPIAVSLLGITYRYLLLFFAELERMVRARRSRTAEPSLRRNWRDSGHFVGSFLVRSLERGERVQRAARARGGTGSTPAQPREPLGRADFAF................ 250
416 4.000e-32UniRef50_A0A1S6IT99 Transporter n=1 Tax=Desulfotomaculum ferrireducens TaxID=1833852 RepID=A0A1S6IT99_9FIRM  ali  22  2....SFFSNITLGQYYPGNSFIHRLDPRAKLLAMPLIMAGILLAQGPIGYTVASLPPIVGYALAQVPLSALWRGMRLLWFFLIFSLALQALTYPWGIITISREGLLLGLRLIYRLALLVLTAMLLTTTTAMERLLKPLKRLGVPHELAMMMTIALRFVPTLLEEAEVVMKAQQARGGSGSVEKRVRAATALLVPLLAGSLRRAEELAIAMEARCYRGDGRTKLKQFQYNYQDYATLISLVAITIIVGL.. 263
417 4.000e-32UniRef50_M1FDW6 Energy-coupling factor transporter transmembrane protein EcfT n=23 Tax=Proteobacteria TaxID=1224 RepID=M1FDW6_9ALTE  ali  20  11...............SSQSWLTQRDSRTRVITAVLFSIAVVSLARXXXXXXXXXXXXXXXXXXXXRPL-ILLKRMAAMETFMLVVLVLLPFTTPGGALSASQEGLTLAVTIILKANSVVLMLLALVGTLEPVVLGHALARMRIPTKLVHLFLLTVRYISVLHGEYQSLRRAMQARAFPRSNFHTWRSFGNLLGMLLVRSLERSQRVMAAMKCRGFDGRFHLLSEQHWQWRD................... 232
418 4.000e-32UniRef50_A0A2D6J0F0 Cobalt ECF transporter T component CbiQ n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2D6J0F0_9CHLR  ali  21  2....SHKDKLFSDVFVHRENLVTRIEARTKISFTVVALVINLLSPTXXXXXXXXXXXXXXXXXXXXPPKLLGLRLAMPLVMAGVVLITQIFFYGGFNLVGYEEGLARGLLIMYRVIGGVSLILFLSMSTPMNKLLMAATWFQAPKIFVELALLVYRYIFVLLEEIVTVKDAQRIRLGYHNWRQSMRSLGVLGGSLILRTYDRAERVFEAMIARGYSGTVTVSYSEHFGRKD................... 238
419 4.000e-32UniRef50_A0A0F2PST3 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c4b TaxID=1629717 RepID=A0A0F2PST3_9FIRM  ali  21  7..............YASTDSILNRIDPRIKILSVFGFVAIISSLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXXAALTLSLGPLALEATREGLHHAAVLSLRILTAVLAINILVLSTGFRNLTAALVQLKVPVVLIQIVEFTVRYIFVLTDELQRMRVARKARGFEAGRLHTYRTLGLLIGVLFVRSWERGERIHQAMLARCYSGKGETGKEQSLKTADLCWGFTVVAVAVSL..... 251
420 4.000e-32UniRef50_A0A1Y0IQG7 Uncharacterized protein n=3 Tax=Tumebacillus TaxID=432330 RepID=A0A1Y0IQG7_9BACL  ali  19  20.................NSFVGGVNPSVKLFLHLLCMILLVFSRDPWTTLVLLAVPVIITLTLAKIPLKTFIVRVSPFLVLFLSTTWVLAVWWEWAWIRITAEGLQNGLNIGLRMMAFVCYGFLFTATTDVTKLVMSLQQCKVSPKFAYALLAGFRFLPLFKEEYAQIKAAHRVRGVARGLRGKIQGVMRYTIPLLAQGIRKAERVAVALEARGFDGTLRTFYHQMTVGRRDALYLALLVVTNLAVLLLL 263
421 4.000e-32UniRef50_UPI000A04A84F energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Desulfurispora thermophila TaxID=265470 RepID=UPI000A04A  ali  20  22............GQYFPGDTVLHRLDPRCKIVVCGLLMVATLAARELY-ILLPALTLLLATRLARLPVSQLWRGMKLFWIFLLVTMLLQFFFTAGGPLQISRQGVALGVSMFGRIVLLILSGILLTFTTSPSRLTAGIESLLSPADIALMMTIAMRFVPLLLDETWQIMQAQQARGGSMAIRQRLKSALALLVPVLIGVLRRAEELALAMEARCFVGSRRTHLHSPCWRARDTAVLLGACGVLVVVL... 273
422 4.000e-32UniRef50_A0A0H4TC41 ABC transporter permease (Fragment) n=1 Tax=uncultured actinobacterium Rifle_16ft_4_minimus_550 TaxID=1665149 RepID=A0A0H4TC41_9A  ali  18  21.....ILSNITIGQYYSASSQVHSLDPRAKIVLVILLMAATFAIQNXXXXXXXXXXXXXXXXXXXXXXXXXXRSVKPLLYIIIFSFIVHILFTGGGIINITREGVRNGFFITLRLVLLVSGTSILIFTTTPIELTDGLEKLKVPHELAMMLTIALRFIPTLLLETERLMKAQMARGADGNFLRRAKCFLPLIIPLFISAFRRADELALAMESRCYRGGL............................... 251
423 4.000e-32UniRef50_A0A2P5K2K4 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=ANME-2 cluster archaeon HR1 TaxID=1968520 RepID=A0A2P5K2K4_  ali  29  91........................................................................................FSIDIFGFTLTATKDGFSRALISTGRMLGSVTCLLFLALTTPMADIFVLLHKLHLPAVFIELSMLIYRNIFVMLQEALRMEYAQKMRLGYSDISGSIHALSMLAGNLFIRSWDSAERTLIAMDSRCYDGTIRVLVEDPPVSKTFLFGLVGFELVLIYLNIII 252
424 4.000e-32UniRef50_A0A096AN49 Uncharacterized protein n=2 Tax=Veillonella montpellierensis TaxID=187328 RepID=A0A096AN49_9FIRM  ali  19  14.........FSIDMYAYHSNINGWNPGLKLLLATCMICSCIVLDNLYVSMSIILISMFITVVIGKMNFREXXXXXXXXXXXXXXXXXLFGMWTPLGYIFASHESLNTVLHLWGKAFGGMSAMFMLSLSTPSNEIFSVLRKLYVPTLVIELMNMVYRFVFIMIETFLHMHESAESRLGFVNYRTSLKTFGCIASNLFIVSMKKGDRYYDAMEARCYDGNLVFLETEK........................ 242
425 4.000e-32UniRef50_A0A1V5UKA1 Energy-coupling factor transporter transmembrane protein EcfT n=16 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1V5UKA1_9BACT :  ali  14  1......MKNISLGRYLPTNSFMHKADPRIKFFGLIIFMVLIFLKTDFLMYGIYALVIFIIMKVAKLRVFSIFKQLKSLWFMMIFLLVINLFTFQIGNFAVKDIALYQTLYILIRLVLMIALTSILTASTKPLDLTYAIEWYMSPHEIAMTLSIALRFIPTLLDETGRIMRAQESRGVDGRVKEKIRAIVALIVPLFVSALQRSDELANAMIARGYDAKRTRYRLLYFSWRDVIVLCLSLGFLTGVILL.. 269
