current user: public

If you have questions about the server, please let us know.

Query: PF14881.6; C5FUZ2_ARTOC/120-304; Tubulin domain, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst APELTPETVRYWSDFNRVFYNPRSIQQINEYDLGSQLVPFEDWSRGQSLFSELDGEHDLLDRDLRPFAEECDQLKGIQIFSGTDDAWGGFAASYVDRLKDEYGGKSIWTWAINGSSDPQREKRRLASANMARSLSEMCSQVTAFIPIAALPTRTPHYVRSDLHHIWYSSALISLVLESVSLPARLLast
1 -68.700[Z] KOG2530 Members of tubulin/FtsZ family  ali follow..  23  141IVGCLDEEVECWTDFSKSHYHPQSLYELNGL--WMDSQAFNNYGIGKDVFSEASR-GEEICDRLRFFVEECDHIQGIKFLVDDSGGFSAVAADFLENMADEYTNVPVLLYSVRTPMSQSSKKTVSNKLHDAISFSRLSSFCKLFTPIGLPSLTASKFLNLGDEKPYRSSAVYAAALHSSTIPFRM 326
2 -37.600[Z] KOG1375 Beta tubulin  ali follow..  16  53....EASSHKYVPRAILVDLEPGTMDSVPDNFIFGQSGAGNNWAKGH--YTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGGMGTLLISKVREEYPDRIMNTFSVVPS--PKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFLKLATPTYGDLNHLVSATMSGVTTSLR. 241
3 -37.100[Z] COG5023 Tubulin  ali follow..  17  53....EASSGKWVPRSINVDLEPGTIDAVPDNYIFGQSSAGNVWAKGH--YTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGGMGTLLISKIREEFPDRMMATFSVLPS--PKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQLKLNQPSYGDLNNLVSSVMSGVTTSLRY 242
4 -36.800[Z] KOG1376 Alpha tubulin  ali follow..  18  55....ETGAGKHVPRAVFVDLEPTVIDEVPEQLISGKEDAANNFARGH--YTVGKEIVDLCLDRVRKLADNCTGLQGFLVFNAVGGGTGGLGSLLLERLSVDYGKKSKLGFTIYPS--PQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRLDIERPTYTNLNRLISQIISSLTTSLRF 244
5 -36.400[Z] KOG1374 Gamma tubulin  ali follow..  14  54....QADDNHYIPRAVLIDLEPRVINNIENVFLSKHGGGAGNNWASG--FSQGEKVQEEVFDILDREADGSDSLEGFVLCHSIAGGTGGMGSYVLERLSERFPKKLIQTYSVFPNQD-EISDVVVQPYNSILTLKRLTKCADSVVVLDNTALNRIERLHIQTPTFTQINNLVSTIMSLSTTTLRY 245
6 -6.630[S] COG4474 Uncharacterized protein conserved in bacteria  ali follow..  7............................................TGYRIFDHKDPRVSIIKQAIRKDLIGYLENGVDWFIFTGNLGFEQWALEVANELKEEYPLQIATIFL-FETHGDRWNEKNKEVLSQFRAVDFLLEKTEGAYVFYDTENETNLKYFLKKAKDMPHYQLLLLTFDRL...... 165
7 -5.810[M] COG2335 Secreted and surface protein containing fasciclin-like repeats  ali follow..  18  28.......................................................................ETLKSFTVFAPNDDAFAKLPPGTIQTLVQNIPQTRILTYHVVPGKLKQ---------ADLAKLGTVTSVEGSPIKIDCADGFEVKNATVLAADIEADNGII--VIDTVILM... 132
8 -5.740[S] KOG4526 Predicted membrane protein  ali follow..  5..............................................................................................LKEIVKKYGKVALGVHFSVS-KNNVDVESLLEKYQIPWFSSKENPNPSLDLKLEEQGSVTSDNKTKQLAKSAGGALALAVLCNKALFPIRV 105
9 -5.680[S] KOG4068 Uncharacterized conserved protein  ali follow..  10  19.DNTWHSQKAAWQMWILLWCRENRQTSITINPELLESSLLHNSTIHRTLPLSVFREEDMVKQNLAEWTEKRNPKDVFWVYWRSISEWGNM---ILKWLSDMGREGSICTFYELQEQYKEVDCLDEVLLHKVLELLMKKGNIELM......................................... 160
10 -5.640[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  11  226.PKIGQITPAFVYDF------PASQAALAKINPADPADRFEVYFKGIELANGFHELDNPAEQLARFKADDYHLIAALEAGLPECAGVALGIDRLIMLALGEDHIDKVTAFPFPRA...................................................................... 349

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.