current user: public

If you have questions about the server, please let us know.

Query: PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst SPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESRHDFQVRVKVGLast
1 -46.700[S] KOG4646 Uncharacterized conserved protein, contains ARM repeats  ali follow..  15  4KPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPETPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPR................................................................ 196
2 -40.700[U] KOG4224 Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting  ali follow..  15  156LDENKSKIAHSGALGPLTRLA-KSKDIRVQRNATGALLNMTHSYENRQQLVSAGTIPVLVSLLPSSDTDVQYYCTTSISNIAVDAVHRKRQSEPKLVRSLIQLMDTSSPKVQCQAALALRNLASDERYQIEISNALPSLLRLLRSSYLPLILASVACIRNISIHPLNESPIIDAGFLRPLVDLLSCTENEEIQCHAVSTLRNLAAS-SERNKRAIIEANAIQKLRCLILDAPVSVQSLIPLTDSMSIEVQGNSA 438
3 -36.300[U] KOG0166 Karyopherin (importin) alpha  ali follow..  16  200STMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVCSALQSLLHLLSSPKESIKKEACWTISNITANRAQIQTVIDANIFPALISILQTAEFR-TRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDYGLDKIEFLQSHENQEIYQKA. 496
4 -34.600[U] COG5064 Karyopherin (importin) alpha  ali follow..  16  193SSACRDYVLGNGVLQPLLNILQSSADVSMLRNATWTLSNLCRGKNPPNWSTISVAVPILAKLLYSEDVEIIVDACWAISYLSDGPNEKGAILDVGCAPRLVELLSSPSVNIQTPALRSVGNIVTGTDAQTQICGALNAFPSLLSHQKENIRKEACWTISNITANTQQIQAIIESNLIPPLVHLLSYA-DYKTKKEACWAISNATSGGLGQPIRYLVSQGVIKPLCDMLNGSDNGMDMIHDLQSSGNNDIYLKAY 493
5 -31.000[S] COG5369 Uncharacterized conserved protein  ali follow..  12  361NEIMQKTAVNAGFIDAAKYLLEYATDELQSSAACECLLSLSRSVYIRTGLADADVSEPLIKLLSDPDTRVKSTATSAICNLVLKSPLREKFLTTNFIDTLISNISTKDSSLRKKTVWVLRHVVFGDDETIQLKIGASKLVELCNDEDLGVQEQMLQVLRNFTCQEESVDFLLKMVPMELLAKILLESKNPILIEPSIYILVHIAASDGELRDSILRQTKLLLLVKEIMLQEAQRLKPYEEDTYEPNSEILLAGI 668
6 -31.000[R] KOG1293 Proteins containing armadillo/beta-catenin-like repeat  ali follow..  12  361NEIMQKTAVNAGFIDAAKYLLEYATDELQSSAACECLLSLSRSVYIRTGLADADVSEPLIKLLSDPDTRVKSTATSAICNLVLKSPLREKFLTTNFIDTLISNISTKDSSLRKKTVWVLRHVVFGDDETIQLKIGASKLVELCNDEDLGVQEQMLQVLRNFTCQEESVDFLLKMVPMELLAKILLESKNPILIEPSIYILVHIAASDGELRDSILRQTKLLLLVKEIMLQEAQRLKPYEEDTYEPNSEILLAGI 668
