current user: public

If you have questions about the server, please let us know.

Query: PF11944.8; Y2971_PHOPR/1-125; Protein of unknown function (DUF3461 topsan), from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MYPHLTSIGIEQPEAIERYSLRQEAANDILKVYFAKNKGELFAKSVKFKFPRQRKSVLVNSGSREYKEITEINRTLTHIIDELDIITKRKHTEVDIKKKILGDLRHLERVVSHKISEIEADLEKLLast
1 -71.700IDP00879 gene: yaeH; putative cytoplasmic protein STM0211 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  63  1MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDRGEFFAKSVKFKYPRQRKTVVADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDLRHLESVVANKISEIEADLDKL 125
2 -5.860IDP91677 gene: M1; matrix protein 1 [Influenza A virus (A/Puerto Rico/8/34(H1N1))] FLUAVs7gp1 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]  ali follow..  11  192..........................................................MAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK...... 252
3 -5.850IDP04288 gene: YPCD1.08c; hypothetical protein YPCD1.08c [Yersinia pestis CO92] YPCD1.08c [Yersinia pestis CO92]  ali follow..  10  2..................YKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAKNPELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPE........... 97
4 -5.450IDP91890 hypothetical protein SpneCM_06068 [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100006068 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  21....................................................KNRQTITDEVLNTTDRVQAIKDDVDIIQNSLQIINQQKELIKEYQEDLTYKFKVLEKDIQTRLAVIKEMQGTE 93
5 -4.930IDP01826 gene: zraP; zinc resistance protein [Salmonella typhimurium LT2] STM4172 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  43................................................PLTTEQQATAQKIYDDYYTQTSALRQQLISKRYEYNALLTASSPDTAKINAVAKEMESLGQKLDEQRVKRDVAMAQA 119
6 -4.920IDP05582 putative lipoprotein [Bacillus anthracis str. Ames] BA_1978 [Bacillus anthracis str. Ames]  ali follow..  10  60LYSQILQEGKDHNDAVMKKIEQATANVDDREKVLKNEKEML--EKAQKETKSVQGNIEKLEDKKLQKQAKAVEESYKNRYDAFQKMNENYTKALATEKELYEKLKVKEKEIGEKVKAVNELTVEA 185
7 -4.700IDP05013 hypothetical protein CD0238 [Clostridium difficile 630] CD0238 [Peptoclostridium difficile 630]  ali follow..  14  10................................................LYKDISLKIINFIEKMEYKNISFQLDERQNIIDSISEVDKSEFIQLYDSMELFEIDAKIRDALQEQLSEVKKELHEY 86
8 -4.700IDP00912 gene: fhuD; iron-hydroxamate transporter substrate-binding subunit STM0193 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  54....ITPYGVADVPNYKLWVSEPPLPDSVIDVGLRTE-----PNLELLTEMKPSFMVWSAGYGPSPEKLARIAPGRGFDFSDGKKPLAVARRSLVELAQTLNLEAAAEKHLARFIASQKPHFIR. 171
9 -4.450IDP95249 ferric acinetobactin binding protein [Acinetobacter baumannii ATCC 17978] YP_001085407 [Acinetobacter baumannii ATCC 17978]  ali follow..  5..DFLDQLNVPIMDYIPHFLEKYKKDAQIQDLGAIVQ-----PNMERIYALKPDLILMTPLHVNQYQELSKIAPTIKDHMMTLGKIFNKEDLARQKVSELDEQVKQVQAVTANR........... 132
10 -4.410IDP01090 gene: deoC; deoxyribose-phosphate aldolase STM4567 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  85............................................................GNDDIDIALAETRAAIAYGADEVDVVFPYRALIAGNEQVGFDLVKACKDACAAANVLLKVIIET. 148

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.