Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: PF10752.9; D3FXJ5_BACPE/1-83; Protein of unknown function (DUF2533 topsan), from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MSVHLQIAEQVTNHRRAQKEFLALDEKREAAIDRVVEDAKKGLHISLNEVNAITKEMNQIAQDFYFPPRKEVTTDMVREYINKLast
1 -5.720IDP04435 hypothetical protein YPCD1.91n [Yersinia pestis CO92] YPCD1.91n [Yersinia pestis CO92]  ali follow..  13  72VSVYKATNSFNSVCLGIKASLNSLDERKELTVQFTYSMVFDASKGIPNFSNELETSMGLLRIAPKKLSNSFKDKGIEHNYVN. 154
2 -4.990IDP90210 gene: m136R; m136R MYXV_gp140 [Myxoma virus (strain Lausanne)]  ali follow..  12  1...............................MERSPTYTVHDKRFSIVALNGQYDMVDDFGLSFSYTAIDDISKNVLEEYF.. 55
3 -4.630IDP02689 hypothetical protein FTT0903 [Francisella tularensis subsp. tularensis SCHU S4] FTT0903 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  19.................MLASCASKSEKLNELEQSQQQLQKEMTTIEKKADEAKQRADKYEKL.................... 64
4 -4.430IDP02660 hypothetical protein GBAA4615 [Bacillus anthracis str. `Ames Ancestor`] GBAA4615 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  29....................YDALQEKGYNPINQIVGYLLSGDPAYIPRHKDARSIIRKL-------ERDELIEELVKSYLKH 84
5 -4.340IDP05090 putative flagellar biosynthesis protein [Clostridium difficile 630] CD0230 [Peptoclostridium difficile 630]  ali follow..  10  37.....NLNRLNPKLEDISRELASIEIKRRQLLGDDVSISEVVENSNDEYLKEIYIDLKHILAL.................... 94
6 -4.280IDP91172 gene: pcrV; type III secretion protein PcrV [Pseudomonas aeruginosa PAO1] PA1706 [Pseudomonas aeruginosa PAO1]  ali follow..  13  231...........EKDNNPVGNFATTVSDRSRPLNDKVNE-------KTTLLNDTSSRYNS-------------AVEALNRFIQK 282
7 -4.250IDP91338 cytochrome c553 [Vibrio vulnificus CMCP6] VV2_0132 [Vibrio vulnificus CMCP6]  ali follow..  10  144.........HADGGSDPLDEASILAGQQKGYLITTLTQFHQGKRSADKKMDKAIKALSQ........................ 193
8 -4.200IDP90102 TNF-alpha-receptor-like protein [Monkeypox virus] MPXV_ZAI1979_005_002 [Monkeypox virus]  ali follow..  279IMPHSETVTLVGDCLSSVDIYILYSNTNTQDYETDTISYHMGNVLDVNSHMPASCDIHKLITNSQNPTH.............. 347
9 -4.150IDP90418 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_466 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  4....SALLPLLKKKKGFFLSILDLTQVEASLSPEDLIKVLRQKKTLLSCIEKVDHQIKKFRDSFSLALPQEVQEEL....... 75
10 -4.070IDP00522 gene: ampD; N-acetyl-anhydromuranmyl-L-alanine amidase YPO3423 [Yersinia pestis CO92]  ali follow..  83.EIIQYVPFDKRAWHAGVSVFAGRERCNDFSI--GIELEGTDLPFTPVQYQRLTEISAVLFAHYPITVERVAGHSEI...... 157

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98.