426 4.000e-32UniRef50_A0A1F8PQ89 Cobalt ECF transporter T component CbiQ n=1 Tax=Chloroflexi bacterium RBG_16_51_16 TaxID=1797644 RepID=A0A1F8PQ89_9CHLR  ali  18  1......MHSDIFDRYHHSNSPLHRLDPRIKVVIAIAFILSNALLPDXXXXXXXXXXXXXXXXXXXXNLGFLFXXXXXXXXXXXXXXXVTTFRFLFWNLTITDVGLIRFISIVIRSWLSVQMAVLLVAVTQFPDLIHALEHLHVPRIITTIIAFLYRFLFILTDEVLRLLRARKARSAGGDVIWRAQVAGHMTGQLFLRSYERSDRIYNAMLSRGYTGNLRTLNPHQIHGRD................... 243
427 5.000e-32UniRef50_A0A1W7QQR8 Cobalt ABC transporter permease n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1W7QQR8_9DELT  ali  22  5..SAALLDLKRLDQLASGTTFLHRLDARAKVLATLFFIVCVVSFDRXXXXXXXXXXXXXXXXXXXXXXKYLLAKVALVLPFAIAVGICNPFFLQVGALKLT-GGWLSFASIVLRTGLTVTAVFSLTALTGFPAVCSALKRLGMPRPFALQLLFLYRYLFVLAEEGARAAKARELRCF-GRKGAGLKSYASLIGHLLLRTWHRAERLHMAMLARGFSGAFPEPVKKRVRVADLAFLSLWVSLCIALRL... 254
428 5.000e-32UniRef50_UPI000482FC46 cobalt ECF transporter T component CbiQ n=1 Tax=Fusobacterium perfoetens TaxID=852 RepID=UPI000482FC46  ali  16  31..........YFEYYSYKSQIRDWNSYLKVFYPXXXXXXXXXXXXXXXXXXXXXXTNYITIYLGKIPIKRYIDSWKIPFLFLIFTIIVINFYFLNNYIYFTKEKLYESIEIFFRVLSGISSMYMLIYSTSIEEIIKVLRKIKMPDIIIEIMYLTYRYIFILLNTYYEMRVAIESRLGFINYKLSLNSFGKIISNIFLISFRKSIVFYEAMEARNYNGKLIFFERKEKFQKKIFICMLLSIVFLILVFIF. 281
429 5.000e-32UniRef50_A0A0L6JN90 ABC-type transporter, integral membrane subunit n=1 Tax=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933 TaxID=398512 RepID  ali  17  1.....MIKNITLGQYVQGNTLLHRADPRTKXXXXXXXXXXXXXXXXXXXXGLAVFFTVIVLAGTKVHISYVIKSIKPIFLIMMITGIINLIATKGGFVRITYEGIGITVKMILRLSLIIINSSMITYTTALESLLAGLKRFRVPHEVAMMVSLSIRFIPILVEETDKLMKAQASRGAQGGIIKRAKGYIPLMIPLLAGAFRRAEELAMAMEARCYRGEGRTRLKQLKYSKDDIKVSVLFLVFIICAI... 260
430 5.000e-32UniRef50_A0A0E9FRW5 Energy-coupling factor transporter transmembrane protein EcfT n=34 Tax=Bacteria TaxID=2 RepID=A0A0E9FRW5_CHLTH  ali  15  3......MNNIALGRYMPLDSVVHKMDPRSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLVLSKLSIQYAFRSMKPMMWMMVFLFVINCFWVHLGPITVYSDAITQTLYIVVRLMMMIVITTILTATTKPLDLTLGIEKLLKPHIIAMMISIALRFIPTLIEETQRIMNAQASRGVDGTLREKVMAILSLIVPLFVSAFDRADQLANAMEARGYD.................................. 230
431 6.000e-32UniRef50_D9SNZ3 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) T  ali  24  1........MNIIDKCANDSKLRNIEATPKIFFGLILLCICLCGNKLFLSLTIFVTITFITIKISGVKMETYLRXXXXXXXXXXXXXXXXXIRFSSYFLSISRENLILGFELFFKALASVVCLYFISLTTPLFEIIHFLNKIRIPKFLTEIMLIMYNFIFILLEAMETIRCAQNIRLGYKNLKTSYNSTTMLATSLFIKAFKHSEDLYNSMEARLFNGEIRLLK........................... 227
432 6.000e-32UniRef50_V9HEH7 Cobalt ABC transporter, permease CbiQ n=9 Tax=Clostridiales TaxID=186802 RepID=V9HEH7_9CLOT  ali  14  6...KALYEIQGIEDLANRDYLVNIHPSIKFILTVTYISLVVSMDKYNLGGVIMSIYPIILLITCDISLKDSLRRLKIVLSFVFLMGIFNPFFLININGISISGGIISMITLIMKGILTILASYLLIATTTIEKICYAMDKIHIPNIFITEILFIYRYVTVLIEEANKITESYSLR-APNHKGINYKAWGSLIGQLLLRSIDKAENIYESMCLRGYSDKFYYSYKIRYNAKD................... 238
433 6.000e-32UniRef50_A0A2H6JQ61 Nickel transport protein NikQ n=1 Tax=bacterium BMS3Bbin14 TaxID=2005737 RepID=A0A2H6JQ61_9BACT  ali  20  25............EHYARLPGLLQGLDPRGKILTFLALLIATAVTHRPEVLLGIYLLTVVLALASRIPLVFFTKRXXXXXPVFTLVTLAAPINWGPFHITITEQGLRGAVIFILRVATSVSLSVLLILTTEWARLLRALSALHFPRVGILILGMTYRYIFLFIKVAEEMFLARRSRVGRTSTREQQRWVSARLGFMLNKSYNLSNEVYLAMLSRGWNGQARFLDDFHFQWKDAAWVAFTFAFIFLIVFF.. 285
434 6.000e-32UniRef50_A0A2N6FAI1 Cobalt ECF transporter T component CbiQ n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N6FAI1_9DELT  ali  20  5..ELAFFDLGTLDTLAYSDSPVHRLDPRVKVVVVLTFILTVASYGRYXXXXXXXXXXXXXXXXXXXXXXXXXRKVLLVAPFALFIGIFNPLLDQTPYLSIGDGGWLSFASILLRFVLTVSSALILIATTSFPGVCRALERLGAPRVFAVQLLFLYRYLFVLVEEGARMVRARKLRS-QPGRGEGFRSLIPLLGQLLLRTLARAQRIHQAMLCRAFDGEFRSTHREHFGRQETLFLCGWCGFFLLARLYPL 257
435 6.000e-32UniRef50_UPI0009707F4F cobalt ECF transporter T component CbiQ n=1 Tax=Propionimicrobium sp. Marseille-P3275 TaxID=1871034 RepID=UPI0009707F4F  ali  38  1........MIALDDAAWAAPWRHVRVGQKVMLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIPPRXXXXXXXXXXXXXXXSPPSYLYKLGP--LSISQQSLTNAITVFARSCSATLSVLLLATTTPMADLLSWLRRLGVPGTLIEIASLMYRMLFVLLDSAIAIHQAQVARLGDAPLRRKFDNTGKAVGTLALRSWTRAQRLTDGLDARGITGDLVILTRQPQFSTR................... 237
