current user: public
If you have questions about the server, please let us know.

Query: PF05635.11; K7WXD0_9NOST/8-110; 23S rRNA-intervening sequence protein, from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst EDLIVWQKAHQFVLEVYQITGNFPKSEIYGLASQFRRASISIPANIAEGFKKKGDLDKVRFMNIAQASLEECRYYLILTKDLGYANTSESMLKLQEVSRLLDSLast
1 -5.610IDP90783 gene: uppP; undecaprenyl pyrophosphate phosphatase [Yersinia pestis CO92] YPO0649 [Yersinia pestis CO92]  ali follow..  13  163..........................QCLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAV....................................... 200
2 -5.450IDP05305 gene: bacA2; undecaprenyl pyrophosphate phosphatase [Clostridium difficile 630] CD2986 [Peptoclostridium difficile 630]  ali follow..  10  167..........................QVLSAWPGMSRSASTIMGGWIAGLNSPTAAEFSFFLAV....................................... 204
3 -4.970IDP05110 N-acetylmuramoyl-L-alanine amidase (cell wall hydrolase) (partial) region relative to most database matches. [Clostridium difficile 630] CD2184 [Peptoclostridium difficile 630]  ali follow..  10  74......SGKYDLLVELHKADGTQCGTEVLYYGTEGLEYAKRVSNRLGELFENRGAKKRENLYILRNTNPVAIQIESFFVNDCNKANESGYDYIARLITEGILN 175
4 -4.820IDP02136 gene: metJ; transcriptional repressor protein MetJ [Yersinia pestis CO92] YPO0114 [Yersinia pestis CO92]  ali follow..  17  11.......................PYAEHGKKSKQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRK........... 79
5 -4.680IDP00138 conserved hypothetical protein BA_4159 [Bacillus anthracis str. Ames]  ali follow..  11  15................................ALLQADAEKILRLIKVQMDHLTMPQCPLYEEVLDTQMFGLSREVDFAVRLGLIAEEQGKVMLGELERELS. 84
6 -4.540IDP91581 hypothetical protein CBU_0080 [Coxiella burnetii RSA 493]  ali follow..  13  6KEKQIRENKRRYVNRLYNLIPRFENENKYSKKAQVPYSYIQI------GAAKQYIEKLKLLVKTTENSVQSLSSPITVSSDQPF................... 86
7 -4.430IDP90548 gene: rnpA; ribonuclease P protein component [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0960c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  8  31............................FYLNSYEKKIAVVASKKVGKAVVRNRSKRILRALFAKFERYLQDGKYIFVAKN---ITELSFSRLEKNLKWGLK. 102
8 -4.280IDP90120 unknown [Monkeypox virus] MPXV_ZAI1979_005_030 [Monkeypox virus]  ali follow..  16  29QDYRYWYFVAELTIGVYDINSTIIGECHMSESYIDRNANIVLTGAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTKYNSDLPESIHK.... 145
9 -4.080IDP06049 (dimethylallyl)adenosine tRNA methylthiotransferase [Helicobacter pylori J99] NP_222975 [Helicobacter pylori J99]  ali follow..  14  266...............LKMMRRGYSKEWFLNRVERLKALVVGISTDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRPFTEAGAWKERVPLEISS.... 351
10 -4.080IDP91026 flavodoxin [Yersinia pestis KIM 10] y3142 [Yersinia pestis KIM10+]  ali follow..  14  49...................................QHYVLVITSTTGQGDFPDSIASLFVAVRDQVGFQPELRYGVIALGDSSYDNFCGAGRTFDELLQEQGA 116
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Multiple flexible structure alignment using partial order graphs. Bioinformatics. 2005 Mar 3;