7 -30.400[T] KOG4500 Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar  ali follow..  12  213TENVSDLNFDSSLNIQLSRILAASTNPDLAEMCLELLHYQAESDEVKLILAKDGLCETIYNLLEKYKTLLMKLACELIVLILTGDDSMHYLYTTPLLKNMVDWLDSTDIDLLTTGVLALGNFARTDSHCIYFVQTMNKLLEVLAKDDVRLQHALLSALRNLVIPKPNKNAVIQAGLVQTILPMLEI-HQPPVVFKLLGTLRMTVDGQEKLALELLKNKTLIEQLVHWSKSSD-------------YAGVTGESL 467
8 -26.900[U] KOG0946 ER-Golgi vesicle-tethering protein p115  ali follow..  16  10GQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLS---KKYRLEVGIQAMEHLIHVLQTDDSEIIGYALDILYNIISNEEEEEVIKQQENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQ-PMGVSRLMDLLADSREVIRNDGVLLLQALTRNGAIQKIVAFENAFERLLDIISEEDGGIVVEDCLILLQNLLKN-NNSNQNFFKEGSYIQRMKPWFEVGDE..................... 268
9 -26.500[TW] KOG1048 Neural adherens junction protein Plakophilin and related Armadillo repeat proteins  ali follow..  15  384KSEARKRVNQLRGILKLLQLL-KVQNEDVQRAVCGALRNLVEDNDNKLEVAELNGVPRLLQVLKQTDLETKKQITDHTVNLRSRNGWPGAVAHACTLGGQGGRITRSGVRDQPDQHGLLWNLSSNDKLKNLMIGLIDSLVHYVRGTDDKATENCVCILHNLSSNPKGVEWLWHSIVIRMYLSLIAKSVRNYTQEASLGALQNLTAGPTSVAQTVVQKESGLQHTRKMLHVGDPSVKKLRNLSRNLSLQIAKETL 771
10 -26.000[O] KOG4413 26S proteasome regulatory complex, subunit PSMD5  ali follow..  12  22NETSVKEFLDRFPLPVIFNALQTDPDPGFENTLVTCLERLFKTKYGASLIPQY--MPVLQVGLKADSAVVKSLACKTVLCLLEDCDTNQLVVNNGIYPLLLDYIINSDDEVANAASETIKSLARFPDAMSVITNDPTHLRNLAARCSSLARVRVLSLIVKLFSSRLVASEVKKSGLLDLLEAEMKGTKDTLVILNVLELYYELME--VEHSSEFVPQTSLIQLLCSIISGTST..................... 261
11 -24.200[S] KOG2734 Uncharacterized conserved protein  ali follow..  13  93NEEADGDVLDEQSLKKLILVFEKMDSEVELHTVIQELKGVATVPDLYPILVDLHGLHSLLELLAHQNTDIAVAVVDLLQEVTDVDILGESCALLVQNLERLNEQVKEEADGVHNTLAIVENLTEIDSEFVKEQGLLAWLLKRLRGKSDPNKLYCSEILSILIQENENRLLLGSLDGVDVLLQQLASNEEQEYMQNLFNCLCSALM--ARENRDRFLSGEGLQLMNLMLREKKMSRNGSLKVLDH.......... 383
12 -23.900[S] KOG2973 Uncharacterized conserved protein  ali follow..  10  2...............AIFGLT-FDANQTVAKDAVLSLINLTSEEEAAIKVFQLAIVEVAAKEITNEQSDLADPWSMVLSNLTRVESLVHEILDTLEAKAFAQLDYNKKKAKLHYLAPIFCNLTQVSRGRELCCHRLEKLLPFASFEGSVVRRGTIGILKNVCFDTVYHDVILQSSILVAILQPLTREEDPDLRKMLLECLLQLCS--TRRSREILRSRGVYEILREYHKWEALACENVVDILIKKEEEIGLD.. 293
13 -21.000[ODR] KOG4151 Myosin assembly protein/sexual cycle protein and related proteins  ali follow..  11  560DADVKEWIVDDSLLLKALVLLAKKAGALCVYTLATIYANLSNAFEKPKALVEEGAVPACVAVSKTESKNALELIARSLLAFAEYEDLRGRIIAEGGTVLCLRLTKEASGEGKIKAGHAIAKLGAKADPMISFPGVVKPLCDLLHPDVEGKANDSLLTLTNLASSDSIRGRILKEKAIPKIEEFWFMTDHEHLRAAAAELLLNLLFFEKEEERLSRASAAGFAILTEIMDEIKSWPEVFKDIAMHEDAETQRRGL 883