436 7.000e-32UniRef50_B9M4Z7 Nickel ABC transporter, membrane protein NikQ n=39 Tax=Bacteria TaxID=2 RepID=B9M4Z7_GEODF  ali  16  5..DSALLDFKRLDLLAKGDTIHRLDPRAKVLVTLAFVVTVVSFGKYELSXXXXXXXXXXXXXXXXXXXXXXXRKVAIICPFAVIVALFNPLFMEFGPLTIS-GGWISFASVLIRSALTISAALILLCVTGFPSICRAMEKLGMPRAFAVQLLFLYRYIFVLAEEGSRVSRARELR-ANGKNGLGMKSFIPLLGHLLLRTWLRAERVHMAMLARGFEGNFNTRHQFTFGRRETAFLLCWSTSFFILRC... 254
437 7.000e-32UniRef50_UPI0009FC5710 cobalt ECF transporter T component CbiQ n=1 Tax=Desulfovibrio putealis TaxID=270496 RepID=UPI0009FC5710  ali  20  42........................LDPRSRLLCAFGLCVAVAVCRSWPAALAGLGFGAACLALNSGRWGMLARRLALVNVFFLGLLATVPLAVPGGSLAFTREGLMLALHMTAKGNAIFLIFWGLVQPLSPPRLGSALSALGVPDKLCLILSLTFRYLDLMRHEWDRLVTAARLRGFPGTSRRAWGTYGLLLALLFMRAMDKSAAIHQAMICRGFDGRFRSLGGLRWRTADTALGVAALAGIVLVAVL.. 272
438 7.000e-32UniRef50_A0A1B2I1L4 Cobalt ECF transporter T component CbiQ n=4 Tax=Synergistaceae TaxID=649777 RepID=A0A1B2I1L4_9BACT  ali  23  7....SVYEIYSLEQLAGGGSVIHALDPRAKILGTLFYIAAVVSRGEXXXXXXXXXXXXXXXXXXXXXXXXXXKRSLVALPFCLFAGLSSAFFFTVGGLHVT-AGWMALFTIVFRTLLCVSAVLILVAVTPFRELTEGLRRLRLPAVFISLFEMTYRYLGTLAGEALSMYTAYSLRGG-GKKGVAMRDMGSFAGQLLLRSFDRAERVYQAMKCRGYQSAPPSAIRKRRLAPGDLVFILLLCGSSLLFRLI. 256
439 7.000e-32UniRef50_A0A1M4MQY0 Uncharacterized protein n=3 Tax=Methanothermobacter TaxID=145260 RepID=A0A1M4MQY0_METWO  ali  31  2........NVSVDYYAHTNGLRNTSPAFKMALALITMIISLAXXXXXXXXXXXXXXXXXXXXXXXXXPAYYLKXXXXXXXXXXXXXXXXXXXXXXXGIKVYSDGLNTGLLVFSRIMGGFTCLAFLALTTPLNEIFQELERLRVPRAFTEIALLMYRSVFIFLEEASVMYHAQDTRLGYSGIRNSYRSLGLLAGNLFIRSWLRGEALYRSMESRCYQENLPSMGKQTSTSP.................... 229
440 7.000e-32UniRef50_A0A1J5IER8 Cobalt ECF transporter T component CbiQ n=1 Tax=Syntrophobacteraceae bacterium CG2_30_61_12 TaxID=1805379 RepID=A0A1J5IER8_9DELT  ali  27  63....................LFQRWDTRIKLATLLGYAFLVVSLHRPGPAAAAVLISAVAVLLARIPSTGVLKRAAGISGFLLMLALIMPLTVGLEFLTFNPRGLTLALTIGCKALAVALLMEPMLATSALGNTLEALARLGVPVKLTQMVLLSHRYLHVFAAESQRMQTAMRARGFKRTDRRTLQTVANFLGMLFVRSFDRTQRVQDAMLARGFTGRFPVHHRF......................... 280
441 8.000e-32UniRef50_A0A1G9QZL5 Cobalt/nickel transport system permease protein n=1 Tax=Romboutsia lituseburensis DSM 797 TaxID=1121325 RepID=A0A1G9QZL5_9FIRM :_  ali  22  1........MLLIDKYAYTNSLTEINPKIKGSIGLIFLIISMAFKNIFCLISIITFMSSLIVFLAKIDLKSYLKLVKIPMYFLIMGVLINLINISFLNIGISNKSIITSVHILFRAIACLTCIYFFILTTPFNQIIFLLKKLHISDTVIELSMLVYRFIFIFLEEVSDIRKSQQLRFGYINLKTSYNSIGILGNMLFKRMMKRYDEMCISLDIKLYDSKFHI............................. 226
442 8.000e-32UniRef50_A0A2D6DK11 Cobalt ECF transporter T component CbiQ n=1 Tax=Oceanospirillaceae bacterium TaxID=1899355 RepID=A0A2D6DK11_9GAMM  ali  21  24...........................................................................................LFTIAGLTASWQGLWQAVTIALKANAIVLMLMTLVGSMEMVTLGHALGKLRVAKNMVHLLLFTVRYLDVLKEEYQRLRQAMQARAFRGNNWHTYRSFGYLVGMLLVRAMERSERVLEAMRCRGFNGNLPMLVELRMGIADWVFVAVMTAALSGLLYM.. 181
443 8.000e-32UniRef50_D7EAP8 Cobalt transport protein n=1 Tax=Methanohalobium evestigatum (strain ATCC BAA-1072 / DSM 3721 / NBRC 107634 / OCM 161 / Z-7303) TaxID  ali  15  2.......................................................ITFTLLIISKLPFKFIFNHVKWVSLFILPFLIIMPFTVNGSNITVTHEGITYGFLITVRAFTAILLVFTMLGTMRFDTTIKALHMLKIPNPLIQMLMFTYRYIFVFLDEFQRMWTAMTSKGFKPGLISSMSKIGKSVGMLVVKSYERAQRVYQAMLSKGYTGNPNTIVKFNIKTKD................... 184
444 8.000e-32UniRef50_A0A2N2FY64 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-4 TaxID=2013754 RepID=A0A2N2FY64_9DELT  ali  19  302........LVMMGGYAPGDSLLHRTDARSKILLALLFMVLLYSVESYGALFLLCAFMLLLTLGIGRSLSDSWRGLRPILWLAACAAFFNIFFVSGAPLYLSYEGLHRSAKMMLRLILLVSSATLLTATTSPLALTSGLESLLQPQQLAMLFALALRFIPVIVEEAAKSIQARASRSPAGGLRQRLQGYIPLLFPLFVAIFRRGEALATAMEARCYRGDLRTRMRPLQFSSADLFSSA............. 549
445 9.000e-32UniRef50_D2RGQ9 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18)  ali  20  1......MKHHLVDRYYHLDSLIHRLDPRAKLLGIFILVFSIVLVKDLLACILALTISLIFLYLSKLPLKFAFEQLKYGLIFLLILSITMLIFGH------------RPFEIFTRATSALILIFVAFATSRFDISIKALNQIGFPSKLTQILMFAYRYIFVFAEEYEKLSIALKMKGFKRTNIHTFETIAKLIATLFIRSYERAESVYRAMILRGYTGNIETITDFKITARD................... 214
