|
current user: public |
|
Query: PF10752.9; D3FXJ5_BACPE/1-83; Protein of unknown function (DUF2533 topsan), from PfamA32U |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 | |||||||
# | Score | Template | Links and tools | %id | First | MSVHLQIAEQVTNHRRAQKEFLALDEKREAAIDRVVEDAKKGLHISLNEVNAITKEMNQIAQDFYFPPRKEVTTDMVREYINK | Last |
1 | -5.720 | IDP04435 hypothetical protein YPCD1.91n [Yersinia pestis CO92] YPCD1.91n [Yersinia pestis CO92] | ali follow.. | 13 | 72 | VSVYKATNSFNSVCLGIKASLNSLDERKELTVQFTYSMVFDASKGIPNFSNELETSMGLLRIAPKKLSNSFKDKGIEHNYVN. | 154 |
2 | -4.990 | IDP90210 gene: m136R; m136R MYXV_gp140 [Myxoma virus (strain Lausanne)] | ali follow.. | 12 | 1 | ...............................MERSPTYTVHDKRFSIVALNGQYDMVDDFGLSFSYTAIDDISKNVLEEYF.. | 55 |
3 | -4.630 | IDP02689 hypothetical protein FTT0903 [Francisella tularensis subsp. tularensis SCHU S4] FTT0903 [Francisella tularensis subsp. tularensis SCHU S4] | ali follow.. | 4 | 19 | .................MLASCASKSEKLNELEQSQQQLQKEMTTIEKKADEAKQRADKYEKL.................... | 64 |
4 | -4.430 | IDP02660 hypothetical protein GBAA4615 [Bacillus anthracis str. `Ames Ancestor`] GBAA4615 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 19 | 29 | ....................YDALQEKGYNPINQIVGYLLSGDPAYIPRHKDARSIIRKL-------ERDELIEELVKSYLKH | 84 |
5 | -4.340 | IDP05090 putative flagellar biosynthesis protein [Clostridium difficile 630] CD0230 [Peptoclostridium difficile 630] | ali follow.. | 10 | 37 | .....NLNRLNPKLEDISRELASIEIKRRQLLGDDVSISEVVENSNDEYLKEIYIDLKHILAL.................... | 94 |
6 | -4.280 | IDP91172 gene: pcrV; type III secretion protein PcrV [Pseudomonas aeruginosa PAO1] PA1706 [Pseudomonas aeruginosa PAO1] | ali follow.. | 13 | 231 | ...........EKDNNPVGNFATTVSDRSRPLNDKVNE-------KTTLLNDTSSRYNS-------------AVEALNRFIQK | 282 |
7 | -4.250 | IDP91338 cytochrome c553 [Vibrio vulnificus CMCP6] VV2_0132 [Vibrio vulnificus CMCP6] | ali follow.. | 10 | 144 | .........HADGGSDPLDEASILAGQQKGYLITTLTQFHQGKRSADKKMDKAIKALSQ........................ | 193 |
8 | -4.200 | IDP90102 TNF-alpha-receptor-like protein [Monkeypox virus] MPXV_ZAI1979_005_002 [Monkeypox virus] | ali follow.. | 7 | 279 | IMPHSETVTLVGDCLSSVDIYILYSNTNTQDYETDTISYHMGNVLDVNSHMPASCDIHKLITNSQNPTH.............. | 347 |
9 | -4.150 | IDP90418 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_466 [Chlamydia trachomatis D/UW-3/CX] | ali follow.. | 8 | 4 | ....SALLPLLKKKKGFFLSILDLTQVEASLSPEDLIKVLRQKKTLLSCIEKVDHQIKKFRDSFSLALPQEVQEEL....... | 75 |
10 | -4.070 | IDP00522 gene: ampD; N-acetyl-anhydromuranmyl-L-alanine amidase YPO3423 [Yersinia pestis CO92] | ali follow.. | 6 | 83 | .EIIQYVPFDKRAWHAGVSVFAGRERCNDFSI--GIELEGTDLPFTPVQYQRLTEISAVLFAHYPITVERVAGHSEI...... | 157 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Plewczynski D, Rychlewski L, Ye Y, Jaroszewski L, Godzik A. Integrated web service for improving alignment quality based on segments comparison. BMC Bioinformatics. 2004 Jul 22;5(1):98. |