14 -18.200[R] KOG0567 HEAT repeat-containing protein  ali follow..  1.......MVSQQQIEAIGGVLNNKEPLKERFRALFTLKN----------IGGGAAIEAISKAFDDDSALLKHELAYCLGQMQDA--------QALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPD--------VLPILEEYKQDPVVEVAETCAIALDRVRWLQSGQKPTAGDKSVTELKAIYLDAQQSFDRYRAMFSLRNLRTEESVLAIA-LQEPCSIPFLQENLEDRLECIQILNRYAEDDKRVVKESCV 275
15 -16.700[O] KOG2160 Armadillo/beta-catenin-like repeat-containing protein  ali follow..  12  137.........DGELIVQLIDQFRNESEMRSKLDCLENLEYLLHQIDNALMFIDNGGLDDVLIVVNDTSTSLRVSAMRVLGSLASNNPQIKVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRKFPQRVLSTSGTQALIKVLQSPELRSKAKVVTLISDLVLEKDFESWLKTPGYCAAVDTVLTKEEQPEVVEQFATALETTEDMCTSTWSQSSGLRHALLTVRNRYANSTEVSQILAKLCKPKHTEL..... 429
16 -16.500[A] COG5181 U2 snRNP spliceosome subunit  ali follow..  12  529.............LPFLKAVCRSKKSWQARHTGVRIIQQIALLLGCSILPHLKNLVDCIGHGLEDEQQKVRIMTALSLSALAEAATPYGIEAFDSVLKPLWSGVQRHRGKSLAAFLKATGFIIPPEYASHFTRRIMKILLREFNSPDEEMKKIVLKVVSQCASTDGVTPEYLRTDVLPEFFHCFW-SRRMASDRRSYKQVVETTVVLAQQVGS------------------RQIVERVVNNFKDESEPYRKMTA 753
17 -15.300[C] COG1413 FOG: HEAT repeat  ali follow..  15  181........LSPGDMELCVQGL-EDEKPEVRIAAAQLLGW----------LGDEQAVDALLRKLADKNPRVREAAVEALGRVGDEN----------IVAELIGCLEDKNKGLRLQAVRALSRLGDER--------AVDPLVKKLEDKAPEVQAAAAEALGNLK----------SQDSMDVLLKKLEESAPTEFQVQVLTALGKIG------------DEKALAAILSRLDSPYPDIRKLVKKLADISPEVRNASV 396
18 -14.100[S] KOG1949 Uncharacterized conserved protein  ali follow..  123.............YKPILWRGLKARNSEVRSNAALLFVEAFPIRDPNLHAIEMD-FEELYSLLEDPYPMVRSTGILGVCKITSK---PTILIDLLKKVTGELAFDTSSADVRCSVFKCLPMILDNKLSHPLLEQLLPALRYSLHDNSEKVRVAFVDMLLKIKAVRAA--KFWKICPMEHILVRL-ETDSRPVSRRLVSLIFN.................................................... 316
19 -12.400[U] COG5215 Karyopherin (importin) beta  ali follow..  14  98..............TNALTAL-VSIEPRIANAAAQLIAAIADIELPHGAWPEL--MKIMVDNTGAEQPNVKRASLLALGYMCESQALVSSSNNILIAIVQGAQSTETSKAVRLAALNALADSLINMEREGERNYLMQVVCEATQAEDIEVQAAAFGCLCKIMSLYYTFMKPYMEQALYALTIATMKSPNDKVASMTVEFWSTICE................................................. 295