446 9.000e-32UniRef50_A0A2G6G126 Cobalt ECF transporter T component CbiQ n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2G6G126_9FIRM  ali  23  1........METIESYSYSSPLRLVHPNIKLFAVLLTLVLTIFCYXXXXXXXXXXXXXXXXXXXXKVKWSSLIHLMRVPLSFIFLSVITIIVEFGGDIVYISQSGIWRGLTVMLTAMAAANAMYLLALSTPIIDFCEGLAMLKLPKSMVTLMLMIYRLIFVVSEMANKMRIAQTARLGYQTFREGLHSFGVLVSSIFIRSIKRTTKLYNALEARAYNGDIVVLSQDYQMR..................... 231
447 9.000e-32UniRef50_D3RNW1 Cobalt ABC transporter, inner membrane subunit CbiQ n=4 Tax=Chromatiaceae TaxID=1046 RepID=D3RNW1_ALLVD  ali  22  1......MTAAPIPHLAGSGWIVARDPRLRVGAALAFALITVGLDHP-GSTATXXXXXXXXXXXXXXKARDLVRRLLALEGFMLILVLTLPFTTPGGSLRASTAGRDLALMILLKANAVVLALMALVGTLEPVALGQALGRLGVPDKLTHLLLMTIRQIHLIHAEFIRLRQAMRARAFPRTDRHTWRAYGWLMGMLLVRSLARAERLMDAMRCRGFRGRLYRLDTPHWQPGDTLAALSLMILLGALAWL.. 248
448 1.000e-31UniRef50_A0A2J6J0A7 Cobalt ECF transporter T component CbiQ n=2 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2J6J0A7_9DELT  ali  20  57................PGTTPLHRWDARFKIAAIIGFAFLTVSLHRSLYIGAALLVAAGLVSLARLSWSRSLRRIMAMNGFLAMFLVVMPFTAIIHPWPLNLRGLELAVQIVGKAWTVALLMEPLLATAPLGSTLAGLTRLGVPDKVAELLLIAHRYIHVFFGELQRMRCGMEARAFRSGFRGALRDYGNFVGMLLVRSFERTHRVYDAMQARGYAGLMPQQEVGKAKAADWL................. 286
449 1.000e-31UniRef50_UPI000A073881 cobalt ECF transporter T component CbiQ n=1 Tax=Uliginosibacterium gangwonense TaxID=392736 RepID=UPI000A073881  ali  46  13........MLIIDQLAHGNAWRHHALIEKICLGLGGLGVVIGQPGWVTGTLVSCALMAAAVWGARIPFGFLLRVLCIPAGFVVLGALTFLFSVDANGIHFVASGVAAAFTLIGRSFAATVCVCFLALTTPATDLLCGMRRVGLPRDVAEIALLTYRFLFQIAETAATMHAAQAARLGHVTPMRRLRCLGMLVANLLPRAFERARHMEIGLAARNWNGELRV............................. 225
450 1.000e-31UniRef50_A0A2K8N485 Cobalt ECF transporter T component CbiQ n=1 Tax=Kyrpidia sp. EA-1 TaxID=2055160 RepID=A0A2K8N485_9BACL  ali  33  14........MSPIDRWAHANRWRRLHPLQKTVFA-AALGGXXXXXXXXXXXXXXXXXXXXXRYGAGIPVRAFLRFMALPLSFLSLGAIPLLVQIPGWWIGVNGEGVRTAVTVWVRALAVTSSMYVLALTTPVPDLVDMLRRVNVPEILLEVMHLMYRYLFILMEMAQQTYVAQSSRLGYQSWSRSLSSLGRLGAALAVKSRLEVEDLHRALISRGYRGRLTVLPPP......................... 243
451 1.000e-31UniRef50_A0A1F9MRZ1 Cobalt ECF transporter T component CbiQ n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1F9MRZ1_9DELT  ali  18  5..EAVLFEARALEILATQNTPIHRLDPRAKLLTTLIFVLVVLSHDKYAVXXXXXXXXXXXXXXXXXXXXXXXKKLLIVSPFAILIGIANPLLFHLGVIPVS-GGILSFLSILLRFMLTVSSGLLLIATSGLSEICLAMGQLKVPQIFTIQLLFLYRYIYVLIEEGARLVRARNLRSFNGH-GQGLTTAGPLIGQLLLRTLERARRIHLAMLCRGFTGEIRVMRDFRMQTMDWLFLTGWTTLFILLHYL.. 255
452 1.000e-31UniRef50_A0A2N2ABP1 Transporter n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A2N2ABP1_9FIRM  ali  16  1......MEGIVLGQYIPGNSFIHRLDPRSKLVISIILLWMVFLLTRPAEFVGFSVFIVFSYFMAGVT-GSFLRVLKPGFYLILFTLTVNMVFTPGGPVAVTREGFILGAVIGLKLVFLISVSSLITLTTSPVRMTDGLERIGVPSELGMMMNIALRFIPTFWEETDKIKKAQVSRGADFNTWRRVKYATALLVPLFVSAFRKSDELAVSMEARGYSVERTSLYELEMHKRDYVTLVVVSVLAAVFLWY.. 260
453 1.000e-31UniRef50_A0A1T4W7C2 Cobalt/nickel transport system permease protein n=2 Tax=Desulfovibrionaceae TaxID=194924 RepID=A0A1T4W7C2_9DELT  ali  18  4............ESFSLGHSPIHRLDPRGRILAACAFSCVVALLHIRLPLYIALACGLCLLLCARLSLSSVLRRXXXXXXXXXXXXXXXXXXXQVWKFTASLEGIQLATDISIKSNAIIMAFIALISTIPIPDLGHALLRLKVPQKLSLLLLFAYRHIFLIAEEYQRLHAAMKIRGFPRTNLHTYRAYASLLGMVIIRSWERSERVYNAMLCRGFRGTFRSLNGFRFTLSDRVFVFFMLALSCALAA... 245
454 1.000e-31UniRef50_UPI0009842D80 cobalt ECF transporter T component CbiQ n=1 Tax=Anaerosalibacter sp. Marseille-P3206 TaxID=1871005 RepID=UPI0009842D80  ali  23  1.........MVIDKYAYTNKIVNVNPMAKFIFAIGALILAVGLNNFYLNIIIFLIMFLSTTVVAKIPIKNYLKLYLIPSVFLIISVFIWSIRIGKSFIGIKSESLNEVIIIIARVFASISSTFFIALTIPINQLIVVFKKLRVPGNVVELIILIYRSIFIFLEEMMEIYNIQEMKFGYCGMKNSYRSLGLLIKCLFVRVLQKYEDMVISLETKLYDGEFKI............................. 224
455 1.000e-31UniRef50_A0A0S8IW17 Uncharacterized protein n=3 Tax=candidate division Zixibacteria TaxID=1379697 RepID=A0A0S8IW17_9BACT  ali  18  2....AFLENITIGQYVPADSVIHRLDPRTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLSFASGVPFFYFFRNLKSFVWLFLFTFVLHTFFTSGEFIRVTYEGVINGIIYSWRLAIFIFCAAFLSLTTQAVELTDALKKWKLPEELSLITMISLRFVPLLLEEAFNLKKAQLSRGFEGGLIKRVKKTLPLLIPLFVSSFRKADELALALDARGFRSGQERTCFQRLVFKKVDYLFLSFVVLIIVTSFLI 265
