Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public
If you have questions about the server, please let us know.

Query: PF03992.16; HMOB_BACSU/65-140; Antibiotic biosynthesis monooxygenase, from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst GFAVLNNIAVTQEGRPLFENRFKNRAGKVENEPGFEAIRVLRPLDSDTYVILTLWETESAFQDWQQSGSYKEAHKKLast
1 -36.900IDP02222 heme-degrading monooxygenase IsdG [Listeria monocytogenes EGD-e] lmo0484 [Listeria monocytogenes EGD-e]  ali follow..  24  2.IIVTNTIKVEKGAAEHVIRQFTGPTKDIAEVEGFLGFELWHSKPEEEVVVTSKWESEEAQRNWVKSDSFKKAHGR 86
2 -31.900IDP93953 hypothetical protein YE0340 [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001004718 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  13  9.RHIICELRCEPENRERVKELVLKFVEPARLETGCLYYDLYQKIEPDTFYIIDGWVNQEAVTSHAENPHVAEVMSD 84
3 -31.400IDP90999 hypothetical protein y1744 [Yersinia pestis KIM 10] y1744 [Yersinia pestis KIM10+]  ali follow..  13  3.IRVIASIVAKTEFIEEVKAALHQIIEPSREEKGNLQYDLHTEEQKGSFVFFERWASDEALEKHNKTEHFKQLVKA 78
4 -31.000IDP00080 gene: yneC; putative inner membrane protein NT01ST5073 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  15.HVTLVEINVHDDKVEQFIDVFRQNHLGSIKEPGNLRFDVLQDQVLTRFYIYEAYVDEQAVAFHKTTPHYKTCVEQ 90
5 -6.680IDP95449 set236a-051 [Undefined organism]  ali follow..  22  9........................................FRPMSEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKT 44
6 -4.860IDP95350 hypothetical protein [Vibrio cholerae] AHX36851 [Vibrio cholerae]  ali follow..  10  62.........LARNEHYEYCVINEGENLSNGDKEGFFITLDSVSESSVSFSYNTIWYSVN................. 111
7 -4.850IDP95388 set238a-025 [Vibrio cholerae]  ali follow..  10  62.........LARNEHYEYCVINEGENLSNGDKEGFFITLDSVSESSVSFSYNTIWYSVN................. 111
8 -4.630IDP05434 hypothetical protein lmo1913 [Listeria monocytogenes EGD-e] lmo1913 [Listeria monocytogenes EGD-e]  ali follow..  11  75GLYME--YLVEVNDSKTFQKQVNHLEKYFIAEDNFIKWEATDSTTTNAYQASEKFSFPS................. 142
9 -4.360IDP02785 gene: yaiY; putative inner membrane protein [Salmonella typhimurium LT2] STM0378 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  8..................KSLFSGKHRETSSTPGNIAYAI--------FVLFCFWAGAQLLNLLVHAPGIYEHLMQ 57
10 -4.100IDP95293 gene: aac(6`)-Ib; aminoglycoside 6`-N-acetyltransferase type Ib [Klebsiella pneumoniae] AAL93141 [Klebsiella pneumoniae]  ali follow..  16  27........................................LRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLAD 62
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 6 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Kolodny R, Sitbon E, Li Z, Godzik A. Using an alignment of fragment strings for comparing protein structures. Bioinformatics. 2007 Jan 15;23(2):e219-24.