20 -12.300[O] KOG2062 26S proteasome regulatory complex, subunit RPN2/PSMD1  ali follow..  437.........GRGVTEYLREQLKHTEDEIVQYGLLLGIGLTGMASRDETL------YESVKTILFNDNAVAGSAAGISMGLIMLGTASSAAIDE-----MLQYAHETQHEKIIRGLGIGIALIVYGRQ------QEADGIIKELNNDLDPTLRYAGMFATALAYCGTS-----NSKIVRDVLHISVSDVNDDVRRAAVCALGFICFK-----------------------DPNALISTVELLVDSYNPHVRYGSA 636
21 -12.300[O] COG5116 26S proteasome regulatory complex component  ali follow..  437.........GRGVTEYLREQLKHTEDEIVQYGLLLGIGLTGMASRDETL------YESVKTILFNDNAVAGSAAGISMGLIMLGTASSAAIDE-----MLQYAHETQHEKIIRGLGIGIALIVYGRQ------QEADGIIKELNNDLDPTLRYAGMFATALAYCGTS-----NSKIVRDVLHISVSDVNDDVRRAAVCALGFICFK-----------------------DPNALISTVELLVDSYNPHVRYGSA 636
22 -12.300[R] COG5209 Uncharacterized protein involved in cell differentiation/sexual development  ali follow..  12  12..............ALVYEWIIQLVSGTSREQALVELSRKREQYEDLALILSYGVMTALLQ-LTGPTSNRVCNALALLQCIASHPETRIHFLNAHITLFLYPFLNTLSKSLRLTSLGVIGALVKNDSPEVI-TEIIPLCLRIMENGSELSKTVAIFIVQKFLCDDVGLQYICQASVLNNMVMQLVDSFAFRLLKHVIRCYLRLSDNPRAREALRLPEPLRDATFAQVLKDDHNTKKCLAQLLINLSDV...... 278
23 -12.200[U] COG5096 Vesicle coat complex, various subunits  ali follow..  15  277............AASRLLALADREADNNAKLIMLDRISQLA--ARDKSILEDL--ITDVIPFLSSSDFDVCEKAISIIMGLVSSRNVEDILNHFQKELTKSNGETEKDDGRRRALTKAIHSCAI--NFPHTAATAIQYLLSHISDFQSKSASSVLSFIKEVMEKFPD----LRSSNITKLLLSLKELRAGKIFRGVIWIAGEYCLTEDD............................................. 463
24 -12.100[R] KOG3036 Protein involved in cell differentiation/sexual development  ali follow..  11  35.............LASAEQLVLDLSNPELRENALLELSKKRELFQDLAPLLSFGTIAALLQ-LTPAQSNRVCNSLALLQCVASHSDTRMLFLKAHIPLYLYPFLNTTSKSLRLTSLGVIGALVKVDDTEVI-TEIIPLCLRTMEMGSELSKTVATFIVQKILLDDVGMDYICTGRVLGNMVQSLVEQPSPRLLKHIIRCYLRLSDNPRACAALALPDSLRDGSFSNCLREDPTARRWLQQLVHNVGVG...... 302
25 -11.900[YU] KOG2023 Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily)  ali follow..  6.........DQHELEQVIQLLQHSTDRDVQRNVQVQLVQLNEHQKFCCYL-----VYILSDMKEMIDATSRSLAGLLLKNNKYPQDVKFFVRTT-----CLKSIGDQEPLIRATVGIIVTTIVMEENMCD---DLLDTLATVLMQPDELMQEGALGALQKVFEDSADRYESEFLRPIMPKLLVFYEHHAAKMRALAMNCVNCILMVNNDPIDFAI----------------DQFLTSLFARHNDNDEEVQKQL. 230
26 -11.500[U] COG5240 Vesicle coat complex COPI, gamma subunit  ali follow..  280..KSKGDMVNLEVARNMVRLFLSSHRSATRFSAIRTLNELAMTRPHL-----HSCNLNIESLITDVNRSIATYAITTLLKTGNDESVDRLMKQ------IVTFMSDISDNFKIIVVDAIRSLCL--KFPRKQDSMLTFLSNILCEGGYEFKRAAVDAISDMIKYIPE----SKERALAELCEFIEDCEYPKIAVRILSILGEEGPKASEPTRF-------IRYIYNRIMLENAIVRSLTRCLEDADDEVRDRA. 550