456 1.000e-31UniRef50_R5WQ51 Energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Corallococcus sp. CAG:1435 TaxID=1262867 RepID=R5WQ51_9DELT  ali  18  1.....MLRDVTFGQYYLADSFLHKMDARVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVPLKSILKSIKGIIILLALTVLLNVFFWEWWIFQIYDEGLKFAAKMLLRLTYLVMGSSLLTLTTTPVDLTHAIESLMKPHELALIMSLTLSFIPSLIEETDRIIRAQKARGANGNLVKRAKAFVPILIPLLVGGFRRAEELANAMNSRCYEGTVRTQMRVMKVSWRD.................. 246
457 1.000e-31UniRef50_UPI000CFB54B9 cobalt ECF transporter T component CbiQ n=1 Tax=Vallitalea sp. S15 TaxID=2078660 RepID=UPI000CFB54B9  ali  24  1.........MIIDNIAQESPLKGLHPVEKIIGCILTLTTLLVLKEIRSHLLAIVLLNMFLLFIAKINWKXXXXXXXXXXXXXXXXXXXXXXXXSGITVNITSASLNQGIFIFFRSFSCLLCMYSLVLTTPIQQVIWGLRKLKCPTIICEMMLIIYKYIFILAETSKKIYLSQHARLGYKGYKQSLRSFAALLSALFIKSLDYGRKLFTSLESRGYVGTLHTVATYPPVK..................... 223
458 1.000e-31UniRef50_A0A1F2PLF8 Cobalt transport protein CbiQ n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1F2PLF8_9FIRM  ali  26  2...........IDRFAHTNKLSNANPTVKVVVSLVMLLSVFFINQPLYMAGVFGVMVGCTLLWAKIPVRIYLHTLIFDSLFVIPGALALLFTISKGGIGITTTNLVLASLVFCRAMAGVSCMLFLIYTTPVMQIAGVMKKAHISNTFLEIFILTYRFIFDYWDKIKLMATAQELRFGYRNVRVALQSIAMMLSNLFLMAIQSYEEMTKTLELKQYQGDFHVSYRK......................... 228
459 1.000e-31UniRef50_A0A2E0MR38 Cobalt ECF transporter T component CbiQ n=26 Tax=root TaxID=1 RepID=A0A2E0MR38_PIMSR  ali  23  5........HGHLLHFHAHSAIHRAPAHLKVVALLVFMITVVATPDDWFAAFGAYLMVLVAVILSRVPATYILKRMVVEVPFVLFAVLLPFVARGPLGLSLSESXXXXXXXXXXXXXXXXXXXXTLAATTEPQALLKGLERLRLPTTLVQIMAFMIRYLSVVTEELRRMHVARVSRGFEARNPRHWPVLAKSFGALFIRSYERGERVHLAMLSRGYTGKMPL............................. 222
460 2.000e-31UniRef50_B0NJC5 Cobalt ABC transporter, permease protein CbiQ n=3 Tax=Lachnospiraceae TaxID=186803 RepID=B0NJC5_CLOSV  ali  20  49...........IDLLAGSSRLSEVPPLLKFLLAISLMACSICAGRXXXXXXXXXXXXXXXXXXXXXRVKTYLHMVAVPLSFLMISGLALLWSIGIGYLCVTKAAQVRTMLVMARALGAVSALYLLSLSTPMPEIIGVLRKMRCPDVMTELMYLIYRYIFVLFNIHDSMKNSAMSRLGYIDYPTGIRTTGRIYSNLLAYSYRQASRNFDAMESRCFDGSIRFLDPERKWQPAYVAGAIFLAVLEWLLCVM. 298
461 2.000e-31UniRef50_K5ABN5 Cobalt transporter n=10 Tax=Paenibacillus TaxID=44249 RepID=K5ABN5_PAEAL  ali  17  1.....MQAKMMLGRYVAADSWIHRLDPRAKLIAMVIYLVAVILAEQFVELAALTGFALLMMSSSRISLYRYFRASRPLWLIMAFMFIFYLLFVQVGGLKITTGGVTYGAYAVWRMALLVTLTAILTFTTAPVELNLGLERVGSPQRWSMMIGISLRFIPTIFEEAEKVMKAQASRGADLSFAQKGKLVMTLMVPVIVSAFRRAEELVQAMEARGYVLNAPRTSLRQLVWK.................... 243
462 2.000e-31UniRef50_A0A2D6UD10 Cobalt ECF transporter T component CbiQ n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A2D6UD10_9ACTN  ali  24  1MSSPAAFAHRHL-HVHGTSPIHRLAPEAKLLGLLGFVVTVAITPRQWIAFAIDATVLLGVLVAARLTPRVVLGRLAAILPFVAFAFLFPFITISILEISLSIDGLWASWNVLAKATLGGAASIAVTATTPIPELLTGLSRLRVPAAVVAIIGFMFRYLDLMVDEFGRMRRAMAARAHNPQWLWQSRPLASSAGALFVRTYERGERVHDAMAARGFTGTMPTLSEGRTT...................... 232
463 2.000e-31UniRef50_A0A202DTW3 Uncharacterized protein n=1 Tax=bacterium I07 TaxID=1932703 RepID=A0A202DTW3_9BACT  ali  16  1......MSDITLGQFVPGNSAIHRLDPRTKLITCLLFMICMMFVQRFSVMAVLLLMMITLYSISSIHLSIAINNLKPFLWLFLFTMILHGLFTDGAVLVITWDGIEQGAFYSVRICLFILLANLLTLTTSPMALTDALEKLLSPTEIALMLSIALRFIPILIEETDRIKKAQISRGAEFSGWIVIRVLIALIIPLFISTFRRANELAMAMDARCYHGAQKRTHYFKLQFKDIISFVITFLACITLLKW.. 262
464 2.000e-31UniRef50_A0A0U5MY37 Cobalt ABC transporter, permease protein n=38 Tax=Brucella TaxID=234 RepID=A0A0U5MY37_9RHIZ  ali  14  50......................................................AAAIVLVRVAKAPWHKLRHRLLHLEGFMIVLLVLLPFTMPGGPLVATVEGTVRALTVAIKVNICVLSIYALLGSLDPIRIGQAAESLGLSPKFVRLFLITVRYVSVFRAETGRLSEAMRVRGFRRSNMHTWRTFGNLAGTMVVRSIERAERVDEAMRCRGFSGTMPATPATAAQRRDAVFASLFFCAMFGLLLV.. 250
465 2.000e-31UniRef50_UPI00082C5817 cobalt ECF transporter T component CbiQ n=1 Tax=Clostridium sp. Marseille-P299 TaxID=1805477 RepID=UPI00082C5817  ali  20  2.....HNHMLHIDTIAQNSKLNNVNPGLKIGVGILSLILCVLSEAWVFHIMIAVIMMITVIRYSHLKINNYXXXXXXXXXXXXXXXXFLDIPFAGWYLSITVNSLSKTLIVIIRAYASITCLFMISLTTPMSDIIHVCRQIKIPEIIIELMYLIYRFIMILFDAHSKMTIAADSRLGYINLKNTYISMKGIAMNLLSLSFQKASVSFDAMESRGYIGKLNFYREDKPIHKKELILSIVYLILIGFVFLI. 257
