FFAS03 results for PF01402

Query: PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.

						`. 10 . 20 . 30 . 40`
#	Score	Template	Links and tools	%id	First	`LISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYK`	Last
1	-20.500	`[K] COG0864 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain`	`ali follow..`	38	8	`.IGVSLPKNLLDEFDRIISTRGYSSRSEAIRDAIRTYITE`	46
2	-14.300	`[K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain`	`ali follow..`	30	28	`.MTVDLGDELREFIESLIESGDYRTQSEVIRESLRLLREK`	66
3	-8.990	`[K] COG3905 Predicted transcriptional regulator`	`ali follow..`	25	44	`AFTVRLPDEVAEKLDQLAEKLD-RSRSYMAVQAIEDFVAR`	82
4	-8.270	`[R] COG4710 Predicted DNA-binding protein with an HTH domain`	`ali follow..`	12	25	`ATSIRLSPEMEQRLNYLASHTG-RTKAYYLREIIEHGIEE`	63
5	-6.200	`[S] COG4423 Uncharacterized protein conserved in bacteria`	`ali follow..`	17	1	`.MALNIKDPEVDRLAAELADRLHTSKTAAIRHALSAQLAF`	39
6	-4.340	`[S] COG5304 Uncharacterized protein conserved in bacteria`	`ali follow..`	13	98	`.ITLRLSSELLTAVKNTASAQGMNYQK-YIREVLEQSVLR`	135
7	-4.270	`[S] KOG4506 Uncharacterized conserved protein`	`ali follow..`	10	465	`ITTISIPLLLVHDMSEEMTIPWCLRRAELVFKCVKGFMME`	504
8	-4.250	`[S] COG3514 Uncharacterized protein conserved in bacteria`	`ali follow..`	20	74	`.TAIRLDADLLEAFKA--TGKGWQTR---VNAALRQFIAE`	107
9	-4.190	`[S] COG4877 Uncharacterized protein conserved in bacteria`	`ali follow..`	13	6	`.VPLRLDPAVYDAIAKWAADEA-RSTNAQIEMMLREQLRK`	43
10	-3.770	`[KNU] COG2747 Negative regulator of flagellin synthesis (anti-sigma28 factor)`	`ali follow..`	20	57	`....DINMERVEALKTAIRNGELKMDTGKIADSL......`	86

FFAS is supported by the NIH grant R01-GM087218-01

jobs submitted since Jan 1, 2011

Comments and questions to: webmaster