current user: public

If you have questions about the server, please let us know.

Query: PF04826.13; ARMX3_MOUSE/110-363; Armadillo-like, from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst SPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTVTSRLNSSVQLAGLRLLTNMTVTNEYQHILANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKEYKEVILKLLIIFENINDNFKWEENEPAQNHFSEGSLFFFLKEFQVCADKVLGIESRHDFQVRVKVGLast
1 -36.300IDP91695 gene: KPNA1; importin subunit alpha-1 [Homo sapiens] NP_002255 [Homo sapiens]  ali follow..  16  200STMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVCSALQSLLHLLSSPKESIKKEACWTISNITANRAQIQTVIDANIFPALISILQTAEFR-TRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDYGLDKIEFLQSHENQEIYQKA. 496
2 -18.300IDP90382 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_350 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  92.........SSEALELLSEAI-ETQDLYEQLLILNAATS----------QLSKTSDKLLFKGLTASHPVIRLEAAYRLACMKNSKTIFLQLETEEADAYIHHLLSSPNNLTRNYVAYLIGEYKQKR--------FLPTLRSLLTSASPLDQEGALYALGKLE----------DSGSYPRIKALSS-RSNPEVVLAAAQTLLFLEKEEEALPILTNQKLLRALYTARFLSQEKGEELLLPIFYNATQEEIRLNTA 330
3 -17.100IDP90389 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_384 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  108.........DYRLVPIVLQAL-SDDSDTVREIAVQVAVMYG----------SSCLLRAVGDLAKNDSSQVRITAYRAAAVLEI--------QDLVPHLRVVVQNTQLDGTERREAWRSLCVLTRPHSKEYPEKCTEEQIRTLLAADHPEVQVATLQIILRGGRVFR------SSSIMESVQKLACNSLSARVQMQAAAILYLE------------GDPFGEDKLTEGLSATSSILCEAASLSKVQGMRSRVNLA 349
4 -10.500IDP06019 phospholipase A2 activating protein, putative [Toxoplasma gondii ME49] EEB01121 [Toxoplasma gondii ME49]  ali follow..  10  636...........KKIMEFDAQFPEDSPAHLTALEKQYLLDALESPSFMKKEFRACELDVIFEKLAVWPSSKAVPVMDVWRALALHPQYHAVHRKALRHLKEACASQADETPLILCCLRFLANLMDLTTNRTVMLRHANVVLESLASPNKNVRLTAASLLANFA--ATKEETEGRIKVLKLLRGLMEREGDADVFYRCLLAVLTILATPPQRLLRGACQEIDMADVLPPLNQNIPAEGRIGDAAQD.......... 893
5 -10.300IDP06032 beta-adaptin-like protein, putative [Toxoplasma gondii ME49] EEB01577 [Toxoplasma gondii ME49]  ali follow..  14  123..NDEDPRLRGLALRSLARKGASDPSPYVRRAAVMGMLKV--CKLLQELMATDEIRQRLHEALFDDDPQVTINAICALNELEAETGGLQVTKKIA----FLNRIKRFSEWGVCVILNLVASYQPETEEE--AFDVMNILDDKLKSSSAAVVLGCANCFLELTRGNAELRKQVYCRLKPPLLTLATTG-YPEIAHTILRHILLIVQTGGEDAVEIFAGE-KLQTLAAIATENNDMIAEIREYVCDADADIARQS. 408
6 -9.490IDP06029 adaptin N terminal region domain-containing protein [Toxoplasma gondii ME49] EEB01203 [Toxoplasma gondii ME49]  ali follow..  14  39.........GHFNAAQVKKELQDASVESKVTAMKRLLAAHAGGADVSALLPE------VVKAIAVPDLELKRLVYLFLIQYAEGNRDLALLS----INSFQKDLTDRNQVVRAAALKALASIRLLE----VVQLLVISLKRAAADCSPFVRRTAAQCVVKVALDQDQFEELKSI-----VLTLL-ADVEVSVVGAALIAFRELCL................................................. 215
7 -9.290IDP92583 beta adaptin protein, putative [Toxoplasma gondii ME49] TGME49_040870 [Toxoplasma gondii ME49]  ali follow..  253HANSAVVLSAIKVVMKLLDKVTNPDVVRAVHRKLCPPLVTLLSAEPEIQYVALRNIELIVQCKYNDPVYVKIEKLDILVRLVSEKNVDQVLSE------LKEYATEVDVDFVRKAVRCIGRCAI--KLDCAAERCVAVLLDLIQTKVNYVVQEAIVAIKDIFRKYPN----QYESMISTLCENLETLDEPAAKASMVWIVGEYVDRIDNADELLIVQLQLLTATVKLFLKKPAHTQDLMATEETYNPDLRDRA. 525
8 -9.130IDP04465 hypothetical protein [Yersinia pestis CO92] YPO1994 [Yersinia pestis CO92]  ali follow..  17  242.........NEKSRQLVHKVSLCNHREEIRLIAYEALLKHAQKKGNVSDI-----KSISEQAFKDQSLYIKNKISHSIGSMP............................................................................................................................................................................ 309
9 -8.200IDP95477 ELMO1 [Homo sapiens] AAL14466 [Homo sapiens]  ali follow..  12  85.............AQQLHERIQSSSMDAKLE-ALKDLASLSRDVTFAQEFINLDGISLLTQMVESGT-DMLSFTLTAFVELMDHGIVDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKV--IGQLIPHLQGSDQEIQTYTIAVINAL............................................................................................. 250
10 -8.020IDP92606 gamma-adaptin, putative [Toxoplasma gondii ME49] TGME49_113670 [Toxoplasma gondii ME49]  ali follow..  13  94.........QSEVLMLATNSIKNHPNQYVNGLALTALGNIGTGEMCGAIMTQ------VEDLLRCSNPFIRKKAALCGVRVVKRVGDCEE------LACLPALLADRNHGVLISACALITALAERDSLVSTMRTHIPTLVKSLKAGDAESSASLSDVLAHVATNTEGAKNVGNSVLYECVRTIMTIEDDPGLRVLGVNILGRFLSSRELNVKYV-----ALGTLQQVVRVDSKAVMRLLDCLKDQDLSLRRRA. 365

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.