466 2.000e-31UniRef50_A0A1G5ARA9 Cobalt/nickel transport system permease protein n=1 Tax=Alkaliphilus peptidifermentans DSM 18978 TaxID=1120976 RepID=A0A1G5ARA9_9  ali  29  89...........................................................................................SISSIKVSIPKDGLSIAGFLIIRALASTTCLYFLILSTPITEILYVLKKIKVPILLREIMFLMYRFIFLYIDTANKIYIAQKSRGGYSKLKASYYSISQLIIMLFLKSSYRGHMTYKALKARGYDGELKAIELEYQASRKNWVIIAVFEILLLTITL.. 245
467 2.000e-31UniRef50_A0A1G1PPS0 Cobalt ECF transporter T component CbiQ n=1 Tax=Omnitrophica WOR_2 bacterium RIFCSPLOWO2_02_FULL_45_28 TaxID=1801864 RepID=A0A1G1  ali  24  1..........................................................................MSIFIIFIKPGEPVWEFSLGIFKLSITNEGLAMFLNIAAKAYLCGLCMLLLMLSTNFLNLLKALEKLRVPSILIMIISFMYRYLFVLEDELMRMKRAKDSRTIAGSRWFHARALANMLGVLFVRAYERAEDVYLAMCARGFDGGIRTIYDYKLRIKDLCFLATAVSAVSIIKIYI. 175
468 2.000e-31UniRef50_A0A1V4V6A9 Energy-coupling factor transporter transmembrane protein EcfT n=16 Tax=Methanosarcinales TaxID=94695 RepID=A0A1V4V6A9_9EURY  ali  16  40...KFFQEALITESFAKKDGLLQSLDPRVKLLSILAIVFAISVTGDIRLLSAVYLLTLLFARLSQIGIFFFIKRXXPGDPLFHIMDLSPDAHLGPYSIYITEQGVSAAATFTLRVATAVSAVVLLFLSTPQQLLFKSLRSLRVPKVYVLTMAMAYRYIFLFMEMIRDLHIAKKSRTIRSSLREEQRWVGGRIGYMLIKSLDMSEKVHMAMVSRGYSGDVRILYDHHLQWRDY.................. 293
469 2.000e-31UniRef50_E6MI81 Cobalt ABC transporter, permease protein CbiQ n=14 Tax=Clostridiales TaxID=186802 RepID=E6MI81_9FIRM  ali  21  144..........................................................................................FFAHWGYVIITPQTLYNTAILWSKAFGAISAMYMMSLSTMSGEIFSVLKKCHVPKLIIELMNMMYRFIFILLDTNSKMRNSAESRLGYTDFRKALYSFGSTASNLFVVSMKRGNQFFDAMEARCYDGDLRFLEAKKPVTRAQWLWGALPLAYFVCVWIM. 302
470 2.000e-31UniRef50_C6C257 Cobalt ABC transporter, inner membrane subunit CbiQ n=5 Tax=Desulfovibrio TaxID=872 RepID=C6C257_DESAD  ali  18  8..............FAYGNSIIHSMHPGFRLACAFLFSLAGAXXXXXXXXXXXXXXXXXXXXAARLSLSNLLKRLLIVNFFILFLWIFLPFSFNIGPLTATLEGIIYTAIITLKSNGVILAMTALISTMEVQTLGAAMQSLKLPDKLCRLLLFSWRYVHVMSMEYNRMRRAAAMRAFPRTDFRTYRTYAWLMGMLLVRSMDRAHRVWQAMLCRGFDGTFHTLTTFSTGKRDIALLLATLGCITTFIFL.. 248
471 2.000e-31UniRef50_A0A0D6B4W4 Cobalt ABC transporter, permease protein CbiQ n=9 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A0D6B4W4_RHOSU  ali  21  61..................................................................PVGATLRRMAAMDGFIFLLVAMLPFTTPGWGFDASREGLVHAARILLTANAVVLALLSLVGTLEPVTMGQALHRLGAPDRLVHLLLFTIRYIEVLRSEYLRLRRAMKVRCFRPGSWHSYRSLGYLVGMMLVRAVERSERVLAAMKCRGFSGRMPVLSSLAYGRRDAVFGAGLGVLLLAMIL... 248
472 2.000e-31UniRef50_A0A1Y2MW82 Cobalt transport protein CbiQ n=1 Tax=Pseudonocardia autotrophica TaxID=2074 RepID=A0A1Y2MW82_PSEAH  ali  50  4...........IDETAYAGRWRSRHPGEKXXXXXXXXXXXXXXXXXXXXXXCXXXXXXXXXXXXRVPLRTVGRLLRLPLGXXXXXXXXXXXXXXXXXXXXAPGGPVRAAELVGRAMAAVGCLILFAATTPIADTLPRLRW--VPRAVTEIALLIYRMLFLLLDSLRAVREAQTLRMGFRTRRATFRSLAGQGGAVFVRAFDRARRLEAGLAARGYDGELMVRVTSRPVS..................... 220
473 3.000e-31UniRef50_C9R9R1 Cobalt ABC transporter, inner membrane subunit CbiQ n=1 Tax=Ammonifex degensii (strain DSM 10501 / KC4) TaxID=429009 RepID=C9R9R1_AMM  ali  22  36...............ARRPGLYQSLDPRTKVVATVAFIGVVGLVHHLTTLVLLNLLALAVALLSRLPLKLYLARVWLFIPLFTGAMTFPAIFNWIAPLAITVQGLQGAATIVLRAADSVSWVILLTLTTPWPQLLKALRVFRVPQLFVLILEMTLRYIFLLLQLSVETFEAYRFRLGPPPAREKRRFIASLIGNVLVRTQALSEEVYQAMQARGYTGEPRVLIPYRFGRADLVF................ 278
474 3.000e-31UniRef50_R7DRW9 Cobalt transport protein n=1 Tax=Coprobacillus sp. CAG:826 TaxID=1262857 RepID=R7DRW9_9FIRM  ali  17  1......MTKMTLGKYMPYNSPIHKLDPRVKILTLIFLMVPIFLSTSFILYGVMAIVIYIIMRMSHVRLSMIFKQLKALWVMMLFVSILNILFIKYGFIAIGNQGFIIALYIIIRLVLMVSLTTILTATTKPLDLTFALEWYLTPSEVAMTMTLALRFIPTFLEDTERIMKAQSSRGVHGKLMEKLRAMVSLIVPLLSSAIHRSDDLADALEARGYNPDHKRTHYRQMKW..................... 249
475 3.000e-31UniRef50_A0A2N5KHZ4 Cobalt ECF transporter T component CbiQ n=6 Tax=root TaxID=1 RepID=A0A2N5KHZ4_9CHLR  ali  24  93.......................................................................................VFTVPLGFVTLTATDAGLLRFFTIVWKSWVSVQVALILTATTHFFDILRALGALHLPKIMVALLSFMYRYLFVLADEAQQLLRARDCRSGGGSVWWRAKVTGQLVGTLFLRAFERSERIYVAMLARGYTGELRSLNARPLHPSDLRFGLGGALVLVLI..... 256
