current user: public

If you have questions about the server, please let us know.

Query: PF07837.12; R6RB74_9CLOT/5-181; Formiminotransferase domain, N-terminal subdomain, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst LIECVPNYSEGRDLEKIEKIVECFRAKKGVRLLDYQTDPNHNRLVVTVIGEPEPLRDAVVASFGRAVELIDMTKHEGQHPRMGAVDVVPFIPCRNATLEEADALAKEVAKTVGEQYGIPCFLYESSATAPHRANLASIRKGQFEGMAEKMQDTEKWAPDFGPAAPHPTAGVSAVGARLast
1 -89.500[E] COG3643 Glutamate formiminotransferase  ali follow..  50  4IVECIPNFSEGQNQAVIDGLVATAKSIPGVTLLDYSSDASHNRSVFTLVGDDQSIQEAAFQLVKYASENIDMTKHHGEHPRMGATDVCPFVPIKDITTQECVEISKQVAERINRELGIPIFLYEDSATRPERQNLAKVRKGQFEGMPEKLLEED-WAPDYGDRKIHPTAGVTAVGAR 179
2 -6.480[S] COG2250 Uncharacterized conserved protein related to C-terminal domain of eukaryotic chaperone, SACSIN  ali follow..  11  16LKTAEILIKVKRYYASVFFSQQAAEKALKALYIEIKREFPPKTHSLLRL---SSELGIRDEEIIDAVLDLNPEYVVTRYP--DAANEVPAKIYNERMAIEHFEKAKKVIEFCRQRLGL........................................................... 128
3 -6.400[S] COG3246 Uncharacterized conserved protein  ali follow..  14  242.........................................................SMFSIGRMQLPYVAQAALAGGHVRVGLEDNIWLDRGVLARNGDLVERAATILTAMGCRI---------LTPQEVREKLKLLRR..................................... 315
4 -6.330[L] COG5655 Plasmid rolling circle replication initiator protein and truncated derivatives  ali follow..  13  85...CNWRKTMKRSVQTTKIVEEVIRQKPRARWLFLTLSVKNVFDGDQLDKSLKEMAIGFNRLMKRSTEITVNEKDGSYNQHMHVL............................................................................................ 178
5 -6.290[H] COG0314 Molybdopterin converting factor, large subunit  ali follow..  16  17..............EEYPWLAERDEDGAVVTFTGKVRNHNLGDSVLTLEHYPGMTEKALAEIVDEARNRWPLGLVTVIH-RIGELDEIVFIGVTSAHRSSAFEAGQFIMDYLKTRAPF........................................................... 124
6 -6.170[I] COG1250 3-hydroxyacyl-CoA dehydrogenase  ali follow..  14  57......KMSDEDRKRALSLIKGSGDAQADLVIEAVTEDETVKRKIYGQVCPV-ATNTSSLSITRLASATDRPERFMGIHPVMKLVELVRGIATEEETFKAAKEFVAHLDKTVTVAEDFPAFIVNRILLPMINEAIYTLYEGVGTVDAIDTAMKLGANHPMGPLQLADFIGLDTC... 239
7 -6.120[R] COG1831 Predicted metal-dependent hydrolase (urease superfamily)  ali follow..  13  3ILDNHFHVDPINGLF--LEAVKQFHRAGGTHLVVVYKSAHDYGFGGMKGEDFMRAMDFHVELVEIINKETPVKAYAGVHPAIGEVG-RPHYPVPEEIWEASIEIMKY---ALAKEADCAVQLHTESFDEEKFRELGRYVRE.................................... 177
8 -5.960[R] KOG2295 C2H2 Zn-finger protein  ali follow..  11  519....LRNLAPSITRSEIEAVCNRFSGYLRVAIADPLVERRWYRRGWITFMRDVNIKEICWGLNNQRLRDCEMGA---NRDLSRRVRPANGITAHKQVVRSDIKLCAKIALNLDEKFRL........................................................... 631
9 -5.890[C] COG1141 Ferredoxin  ali follow..  12  1MADFLPSPEQEDNRSGFEPLGGFLRDAPERSGFEPELGGILRQKGVYV----EITCIGCKHCAHVARNTFYIEPDYGRSRVIRAIDTCPVDCIHWVDYTELKNLEEDRKFQVIPVVGYPVDHAVATTEKRRRKQKSKNKKSRY.................................. 152
10 -5.860[DR] KOG1099 SAM-dependent methyltransferase/cell division protein FtsJ  ali follow..  15  6........RDKRDIYYRKAKEEGWRARSAFKLLQIDEEFNIVKRVVDLCAAPGSWSQVLSRQLYLP-AKSSAESKDGDLPLIVAIDLQPMAPIEGVIQVQGDITNARTAEVVIRHFDADLVVCDGAPDVTGLHDMDEFVQ..................................... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.