27 -11.500[BD] COG5098 Chromosome condensation complex Condensin, subunit D2  ali follow..  16  978.............LPLLITVMEKSPDPTIRSNAVLGLGDMAVCFNN---LVDE--TDYLYRRLHDENLMVQRTCLMTVTFLILAG----QVKVKGQLGEMAKCLDNPDQGISDMCRLFFTELASKDN---AIYNGFIDIFSNLSS-GKESFKKIIKFLLTFIDKERHQKQLNE-----KLVGRLRKCETQKQWDDIAFVLNNLPYKNEDVTALL........................................ 1165
28 -11.400[BD] COG5218 Chromosome condensation complex Condensin, subunit G  ali follow..  82.............LKHILRGL-DAKDKTVRYRCCQIIARVVNCVKEIDDDLYNTLKEKLLSRVLDRESIVRLEAVVALSRLQEDTGDEE---NDVRNILLFLLQNDPSSEVRRSVLLNIE----------VSNSTLPFILERARDVDAANRKCVYARVLPKIGDFRY----LSIKKRVRILKWGLNDRDESVEKAAADMLAY.................................................... 252
29 -11.300[U] KOG1058 Vesicle coat complex COPI, beta subunit  ali follow..  12  282............AASAYIDLIVKESDNNVKLIVLDRLVALRGSSSNEKILQGL--VMDILRVLSSPGLEVRKKTLSLALDLVSSRNVEDMVMFLKKEINKTAESNDENGKYRQELVKTLHAATI--KFPDVASTIVPVLMEFLSDTNEKASSYVLQFVREAVHKLPN----LKNAILGALREGIPFIQSPTIFMSALWILATYCEADGA............................................. 471
30 -11.300[U] KOG1078 Vesicle coat complex COPI, gamma subunit  ali follow..  276............AITVLQLFL-SSPRPVLRFAAVRTLNKVAMTHPMAVTNCNI----DMESLISDQNRSIATLAITTLLKTGNESSVERLMKQ------ITNFMSDIADEFKIVVVDAIRSLCV--KFPLKYRSLMTFLSNILREGGFEYKRAIVDSIVTIIRDIPD----AKESGLLHLCEFIEDCEFTYLSTQILHFLGIEGPNTSDPSKYITVRAAAVSTLAKFGFMVESLKPRITVLIYDSDDEVRDRA. 516
31 -10.600[I] KOG0301 Phospholipase A2-activating protein (contains WD40 repeats)  ali follow..  10  611NEKQDAFQLNPDQINGLEELFVLPTSSNYSSEVLDFLRIALTHHSLNSYFCDRERGQELVGRLDPADVALKVLVCRCIANAFSHPVGRNLFASTELSTLAPLVVLNEKTVLQMSAATALANWSLQCEQLGPKEDLLRAILNGIES-GEDAIIRLLQALVTVMWGDASVIRLAKNRNIAQIAARLKDAVSNDSGKNIARDIVEMTYAV............................................... 858
32 -10.600[YU] KOG1241 Karyopherin (importin) beta 1  ali follow..  10  1........MTSDIAMQLIAILEKSPDKNELLSAKNFLEQAAASNLPE--------LKALSEILVNTSAVARMAAGLQLKNHQFPSEIRELIKNN------ILAALGTENTRPSCAAQCVAYVAVIELPINRWPMLIQTLVNKVVSEGSSHRESALEAIGYICQDFGVMENQSNDVLTAIIHGMRKVEPSNHVRLAATTALHNSLEFTKSNFEKDMERNFIMEVVCEATQCQDSQICVTLAAMKSDNDAVALQG. 285
33 -10.500[C] COG5231 Vacuolar H+-ATPase V1 sector, subunit H  ali follow..  12  77.............LIPLIHLLSTSDNEDCKKSVQNLIAELLSSDKYGDDTVKF--EQLFDVSLKGDFQTVLISGFNVVSLLVQNGLHNVKLVEKLLKNLINILQNIEQMDTCYVCIRLLQELAVIPEYRDVIKKFMPTLFKILQHLGIQLQYHSLLLIWLLTFNPVFANELVQKSDFLDLLKLVKITIKEKVSRLCISIILQCCSTRVKQHKKVIKQLLLLGNALPTVQSDEELRQDISNLKEILENEYQELTS 355