476 3.000e-31UniRef50_A0A285L9N6 Cobalt/nickel transport system permease protein n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A285L9N6_9NOCA  ali  24  7..............YLPGNSPAHRAPVVKIVCAVIAIFAVVATPREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAPFVVLAILLPFAAGFAGLSLSTTGLYAAWGIVAKGTLGVGISLTLAATTSVGQLPAGLARLRVPGVIVMIVVLMLRYVDVLVDEAARMRTARISRGDDPRTLRQAGATARGAGQLFLRSYERGERVHLAMLSRGFDGTTTYFGLQPATRTQWLFGLLPAATAICVCL... 245
477 3.000e-31UniRef50_A0A2N5Z9H2 Transporter n=1 Tax=bacterium BM706 TaxID=2053465 RepID=A0A2N5Z9H2_9BACT  ali  14  1.....MFDGIVLGQYIPGESFLHRLNPITKIVFCLFFMIVFLFIEDIFQXXXXXXXXXXXXXXXXXXXXHVLKGLKTIIFFLLITFVMHLFFFEYSFIVITSKGLYNAILIFLRIFSIIMLNSILTLTTMPTDIAWAIEKLLYPEDFALMLSLSLRFIPVLFEELNKIIDSQRSRGASPSFVKKIMAFPPILIPLFVNSFQRAEEIAIAMETRCYSGSKRTLNIIRPGLIDVLFFITFVSVALISFYLF. 263
478 4.000e-31UniRef50_A0A0C2FCP2 Cobalt transporter n=6 Tax=Streptosporangiales TaxID=85012 RepID=A0A0C2FCP2_9ACTN  ali  38  1........MLAIDAAAYASPWRRVHPAVKGVFFGGXXXXXXXXXXXXXXXXXXXXXXXXXXGPARVSPRAFARXXXXXXXXXXXXXXXXXXXXGGGAIAFDPDGPARAAEIIGRAAAAVCCQLLFALTTPLADLLPRLTRIGLPAALVETVALIYRMLFVTLDSAHRIQTAQAGRLGYSHRRAWVRSVGALGAALFVRSYDRAQRMQRGLECRGYTGELTVLVDELSLRPAAVSAAALPSVLVAAATV.. 242
479 4.000e-31UniRef50_A0A0F7GF48 NikQ energizing module of nickel ECF transporter n=23 Tax=root TaxID=1 RepID=A0A0F7GF48_9CHLR  ali  21  1......MRHSFLDKYSDLETPIHRLDPRTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLGYVLKRSFIILPFVLLLGLINVFTRPGWHLGVTDIGXXXXXXXXXXXXXXXXXXXXXSSTTPLPNLLKGIERLGAPKVLVMIMSFMYRYIFLLIDEVLRMKQARDSRSGKISNLAQAKTVGNMIGTLFIRSYERGERVYGSMVARGFDGHPRSLNELAFSRND................... 238
480 4.000e-31UniRef50_A0A2K2EXH8 Energy-coupling factor transporter transmembrane protein EcfT n=3 Tax=Firmicutes TaxID=1239 RepID=A0A2K2EXH8_9FIRM  ali  17  1.....MIKDITIGQYIPGESYLHKADPRTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYTLKGLKPVMFIIIFTALINLFSFQFGFLKITHEGVDMTIKMTLRLSLLIMTASLLTLTTGIEKLMNPFKRFGVPHEIAMMMTIALRFIPTLLEETDKIMKAQAARGADGNLIQRAKSFIPVLVPLFVSAFRRADELANAMEARCYRGEGRTRMKQLQLTGRDYGISAVTLIFSAAVLYL. 262
481 4.000e-31UniRef50_Q5M245 Energy-coupling factor transporter transmembrane protein EcfT n=1100 Tax=Bacteria TaxID=2 RepID=ECFT_STRT2  ali  17  1......MDKLIIGRYIVGDSFIHRLDPRSKLLAXXXXXXXXXXXXXXXXXXXXTLFTLFLVFLSKIKLGFFLGGIKPMIWIILFSTLFQVFFWSIGFFKITEVGLNQGWMIFLRFILIISFSTLLTLTTTPLSLSDAVESLLKPHEIGLMLSLSLRFVPTLMDDTTRIMNAQKARGVDGNIIQKVRSIIPILIPLFASSFKRADALAIAMEARGYRGEGRTKYRRLLWNCRDTLSIIAILALGLILFYL. 262
482 4.000e-31UniRef50_A0A0U4FAK5 Cobalt transport family protein n=3 Tax=Bacillales TaxID=1385 RepID=A0A0U4FAK5_9BACI  ali  14  1.....MSEAIILGQYIEKESILHRLDPRTKLVSMISIMVWFVMIQSVAEYVLATIFIFFLLFASNVSLRYYWKSLRPILFILLFTGVYNAFLWEWSVFHLTQEGIHQGIRFAWRIVLLIFMASILTFTTKPLMLTAGLERLLKPEQFSLMVTIAIRFIPTIVSEFDRIVLAQKARGIDHSFFQRVYLYIPMLIPLLFSLIQRAETLAEAIDSRVYGGKNRTSYRSFQLSAADYRGLTIVHLFVVTGVFW. 263
483 5.000e-31UniRef50_R5PB82 ABC-type cobalt transport system permease component CbiQ and related transporters n=1 Tax=Clostridium sp. CAG:127 TaxID=1262774 RepID  ali  17  1.....MMKDITWGQYHSVDSMIHRIDPRVKIRFTIIYIILLLLDRNLPLFLFLTTVFAGVWACSRVPMRKMIRGTKGVFIFILICSILNAFTMHGGVLTITKEGLIKAGFVFWRMLLLILMSSLLMYTTTPTRLTDGMEKMHLSGGVAMGITIALRFVPILFGELDRIMKAQMARGADGNPVVRLKKLRTVILPLFQNAISRAGHLGDAMDSRCYTGGRTKLHPLVYERRDVVAYVCMLAMVIASVVLI. 256
484 5.000e-31UniRef50_A0A086Z152 Fused ATP-binding protein and permease of ABC transporter n=2 Tax=Bifidobacterium actinocoloniiforme TaxID=638619 RepID=A0A086Z15  ali  20  635...................SLVARLDPRAKIVTFLLAMLTAFFISTPLQLLLGLCATAALFAAARAPMRSILRSVRAFLVLMVFLAVLNLLVTRWGPLVVTIGGIWVAVLYSCRFTLIVLLGALLVQTTTPTQMTDAFASLFKPDEIAMVLSLALRFIPTLDQEMRSIIESQAARGGSGGPSMRLHATMAITIPVFAGALRHADNLSRALDARCYEGGRGRTHYRLLS...................... 861
485 5.000e-31UniRef50_A0A0E3W3Q3 ABC/ECF transporter, transmembrane component n=1 Tax=Syntrophomonas zehnderi OL-4 TaxID=690567 RepID=A0A0E3W3Q3_9FIRM  ali  22  1........MNGIDQLAHCSPLKYIHPGEKLLMTISTLLMVISLNSVILSGLVLFFMTYLLLVKGRVRXXXXXXXXXXXXXXXXPAAYLYYLEFGTIRLGVTPLSLSQSGMVMVKSLAAISCLYFLALTTPMTQLIYIFRKMKLPPVFIDLMTVIYSYIFLLFQTASEIYVAQLSRGGYRGFRGTMKSLAMLCSNLLLKSLKASEDAYNCLASRGFDGHFEVIEETYQLKK.................... 235
