current user: public

If you have questions about the server, please let us know.

Query: PF11047.8; SOPD2_SALTY/1-319; Salmonella outer protein D, from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLILast
1 -109.000IDP91295 SopD-like protein STM0972 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  100  1MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLI 319
2 -32.600IDP01023 gene: sseI; secreted effector protein [Phage Gifsy-2] STM1051 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  1MPFHIG-SGCLPAIISNRRIYRIAWSDT--PPEMSSWEKMKEFFCSTHQAEALECIWTICHPPAGTTRE---------DVVSRFELLRTLAYDGWEENIHSGLHGENYFCILDEDSQEILS...................................................................................................................................................................................................... 109
3 -27.000IDP91560 gene: ECs0073; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB33496 [Escherichia coli O157:H7 str. Sakai]  ali follow..  13  7EQISIPSNTTKDPGLTNSQIIRMANLVKKTENFEELWETLRNLFQSDKQTAARQILKDAFYFQNSDDYSDGKARDKLTHWLIKFNELKEYAKDPENMAAKASLSPEGLCVSFFIGDEAIFTLELQLKKSTRTG.......................................................................................................................................................................................... 153
4 -16.700IDP01707 gene: sseJ; secreted effector protein [Salmonella typhimurium LT2] STM1631 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  1MPLSVGQG--FTSSISSEKFNAIKESAR--LPELSLWEKIKAYFFTTHHAEALECIFNLYHHQELNLTPV--------QVRGAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGENILSIEVECHPEAFGLAKEINKSHPKPKNISLSDSLGRMFEKTHHILPSYGQYFGGRFTNGFTWTEFLSSPHFLGKEMLNFAEGGSTSASYSCFNCIGDFVSNTDRQVASYTPSHQDLAIFLLGANDYMTLHKDNVIMVVEQQIDDIEKIISGGVNNVLVMGIPDLSLTPYGKHRKLKDESIAHNAVEELKEKYPQHKICY 330
5 -14.700IDP91599 gene: ECs0061; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB33484 [Escherichia coli O157:H7 str. Sakai]  ali follow..  16  1MKVSVPGMPATLLNMSNNDIYKMVSGDKMDNIFQRLWETLRHLFWSDKQTEAYKLLFNFVNKKAGNIN-NENEKEKFIHSLELFNELKTCA.................................................................................................................................................................................................................................... 102
6 -13.600IDP91558 gene: ECs4653; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38076 [Escherichia coli O157:H7 str. Sakai]  ali follow..  19  34IALSINDK---KYNVNSKDIENILDGKGDLFKKRTLWEFVRDLFPGSHIKEVKGLIYEFVTKVD--------------NKAEVFDKIKSLAKKEQQWRFSTKTD....................................................................................................................................................................................................................... 120
7 -10.500IDP05081 putative cell surface protein, internalin proteins [Listeria monocytogenes EGD-e] lmo2027 [Listeria monocytogenes EGD-e]  ali follow..  168.............................................................................................................................................................................................................................DFTGMPDLSQLYMADMMITSDVPDFHTIPKLSTLDLSHNQLTNLPDFQNLTNLAELNLSFNNLTNTMTNFTNLLNNLNLDYNHLNELPSN........ 260
8 -9.870IDP05561 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2026 [Listeria monocytogenes EGD-e]  ali follow..  65.............................................................................................................................................................................................................TIQKIHVFGADSIPNK-ISDYKNLTALEANYGTITEVPESVGSLKELVTLNVDENNLQEFPMV-QLPKLEVLYISRGNITEIPTTLASHLKVLDVSNQKLVTIPDSILTTNWK. 180
9 -9.690IDP95476 internalin [Listeria monocytogenes EGD-e] NP_465993 [Listeria monocytogenes EGD-e]  ali follow..  179................................................................................................................................................................................................................YMSEMLITSDELPNFNNIPLLITLDLSSNQLTTIPD-FQNIPNLTFLDLNANLLTNTPDFQNLPKLTDLNLRHNNLTGTMVNYTNLLESLNLDYNFLTELPSN........ 282
10 -9.200IDP91618 gene: ECs2674; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36097 [Escherichia coli O157:H7 str. Sakai]  ali follow..  195...............................................................................................................................................................................................................DWIEMLSLVYNELDSIQVPESCKELELDFNNLTEFPQVPD---GITLISVNNNLISHIDSFPPK--AKKIFISHNKLSETPA-IPDTAKVFDCGYNKIQEIRYFPKNLKEA. 299
11 -9.100IDP91619 gene: ECs2672; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36095 [Escherichia coli O157:H7 str. Sakai]  ali follow..  235...................................................................................................................................................................................................................................GITLISVNNNLISYIDSFPP---KAKKIFICHNKLSEIPALP--DTAKVFDCSENNIKEIRW-FPKNLKEAYIEYNKIEVIPAIPGNLKLL. 319

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35