34 -10.000[S] KOG1566 Conserved protein Mo25  ali follow..  121..............PEILFTLMAGYEDAHPEIALNSLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIASDAFSTFKELLTRHKLLCA--DKFFSQHYQRLLNSENYVTRRQSLKLLGELLLDRHNFTVMTENLKLMMNMLKEKSRNIQFEAFHVFKVFVANPNKPKPILD---------ILLRNQTK-----LVDFLTNFHTDRSEDEQFNDEKAYLIKQIKEL........................... 333
35 -9.820[U] KOG1061 Vesicle coat complex AP-1/AP-2/AP-4, beta subunit  ali follow..  13  96..EDPNPLIRALAVRTMLRKCLKDEDPYVRKTAAVCVAKL--HDINAQMVEDQGFLDSLRDLIADSNPMVVANAVAALSEISESHPNSNLLD----INKLLTALNECTEWGQIFILDCLSNYNPKDD--REAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSD-MLLKKLAPPLVTLLSG-EPEVQYVALRNINLIVQKRPEYNDPIYVKLEKLDIMIRLASQANQVLAELKEYATEVDVDFVRKAV 374
36 -9.540[U] KOG1077 Vesicle coat complex AP-2, alpha subunit  ali follow..  322............ACNQLGQFL-SNRETNLRYLALESMCHLATSEFSHEEVKKHQEV-VILSMKMEKDVSVRQMAVDLLYAMCDRGNAEEIVQE------MLNYLETADYSIREEMVLKVAILA--EKYATDYTWYVDVILNLIRIAGDYVSEEVWYRVIQIVINREE----VQGYAAKTVFEALQAPACHENMVKVGGILGEFGNLIAGDSRSAMTRALLLSTYIKFINLFPEIRTNIQDVLRSADAELQQRA. 572
37 -9.290[U] KOG1062 Vesicle coat complex AP-1, gamma subunit  ali follow..  13  99.........RQEVLMLVTNSLKNHSNQYVVGLALCALGNICSAEMARDLAPE------VERLIQFRDPNIRKKAALCSTRIIRKVPDLAE------VNAAASLLKEKHHGVLITGVQLCYELCTINDEALELHIRLLRLLRVLGQGDADASDLMTDILAQVATKTESNKNAGNAVLYECVETIMAIEDTNSLRVLAINILGRFLSNRDNNIRYV-----ALNMLMKAITFDDQAVQRILECVKDPDASIRKRA. 369
38 -9.270[D] COG5657 CAS/CSE protein involved in chromosome segregation  ali follow..  10  1.............MDDIPTLLARTLNPTTSKSAEEALKVWEL--------QDSSFALKLLNIVAEDTINIKLAASLYFKNYRISDEVAELIKRE-----IINLMLKSTTIIQVQLGEVIGYIANFD-------TLLPDLISKLSAVDMNTNIAVLSTAHAIF--KRWRPLFRSDALFLEIKYVL-----DRFCEPFLALFVQTNNLLRNGPQDAESLNSLFQVILLECK......................... 210
39 -9.240[S] KOG2149 Uncharacterized conserved protein  ali follow..  13  33.....................NNATNTEIKSKAIILHEQSVAAERDGFATSKKGTLLELKNRTGHPNAKVRKDALHGIKDLLKHHPAELLSNKYATTHKLRELITDDDKLVRDDFYTLLTGIFLACKEDINKGLMVSSLMPYIFTASIEVRLMAFKFFRLVLEFYSPTFSLYAEKILENYKDVIHNNHFY................................................................ 206

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.