Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF03519.14; W0HTY6_9GAMM/17-94; Invasion protein B family, from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst GCDPSLLGNFDSHSTIALDFNDMPSIYISSSDDDIWLWSRIAEYQDTILEQCSYNLLKELLEGAEYIRGGHFSLAENELast
1 -39.900IDP93931 type III secretion system protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007703 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  39  17GRQDLINSQLDCHSTIQLELNESPPINVDLLTDDIILWCSIAECQMGHLEALGQNLLSELLETPGNFHIGQPALSFRE 95
2 -7.730IDP04002 gene: ipgA; IpgA, similarities to IpgE, putative chaperone [Shigella flexneri] CAC05806 [Shigella flexneri]  ali follow..  13  18........DFNDKNQAFILLEEQIPVCITDNDEYIFLTGLLNEHELF---TENIINPEHILI................ 68
3 -7.220IDP91487 putative type III export apparatus protein NosA [Vibrio parahaemolyticus RIMD 2210633] VP1697 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  9  19........IAGENGAYTIEVDQL-TLTIKQHSSWILWETALPLRFNEHLDYQQEQALKRCMQ................ 71
4 -7.060IDP00115 gene: VPA0551; hypothetical protein VPA0551 (gi 28900406) NT01VPA0514 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  18  61.................LSTTEEPDLWHVADDQSITHWIEIGEPEPDRIKKASRLAKQVKV................. 104
5 -5.150IDP93852 lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005559 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  17  105GADAALYITIVQYGTSYQILTSDTRVTANALKTGKLLWSGSATASSDEGNNSSGGIIGMLVQAA.............. 172
6 -5.040IDP91509 putative type III secretion protein [Vibrio parahaemolyticus RIMD 2210633] VP1665 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  20  21........DFSAAGRVQLSFEQSGTLHIEKHHDRLFL......................................... 49
7 -4.770IDP90410 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_663 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  20........EFDADGSYVFPISSLVRMRVRQNDEEIIISAFLGEIPAS---MDIEKAYARMME................ 71
8 -4.690IDP04314 gene: YPCD1.73c; hypothetical protein YPCD1.73c [Yersinia pestis CO92] YPCD1.73c [Yersinia pestis CO92]  ali follow..  13  23........SQDEYGLCELILNDRVVIMLRADENRLTLLGPILGFSGP---EARSAASQLFFC................ 75
9 -4.680IDP01023 gene: sseI; secreted effector protein [Phage Gifsy-2] STM1051 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  6  7..........SGCLPAIISNRRIYRIAWSDTPPEMSSWEKMKEFFCSTHQAEALECIWTICHPPAGTTREDVV..... 69
10 -4.290IDP92602 myosin light chain 2, putative [Toxoplasma gondii ME49] TGME49_097470 [Toxoplasma gondii ME49]  ali follow..  14  9....SRVGTPGICTVVLIDKSQRPIMNLHKVPLSATVWAIKSKVSE-RLKEVGRSLSAEVML................ 65
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 1 0 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;