|
|
|
current user: public |
|
| Query: PF02961.14; C3XZ01_BRAFL/2-89; Barrier to autointegration factor, from PfamA32U |
| . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . | |||||||
| # | Score | Template | Links and tools | %id | First | SSTSQKHRDFVGEPMGDKPVTALAGIGGTLGGRLEEEGFDKAYVVLGQFLVLKKNEELFKEWLKSACNANSKQSGDCYTCLKEWCDAF | Last |
| 1 | -5.580 | IDP91448 nucleotidyltransferase/DNA polymerase involved in DNA repair [Vibrio vulnificus CMCP6] VV1_0391 [Vibrio vulnificus CMCP6] | ali follow.. | 22 | 172 | ..........RTSILKQLEVGDVWGVGKKISTRLKHMGINSAYDL........................................... | 206 |
| 2 | -5.240 | IDP01923 gene: srfC; putative virulence protein [Salmonella typhimurium LT2] STM1595 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] | ali follow.. | 13 | 320 | ..............LDNVDLLDIPVAPDSHPHPLWRA---KLGWMLAHY----RQQVQPDVLVICNALASRSQTSTAAHHLLEWVNA. | 385 |
| 3 | -5.230 | IDP90419 gene: euo; CHLPS Euo Protein [Chlamydia trachomatis D/UW-3/CX] CT_446 [Chlamydia trachomatis D/UW-3/CX] | ali follow.. | 6 | 100 | ..............YSVGQVASMLDVPEQKIYYATRIGAMKGERRGSAWVIHVSEVDRYRN........................... | 146 |
| 4 | -4.770 | IDP02430 hypothetical protein FTT1151c [Francisella tularensis subsp. tularensis SCHU S4] FTT1151c [Francisella tularensis subsp. tularensis SCHU S4] | ali follow.. | 15 | 21 | ...................................RRGMLELDIILAPYLFLTSEDSDMFDWLFKGVTPPQRYQQLIDKIIKEKKKF. | 89 |
| 5 | -4.660 | IDP95326 hypothetical protein A51_C0019 [Vibrio cholerae MZO-3] EAY41860 [Vibrio cholerae MZO-3] | ali follow.. | 12 | 42 | ...............................QQQSDVGSAYATFWLGVTQYKNRQHFEAGDTFLKAAEMGDPWAM--WPCDEKWLTK. | 113 |
| 6 | -4.660 | IDP95380 set238a-017 [Vibrio cholerae] | ali follow.. | 11 | 49 | ...............................QQQSDAGSAYATFWLGVAQYKNRQHFEAGQTFLQAAEMGDPWAM............. | 92 |
| 7 | -4.640 | IDP02304 gene: qoxA; quinol oxidase, subunit II [Bacillus anthracis str. `Ames Ancestor`] GBAA0703 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 18 | 169 | .TSVGPMNAFWVPELGGM-KYTMDGMIMDLYLQADKPGSYLGRNFSGEFEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVK..... | 257 |
| 8 | -4.600 | IDP91026 flavodoxin [Yersinia pestis KIM 10] y3142 [Yersinia pestis KIM10+] | ali follow.. | 14 | 78 | QVGFQPELRYGVIALGDSSYDNFCGAGRTFDELLQEQGATR---------------------IGERLEIDAIEHSEPEAISAPWVEQW | 144 |
| 9 | -4.560 | IDP93894 lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005558 [Yersinia enterocolitica subsp. enterocolitica 8081] | ali follow.. | 20 | 69 | .......................PGLHAHLGMLYGNTGTDLAMTEFNTEKSAFPESTPFMDFLMSKDKGAFK................ | 118 |
| 10 | -4.500 | IDP91819 gene: yjhQ; KpLE2 phage-like element; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4307 [Escherichia coli str. K-12 substr. MG1655] | ali follow.. | 15 | 71 | KGEMDSPLMHILAPLAVIPEYQGMGVG----GRLIRTGIEHLRLMGCQTVFVLGHATYYPRH.......................... | 128 |
FFAS is supported by the NIH grant R01-GM087218-01
|
|
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9. |