current user: public

If you have questions about the server, please let us know.

Query: PF13053.6; Q81Q33_BACAN/1-89; Protein of unknown function (DUF3914 topsan), from PfamA32U

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst MQIGSNIHTLSQPTKITPSNLEHNTISSTKLESKKVNDPIKFDIRSSEKEMKQPEHKFNELDLWKMLKDKGVPLWIILEMLQKVRKEKELast
1 -5.580IDP90684 gene: ribA; riboflavin synthase subunit alpha [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1218c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  133...GVSLTINEILKNGIRLTIIPITFKETLFKDYQVGRKINIESDLLARYIYAQLQGKNKGLSWEEVERISY................. 201
2 -5.160IDP00327 gene: aroC; chorismate synthase Cj1634c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  1......MNTFGTRLKFTSFGESHGVAVGCIIDGMPAGVKFDEEFLQNELDKRKGGSKFAESDKAQVLYTTGHPIAIVVFNENAHSKDYD 93
3 -5.120IDP91244 HP0663 [Helicobacter pylori 26695]  ali follow..  21  1......MNTLGRFLRLTTFGESHGDVIGGVLDGMPSG--IKIDYALLENEMKRRQGGRNVFITPRKEDDKGTPIGFLIHNQRARSKDYD 94
4 -5.090IDP00162 gene: tcpF; toxin co-regulated pilus biosynthesis protein F VC0837 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  55IKIGMSRDYLENCVKVTSQDMFYDAYPSTESDGAKTRTKEDFSARLLAGDYDSLQKLYIDFYLAQTTFDWEIPTRDQIETLVNYANE.. 144
5 -4.690IDP00315 gene: aroC; chorismate synthase CBU_0874 [Coxiella burnetii RSA 493]  ali follow..  1....MSGNSFGKLFTVTTAGESHGPALVAIVDGCPAG--LSLTEADIQPDIDRRKTGKSRFTSQRRESDQGTPIALLIENADQRPRDYS 96
6 -4.680IDP92635 gene: elaA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2267 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  21LQLRCAVFVVEQNCPYQDIDGDDLTGDNRHILGWKNDELVAY-ARILKSDDDLEPVVIGRVIVSEALRGEKVGQQLMSKTLETCTHH.. 106
7 -4.510IDP91285 gene: aroC; chorismate synthase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] SPA0480 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]  ali follow..  1....MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPG--IPLTEADLQHDLDRRRPGTSRYTTQRREPDQGTSIGLLIENTDQRSQDYS 96
8 -4.460IDP91165 gene: aroC; RecName: Full=Chorismate synthase; AltName: Full=5-enolpyruvylshikimate-3-phosphate phospholyase VC_2116 [Vibrio cholerae]  ali follow..  1....MAGNSIGQHFRVTTFGESHGIALGCIVDGCPPG--LTISEADLQVDLDRRRPGTSRYTTQRREPDEGTSIGLLIENTDQRSKDYS 96
9 -4.420IDP91303 gene: aroC; chorismate synthase STM2384 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1....MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPG--IPLTEADLQHDLDRRRPGTSRYTTQRREPDQGTSIGLLIENTDQRSQDYS 96
10 -4.370IDP04231 gene: aroC; chorismate synthase [Clostridium perfringens ATCC 13124] CPF_0690 [Clostridium perfringens ATCC 13124]  ali follow..  18  3.......GVWGNKIKLSIFGESHGEGIGIVIDGIEPG--IKINMDNIEKDMERRAPGRNSLSTQRKEGDKGAPISMIIRNTDKRSRDYS 95

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.