486 5.000e-31UniRef50_K6D866 Cobalt ABC transporter inner membrane protein CbiQ n=2 Tax=Bacillus azotoformans TaxID=1454 RepID=K6D866_BACAZ  ali  19  2........NIQIDTLSYNSRFRKVPPIYKIIFTIL-LCVMVFLSHIPVQITIFLGVFVFLCCYEKIPVGVLLKXXXXXXXXXXXXIWLSIIKIDNWQIYISESGLGLAKAIIFRSLSLLICVFALVMTTPFNEILHALHKMRTPQVLLDILVGMYRFIFIFLRYAGELYMVFQSRGGNVTWERTFHSVGLVIVQLFVKTFEKYKRMLLVMESRGFHDQLYYADEQRKSAPKKFTGGALFILFILI..... 254
487 5.000e-31UniRef50_A0A2P4TKP6 Cobalt ECF transporter T component CbiQ n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A2P4TKP6_9PSED  ali  21  26..QQALEHSLDAEAISRQRGLLQGLDPRIKLLALLSLMISGILASQLSTLLLLFCFAVLLALLSQVSLRRLYRXXXXXXXXXXXXXXXILFRLPLLHWGISLQGLRSAAFLLGRAETSASYALLLMLTTPWMHVLKAMRSLGVPVLLVALLGMTHRYIFVLLQTASQMFEARRSRLAPPSGRLARQVVAASSGVLLSKAFQLSSEVHLAMVSRGYRGDIYLLHTFHTRRRDWCALLPALCVPLLILW... 280
488 5.000e-31UniRef50_D5XAB6 Cobalt transport protein n=2 Tax=Thermincola TaxID=278993 RepID=D5XAB6_THEPJ  ali  13  1.....MIDSLAFGRFVPGNSFLHRLDPRTKIFASFVLITTIMLINKMQXXXXXXXXXXXXXXXXXXXXKAFLNSVKLVLFLIIFTIIAHFLFTPWGFLQVSREGFNQGITMSLKLFYIVSVTSLVTLTTSPMALTDGLKRMGLPDELALMMVIALRFIPTIWEETDKIKKAQMSRGAQGNIITRIGHMTALMVPILVSAFRRADELALAMESRAYRVGIPRTRMKIMKFSPWDYLVMVLLTAVLIVVV.. 260
489 6.000e-31UniRef50_Q0W113 Putative ABC-type cobalt import system, permease component n=15 Tax=root TaxID=1 RepID=Q0W113_METAR  ali  14  42.........LTSENYSRRNGLLQSLDPRVKLASILALVVAVTMIKDLYLLIFVYALTLLFAGLSKISIGFFVKRXXXXXXXXXXXLLVPLVTFGPNTFGITTQGLLTAVTFTIRVATCVSAIVLLFLSTPQEALFKAFRALGVPKVYVLTLDMCYRYIFMFIDIIRDMFIAKKSRTIRSGTFAEQKWVTGRIGYTLIKTLDMSDKVHKAMVSRGFNGDIKIMQKYTMKMRDYIALVTVFGFSIFLIML.. 305
490 6.000e-31UniRef50_A0A2C6MCG0 Transporter n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6MCG0_9FIRM  ali  20  2....SLFYNITIGQYYPGDSLLHRMDPRAKILAMPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGMKLLWVVLLISPVLQSLTWQWGMIHVSREGFTLGMQLFYRLSLLILSVMIVTMTTTPVNLTAAMERLLQPHELAMMMTIALRFVPSLLEEAEAIMKAQQARGGSGSFNRRLQASVALLVPLLAGSLRRADELAVAMEARCYRGDRTQLKQFKYRLPDIIVLGVLLTSAIAVAA... 263
491 7.000e-31UniRef50_I4CF37 Cobalt ABC transporter, permease protein CbiQ n=2 Tax=Desulfomonile tiedjei TaxID=2358 RepID=I4CF37_DESTA  ali  24  11...............SRENTLTRVDPRIKLILALLLIFCTVLSQMVWFPLVVFTC-CLITMTLIRIPPGLVLLRLSGPLGIVTVLVLLQMFLIGSWTFIASQEGLARGILLGSRVLAAVSTVILLGSVTPAHKIFAALRWFKIPEGWVEIAMLVYRYTFSLLDQTSDVLTAQRARLGYSSIKTSLGSVGVVAGTVLIRAMDQAMRTYEAMTLRGYQGSMPFGPLPVLEQKDVRILTVAVPVILMAFLFV. 253
492 7.000e-31UniRef50_UPI000648F912 energy-coupling factor transporter transmembrane protein EcfT n=1 Tax=Firmicutes bacterium ZOR0006 TaxID=1339252 RepID=UPI0006  ali  15  3.........IAIGNYIETESFIHRLNPIVKLTIFFVWMITLFMIKNLAIYGIILVGILSLIQLTRLPARLIVSSAWSLKWLLLIMIVFNLFFWEFGVVQVYDQGIYQVLLLTVRLVSVVMLATMLTLTTKPLDLTLALEKLLSPADIALMVSIAIRFIPTLIDETDKIMKAQASRGANGPIIQRIKHLVSMLIPMFVISFKRAENLAVAMEARGYTDAQSRTRLTKLSW..................... 239
493 7.000e-31UniRef50_A0A2I0QHN1 Cobalt ECF transporter T component CbiQ (Fragment) n=4 Tax=root TaxID=1 RepID=A0A2I0QHN1_9EURY  ali  19  7...........................................................................................SYGNLNFAVTYSGLLILFNVLVKSWLSVISMLTLTSTTKFSDLLKAFEWLKFPKVMLLVISFMYRYIFVIADEAMRLKTAGDARNFGNKLKQRIEIFGNIIAVLFIRSYERAERVYAAMLSRGFDGNFKTIKEFKFSNADFGFATIMGLILISIFVI.. 164
494 7.000e-31UniRef50_A0A2E0V0J7 Cobalt ECF transporter T component CbiQ n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0V0J7_9CHLR  ali  21  75................................................................GIGIKKLLKRSLWVLPFVIAVFPLLFITLLGFSFTASWEGLERLLSIVLKAWFSIQAAIILVSTTKFEGILKGLRWMKIPKLLVAVIGLMWRYLFVLVAEAKRLLVARSSRSSDGSMIWRAQVTGYMAGNLLLRSIERSDRVYMAMLSRGYDGEVRMDNDRVLSRK.................... 256
495 7.000e-31UniRef50_A0A084JA18 Cobalt ABC transporter permease (Fragment) n=1 Tax=[Clostridium] celerecrescens TaxID=29354 RepID=A0A084JA18_9FIRM  ali  25  10.........................................................................................LISVHGVYLYLTEGGPALALGLILKALAALSAMYMLVLSTPASEIICVFRKLHVPKIILELMNMIYRFIFLMMDTQCYMKQAAESRLGYCDFKTSCRSFGSTAGNLFVVSLKKANTYYDALTARCYDGELLFLEEEKKVKGWQLWTAACYFMVLIWVRLV. 169